TO78M 4688030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : 78M_scaffold23_1
Annotathon code: TO78M_4688030
Sample :
  • GPS :-30,146783N -43,2916E
  •  : Rio de Janiero-Buenos Aires station 78 MESO -
  • (-MESOm, 5°C, 0.2-3 microns)
Authors
Team : BioCell2014
Username : caiane
Annotated on : 2015-02-02 17:38:32
  • Diaz Loriane
  • bruat camille

Synopsis

  • Taxonomy: Gammaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1236
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Gammaproteobacteria - Order:
    Bacteria; Proteobacteria; Gammaproteobacteria;

Genomic Sequence

>78M_scaffold23_1 TO78M_4688030 Genomic DNA
TCCCTAACTTGTTTCTGCAATTCTGCAATCAAACTCATGATTAAAATCGCTCCAACTCAGGATGAGGGAGTTCACCATCATGAACATGCATATTTCCTAA
TTCAGCACAGCGATGAAGAGTCGGCACGGCTTTACCAGGATTAAGCAATGAGATTGGGTCAAAGGCGTTCTTGATTTGATGAAAAACATCTAATTCAGCA
CTGCTATATTGATGGCACATAGCATCTAATTTTTCAATACCAACACCATGTTCCCCTGTAATCGAACCTCCCATTTCAACACAAAGCTTCAATATATCCA
TACCAAAAGCTTCTGTCTTCTCGAGCTCTCCTGGTCGACTTGCGTTATACAATATGAGTGGATGAAGATTACCATCACCTGCATGAAAAACATTAGCTAC
ACGTAATTTGTAGTGCGCAGATAGTTCACTTATTTTTTCAAGAACGGTAGCTAAGTGTCGTTTAGGTATGGTTCCATCCATACAATAATAATCTGGAGAT
AGCCTCCCTACAGAAGGGAAAGCTGCCTTGCGTCCCTTCCAAAAAAGTAAACGCTCATCTTCATTTTCTGAGACCCTTGTAGTGGTCGCATTCGAAAGCA
AGCTGAGAACCTTATTCAAATCTTCATTTACCGAATCTATAGCTCCATCAAGTTCGCAAAGCAGCAGTGCTTGAGCATCTAAAGGGTAGCCTGGATGTGC
AAAAGCTTCGGAAGCCTCTATTGCAAATTTATCCATCATCTCGAGACCAGAAGGTATGATGCCGTTCTTTATAATTTCAGCCACTGTATCGGCACAATCC
CTAACACTACTAAAGCCAGCCATAACTAGTCTAGCAAGCTCAGGTTTTGGAGTTAACTTCACAGTAATCTCTGTTATAACACCTAGTAAACCTTCTGATC
CGT

Translation

[3 - 860/903]   indirect strand
>TO78M_4688030 Translation [3-860   indirect strand]
GSEGLLGVITEITVKLTPKPELARLVMAGFSSVRDCADTVAEIIKNGIIPSGLEMMDKFAIEASEAFAHPGYPLDAQALLLCELDGAIDSVNEDLNKVLS
LLSNATTTRVSENEDERLLFWKGRKAAFPSVGRLSPDYYCMDGTIPKRHLATVLEKISELSAHYKLRVANVFHAGDGNLHPLILYNASRPGELEKTEAFG
MDILKLCVEMGGSITGEHGVGIEKLDAMCHQYSSAELDVFHQIKNAFDPISLLNPGKAVPTLHRCAELGNMHVHDGELPHPELERF

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

La séquence de 903pb a généré 3 ORFs putatifs.

Nous avons choisi l'ORF b), car lors du blastp dans NR il présentait de nombreux homologues (plus de 5000) tandis que les deux autres ORFs n'étaient associés à aucune séquence homologue. Il est situé sur le brin indirect dans le 3ème cadre de lecture. Aucun des 2 Orfs a)1 et a)2 ne sont codants puisqu'ils ne présentaient pas d'homologues.


L'ORF retenu a une taille de 861 pb (286aa), il commence dès la 3ème position de la séquence. Il ne serait donc pas complet en 5'. L'alignement multiple confirme que la séquence protéique de l'ORF est bien tronquée en N-ter : il manquerait entre 192 et 237 aa en N-ter.

L'ORF est complet en 3' : il est terminé par un codon stop. Les homologues de l'ORF présentés dans l'alignement multiple se terminaient approximativement à la même position que l'ORF, ce qui conforte cette idée.


Les résultats obtenus par Blast et INTERPRO prouvent le caractère codant de l'ORF. Les blastp présentent beaucoup d'homologues, en effet nous avons fait un blastp dans NR à 5000 résultats qui présente uniquement des homologues à notre séquence protéique.


Le domaine choisi parmi ceux générés par Interpro présentait la fonction oxydase liée à FAD, l'ORF semble donc coder pour une protéine présentant cette fonction.

Le blastp confirme ces résultats, en présentant plus de 3555 homologues (dans NR) et 2 homologues (dans SP) présentant la fonction de glycolate oxydase liée à FAD. C'est une déshydrogénase qui élimine un déchet issu de la photorespiration, le glycolate par une activité catalytique dans le peroxysome. Cette réaction correspond à un processus catabolique (justification des GO). L'alignement multiple montre que le domaine protéique est présent et conservé chez les homologues de notre séquence (120 positions plus ou moins conservées sur les 261 du domaine).


SP génère des homologues correspondant à la sous unité GlcD de la proteine, notre ORF ne code que pour une partie de la sous unité d'une glycolate oxydase (de 350 aa tandis que notre séq 288aa). Ces résultats sont confirmés par l'alignement multiple : les homologues présentant la fonction de glycolate oxydase liée à FAD sont beaucoup plus longs en leur extremité Nter (de 196 à 245aa) que notre séquence protéique. Cela signifie que la partie tronquée de notre séquence protéique est en fait la partie de la sous-unité manquante.



Les séquences protéiques présentant les meilleurs valeurs dans tax report (e values de 1e-168 à 1e-31 scores de 488 à 130) sont issues des gammaprotéobactéries, que nous avons choisies comme groupe d'étude pour la construction de notre arbre.


Les arbres obtenus confirment l'assignation taxonomique de la protéine aux gammaprotéobactéries, en isolant l'ORF traduit au sein d'un clade avec les gammaprotéobactéries. Les valeurs de bootstrap appuient la robustesse des noeuds de cette phylogénie.


ORF finding

PROTOCOLE:

a) SMS ORF finder ; initiation : any codon - cadres : 1+2+3 - min_60aa - Brin : direct - code génétique: standard

a) SMS ORF finder ; initiation : any codon - cadres : 1+2+3 - min_60aa - Brin : inverse - code génétique standard


Pour le choix de notre séquence d'étude, nous avons préalablement effectué un blastx de différentes séquences génomiques afin d'estimer le nombre d'homologues que présenterait notre séquence putative. La séquence  <Rio de Janiero-Buenos Aires station 78 MESO> présentait de nombreux homologues. Nous l'avons donc sélectionnée.


ANALYSE DES RÉSULTATS:


Ci-dessous l'analyse des ORFs résumée sous forme de tableau :



          |    Taille     |  Taille  |  Brin   | position  |  position  |  ORF complet  |  ORF complet  | nombre de hits   |

          | (nucléotides) |   (aa)   |         | de début  |   de fin   |     en 5'     |     en 3'     |blast NR  EV<1E-10|

    ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

          |               |          |         |           |            |               |               |                  |

  ORF a)1.|    183        |    60    |  direct |     492   |     674    |      oui      |      oui      |       0          |

    ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

          |               |          |         |           |            |               |               |                  |

  ORF a)2.|      213      |   71     | direct  |    690    |    902     |      oui      |      non      |       0          |

    ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

          |               |          |         |           |            |               |               |                  |

  ORF b)  |    861        |    286   |indirect |     3     |     863    |      non      |      oui      |       +5000      |

    ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|



ANALYSE DES RÉSULTATS:


Les trois ORFs sont identifiés dans le cadre 3 de lecture.

Les ORFs a)1 et a)2 sont complets en 5', cela signifie qu'ils sont précédés d'un codon stop; au contraire l'ORF b) est incomplet en 5', ainsi aucun codon stop ne le précède et son codon initiateur n'est peut être pas dans la séquence de l'ORF , tronqué en 5'.


Les ORFs a)1 et b sont complets en 3' ceci manifeste la présence d'un codon stop terminant la séquence de l'ORF. L'ORF a)2 est lui, tronqué en 3', sa séquence est ainsi inachevée et ne comporte pas de codon stop.



Tout d'abord nous allons discuter de la taille des différents ORFs. La taille étant un critère important dans le choix de l'ORF puisque plus un ORF est long plus il sera intéressant pour notre étude (notamment pour les prochaines étapes, par exemple avec le pourcentage de recouvrement pour les homologues).

On remarque que les ORFs a)1 et a)2 ont une taille tout juste supérieure à la taille "seuil" sélectionnée (60 codons). Ce seuil ne signifie pas que les séquences de moins de 60 codons ne sont pas réelles, il indique simplement que la probabilité de trouver une séquence nucléotidique codante est plus élevée lorsque cette séquence est constituée de plus de 60 codons. L'ORF a)1 est constitué de 183nt (60aa et codon stop en 3') et l'ORF a)2 de 71aa.

Au contraire, on note que l'ORF b est très long, avec une taille de 861 nt (286 aa et un codon stop en 3'). Ce premier critère favorise donc l'ORF b).



La recherche d'homologues nous permettra d'obtenir des informations sur le caractère codant de l'ORF. En effet si nos ORFs présentent plusieurs homologues significatifs (e value basse < 1e-10, pourcentage d'identité élevé 30%, pourcentage de recouvrement élevé 60%) en plus de leur taille crédible (ici entre 60 et 286 aa), ils pourront être considérés comme codants.

Nous effectuons des blastp dans NR pour chacune des séquences protéiques correspondant à la traduction de nos ORFs.

- L'ORF a)1 ne présente aucun homologue. Cette information croisée avec celle de sa petite taille (qui est bien définie puisqu'il est complet en 5' et en 3') nous fait penser que cet ORF est un faux positif et que celui-ci n'est pas codant.

- L'ORF a)2 est associé à deux résultats dans NR, cependant ces deux résultats ont des e-values très élevées (6.9 et 7.6), des pourcentages d'identité assez faibles (57% et 38%), ainsi qu'un pourcentage de recouvrement faible alors que la séquence est déjà de petite taille (42% et 66% pour 71aa). Par conséquent, nous ne pouvons pas les considérer comme des homologues, et quand bien même deux homologues auraient été un résultat fragile pour supposer un caractère codant pour cet ORF. Aussi, il est fort probable que cet ORF ne soit pas codant d'autant que lui aussi est de courte taille.


Ces deux ORFs peuvent être des faux positifs (de motif mais pas de fonction), ou peuvent correspondre à des séquences orphelines, que nous n'avons pas encore découvertes ni annotées (ORFans).  


- Enfin l'ORF b) présente de nombreuses séquences dans NR. Sur 5000 résultats, la séquence avec la e-value la plus faible est de 7e-31, c'est encore un très bon résultat qui fait d'elle et donc de tous les résultats précédents des séquences homologues à l'ORF (à partir d'un facteur de 1e-10 pour la e-value nous ne prenons presque aucun risque en affirmant que c'est certainement un homologue). Le seuil de E-value pour cette séquence se trouvera dans un blastp à 10000 résultats affichés.



Pour notre étude, l'ORF doit être codant, ainsi nous ne pouvons choisir que l'ORF b) car nous sommes sures qu'il est codant, et qui plus est, présente la meilleure taille.


Nous allons étudier plus en détail l'ORF b) sélectionné : puisqu'il est incomplet en 5', nous aurons du mal à supposer la position du codon d'initiation car il peut se trouver sur la partie de la séquence nucléotidique tronquée en 5'. Nous pouvons en revanche regarder les méthionines présentes sur sa séquence traduite (protéique) constituant l'expression de codons d'initiation putatifs.

Nous avons relevé six positions de méthionines pouvant constituer l'initiation d'une région codante, ces positions sont relatives au sens 5' vers 3' :

27, 55, 56, 141, 203, 221. Une dernière position était possible mais peu probable car elle était proche de l'extrémité 3'(donc petite protéine peu plausible).


Nous pouvons identifier la méthionine initiatrice (ou codon alternatif) plus précisément grâce à alignements multiples avec les séquences homologues à cet ORF. Notre alignement ne nous a pas permis de déterminer sa position exacte mais nous savons qu'elle se trouve entre 237 et 192 acides aminés en aval de l'extrémité N-ter de notre séquence protéique.

Notre ORF est complet en 3', terminé par un codon stop : TAA.



L'ORF n'étant pas complet en 5', on ne peut calculer la masse moléculaire de la protéine pour laquelle il code, puisque l'on ne connait pas sa taille complète.

RÉSULTATS BRUTS:

a) brin direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

1. >ORF number 1 in reading frame 3 on the direct strand extends from base 492 to base 674.
TCTGGAGATAGCCTCCCTACAGAAGGGAAAGCTGCCTTGCGTCCCTTCCAAAAAAGTAAA
CGCTCATCTTCATTTTCTGAGACCCTTGTAGTGGTCGCATTCGAAAGCAAGCTGAGAACC
TTATTCAAATCTTCATTTACCGAATCTATAGCTCCATCAAGTTCGCAAAGCAGCAGTGCT
TGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
SGDSLPTEGKAALRPFQKSKRSSSFSETLVVVAFESKLRTLFKSSFTESIAPSSSQSSSA
*

2. >ORF number 2 in reading frame 3 on the direct strand extends from base 690 to base 902.
CCTGGATGTGCAAAAGCTTCGGAAGCCTCTATTGCAAATTTATCCATCATCTCGAGACCA
GAAGGTATGATGCCGTTCTTTATAATTTCAGCCACTGTATCGGCACAATCCCTAACACTA
CTAAAGCCAGCCATAACTAGTCTAGCAAGCTCAGGTTTTGGAGTTAACTTCACAGTAATC
TCTGTTATAACACCTAGTAAACCTTCTGATCCG

>Translation of ORF number 2 in reading frame 3 on the direct strand.
PGCAKASEASIANLSIISRPEGMMPFFIISATVSAQSLTLLKPAITSLASSGFGVNFTVI
SVITPSKPSDP



b) brin indirect

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 863.
GGATCAGAAGGTTTACTAGGTGTTATAACAGAGATTACTGTGAAGTTAACTCCAAAACCT
GAGCTTGCTAGACTAGTTATGGCTGGCTTTAGTAGTGTTAGGGATTGTGCCGATACAGTG
GCTGAAATTATAAAGAACGGCATCATACCTTCTGGTCTCGAGATGATGGATAAATTTGCA
ATAGAGGCTTCCGAAGCTTTTGCACATCCAGGCTACCCTTTAGATGCTCAAGCACTGCTG
CTTTGCGAACTTGATGGAGCTATAGATTCGGTAAATGAAGATTTGAATAAGGTTCTCAGC
TTGCTTTCGAATGCGACCACTACAAGGGTCTCAGAAAATGAAGATGAGCGTTTACTTTTT
TGGAAGGGACGCAAGGCAGCTTTCCCTTCTGTAGGGAGGCTATCTCCAGATTATTATTGT
ATGGATGGAACCATACCTAAACGACACTTAGCTACCGTTCTTGAAAAAATAAGTGAACTA
TCTGCGCACTACAAATTACGTGTAGCTAATGTTTTTCATGCAGGTGATGGTAATCTTCAT
CCACTCATATTGTATAACGCAAGTCGACCAGGAGAGCTCGAGAAGACAGAAGCTTTTGGT
ATGGATATATTGAAGCTTTGTGTTGAAATGGGAGGTTCGATTACAGGGGAACATGGTGTT
GGTATTGAAAAATTAGATGCTATGTGCCATCAATATAGCAGTGCTGAATTAGATGTTTTT
CATCAAATCAAGAACGCCTTTGACCCAATCTCATTGCTTAATCCTGGTAAAGCCGTGCCG
ACTCTTCATCGCTGTGCTGAATTAGGAAATATGCATGTTCATGATGGTGAACTCCCTCAT
CCTGAGTTGGAGCGATTTTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
GSEGLLGVITEITVKLTPKPELARLVMAGFSSVRDCADTVAEIIKNGIIPSGLEMMDKFA
IEASEAFAHPGYPLDAQALLLCELDGAIDSVNEDLNKVLSLLSNATTTRVSENEDERLLF
WKGRKAAFPSVGRLSPDYYCMDGTIPKRHLATVLEKISELSAHYKLRVANVFHAGDGNLH
PLILYNASRPGELEKTEAFGMDILKLCVEMGGSITGEHGVGIEKLDAMCHQYSSAELDVF
HQIKNAFDPISLLNPGKAVPTLHRCAELGNMHVHDGELPHPELERF*


Multiple Alignement

PROTOCOLE:

a)  Alignement multiple avec l'outil muscle - paramètre : full mode

b)  Alignement multiple avec l'outil gblocks - paramètres : Allow smaller final blocks - Allow less strict flanking positions



ANALYSE DES RÉSULTATS:


- Choix des séquences


Nous avons choisi de sélectionner 27 séquences de gammaprotéobactéries pour représenter au mieux notre groupe d'étude. Nous avons sélectionné au moins une séquence de chaque sous-ordre et des e values hétérogènes (de 1e-168 à 2e-97) pour représenter au mieux la diversité de nos résultats.

De même, nous avons sélectionné pour notre groupe externe au moins une séquence issue de chaque ordre au sein des protéobactéries, autres que l'ordre des gammaprotéobactéries, soit 11 séquences en tout.




- Analyse des alignements


     a) Muscle


On retrouve quelques zones bien conservées :


zone 1 (commence à la position 237 de l'alignement, finit à 252) : sur 16 positions, 6 sont parfaitement conservées (mêmes acides aminés sur la même position), 4 positions comportent des acides aminés de la même famille (substitution conservatrice)


zone 2 (commence à la position 283 de l'alignement, finit à 293) : sur 11 positions, 4 sont parfaitement conservées (mêmes acides aminés sur la même position), 6 comportent des acides aminés de la même famille (substitution conservatrice).


zone 3 (commence à la position 314 de l'alignement, finit à 322): sur 9 positions, 5 sont parfaitement conservées (mêmes acides aminés sur la même position), 2 présentent plusieurs acides aminés de familles différentes, mais variant peu.


zone 4 (commence à la position 362 de l'alignement, finit à 385) : sur 14 positions, 10 sont parfaitement conservées (mêmes acides aminés sur la même position), 4 positions comportent des acides aminés de la même famille (substitution conservatrice)


zone 5 (commence à la position 409 de l'alignement, finit à 424) : sur 16 positions, 12 sont parfaitement conservées (mêmes acides aminés sur la même position), 3 positions comportent des acides aminés de la même famille (substitution conservatrice)


zone 6 (commence à la position 454 de l'alignement, finit à 462) : sur 9 positions, 7 sont parfaitement conservées (mêmes acides aminés sur la même position), 1 position comporte un acide aminé de la même famille (substitution conservatrice)



L'ORF est bien aligné avec les autres séquences, il s'intègre bien à la famille de ses homologues.

Il a subi les mêmes délétions ou insertions que les autres séquences. On observe en effet au niveau de la position A (325eme aa) une indel, retrouvée dans l'ORF mais aussi dans la majeure partie des séquences homologues (37 sur un total de 38 séquences).


Il est cependant tronqué en Nter, étant donné que les séquences de ses homologues commencent bien avant lui, qu'il apparaît beaucoup plus loin dans l'alignement (à la position 237 de l'alignement, alors qu'un de ses homologues commence à la première position, tandis que les 36 autres commencent de la 17ème à la 45ème position de l'alignement).

L'ORF est donc tronqué en son extrémité Nter d'une région comprise entre 237 positions (si on le compare à la protéine la plus longue) et 192 positions (si on le compare à la protéine la plus courte). Néanmoins 27 séquences commencent par une méthionine en position 22 de l'alignement, ainsi il est fort probable que si notre séquence protéique n'était pas tronquée en N-ter, elle présenterait cette méthionine à cette position et elle constituerait la méthionine initiatrice. Dans ce cas notre séquence serait tronquée de 215 aa en N-ter. Cependant, nos arbres phylogénétiques nous apprennent que les homologues les plus proches de notre séquence sont les gammaprotéobactéries n°1 et n°3, hors ces deux séquences présentent une méthionine initiatrice sur une position différente des 27 autres séquences (sur la position 44).


On a placé sur l'alignement multiple le domaine généré par Interpro, choisi pour appartenir à l'ORF (placé de la première position de l'ORF traduit à sa 261ème position, étant donné que le domaine mesure 260aa mais que l'alignement a généré une indel dans la séquence protéique correspondant à l'ORF).


On constate que nos six zones conservées sont contenues dans le domaine, mais ne représentent que 75 positions sur la longueur totale de 261 positions du domaine, ce qui n'est pas significatif.

Sur les 261 positions du domaine, on recense :

- 62 sont parfaitement conservées (mêmes acides aminés sur la même position)

- 38 positions comportent des acides aminés de la même famille (substitution conservatrice)

- 20 présentent plusieurs acides aminés de familles différentes, mais variant peu.

Sur les 261 positions du domaine, 120 sont donc plus ou moins bien conservées (120_62+38+20). Ceci est assez significatif pour pouvoir affirmer que le domaine est bien conservé entre les séquences.


L'ORF code pour une partie de la sous unité de la glycolase oxydase liée à FAD, le fait qu'il soit tronqué en 5' nous fait penser que l'autre partie de la sous unité est codée par la séquence manquante en 5' (interprétations issues du résultats de blastp), partie qui est présente chez ses homologues.


Puisque la séquence protéique de l'ORF est tronquée en Nter, Muscle a inséré des Indel au niveau de la portion tronquée de l'ORF (positions 1 à 236 de l'alignement) pour pouvoir réaliser l'alignement avec les autres séquences. Par conséquent, nous n'avons aucune information sur le degré de conservation des autres séquences sur cette portion tronquée de l'ORF (si un indel est présent, Muscle ne renseigne effectivement pas sur la conservation des positions concernées). Nous ne pouvons donc pas savoir si le domaine protéique est conservé chez les autres séquences sur les positions ou la séquence protéique de l'ORF est tronquée, et si le domaine est tronqué sur notre protéine requête.


Nous pouvons cependant supposer que c'est le cas, étant donné qu'il s'aligne dès le début de la séquence correspondant à l'ORF, qui elle, d'après l'alignement, est tronquée en Nter. Le domaine serait donc tronqué en Nter au sein de la séquence traduite de l'ORF, et ce domaine correspond peut être à l’extrémité Nter de la séquence protéique de la sous unité GlcD.



Les séquences sont toutes complètes en Cter, la position du codon stop est donc bien conservée entre les séquences puisqu'elle diffère de quelques positions (entre 0 et 6). L'ORF lui termine au niveau de la même position que la majeure partie des séquences (37 séquences sur 38 au total), c'est à dire à la 526eme position de l'alignement.




b) Gblocks


On remarque dans un premier temps que Gblocks a estimé 266 positions conservées dans l'alignement, soit 50% des 532 positions de l'alignement, ce qui est un très bon pourcentage.

On remarque 4 blocs conservés, ayant pour positions : 237  à 322 ; 327  à 339 ; 343 à 425 ; 427 à 510 .

Les blocs conservés recouvrent pratiquement tout l'alignement avec la séquence protéique de l'ORF, c'est à dire de la position 245 (première position de la séquence protéique issue de l'ORF) à la position 504 de l'alignement, soit une position seulement avant la position de fin du domaine généré par interpro. Finalement, cet alignement après curation de G blocks permet donc de justifier la conservation du domaine entre les différentes séquences protéiques.





RÉSULTATS BRUTS:

a) Alignement avec Muscle

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


B.P.Bet_13      -----------------MIKEYGVMSISEQTGGLGM----RQRVGLQEKLRREWAEMRVL
B.P.Gam_3       -------------------------------------------MSVIQQLIKALPQDRVI
O.b             ------------------------------------------------------------
B.P.Gam_1       -------------------------------------------MSIISQLTKSLPKHTVI
B.P.Gam_26      -----------------------------------------MDAVIFEALESIVGSEFII
B.P.Gam_19      ---------------------MNAPTEAWQQHPLERR---ERQVQVVRALQAVLPAHALL
B.P.Bet_2       ---------------------MNAPAELSAEVLA------QRQREVVQALMAVLPNHCLL
B.P.Bet_3       ---------------------MNASVEPSPEAIA------ARQREVVQALTTVLPPHCLL
B.P.Gam_22      ----------------------------MVDSSVKN----ISKQQLAKLFKTFINPDFVI
B.P.Gam_12      MINPKSHRKTMNPSHSTTLSPGKSASGASPLGTPPDFDRKERRLALLHAFRRFLPESCLI
B.P.Gam_27      ---------------------MSAAPK-------------IDRAELARRLRSFIDPQFVI
B.P.Gam_28      ---------------------MNTDSKPLNTDASK-----PDKAELAKMFREFIDPQFVI
B.P.Bet_7       ---------------------MSALPQAHEAASSTPDIR-IDRAALIAELSRVLPEDCLI
B.P.Gam_16      ---------------------MPAS---------------PYPTALLAELQAALSADAVL
B.P.Gam_17      ---------------------MWRASRSSVGVCAAR----QLSNAFLAELRAALSADAVL
B.P.Gam_11      ---------------------MSAVTTPQ-----------PGLAAVIDTLREQLPPEALI
B.P.Gam_18      ---------------------MNAAPS-------------ASAAALLPRLRAALPGEALL
B.P.Bet_8       ----------------------------------------MNTNQLIEAFRKFLPAEAIL
B.P.Bet_9       ----------------------------------------MSPQELVNNLRSFLPPEAVL
B.P.Gam_14      ---------------------MHHQ---------------IDRNVLINEFRTFLPQASII
B.P.Gam_15      ---------------------MRHP---------------ADRRRLLEEFKRWLPPASIL
B.P.Gam_21      ---------------------MNILFDERLDGELAR----RDKTEVLTDIQQAVPTLTLL
B.P.Bet_12      ---------------------MNILYNEEIDGPLSK----VDRADLFAELRQAMPDLLIL
B.P.Gam_20      ---------------------MNILHDERIDGKLPR----VDRSALVQELIAHLPSLHLL
B.P.Bet_1       ---------------------MTYAYDERLDGPLRD----HDKAAIVRDLHTLLPDLQLL
B.P.Gam_23      ---------------------MSILYEERLDGALPD----VDQTSVLMALREHVPGLEIL
B.P.Gam_24      ---------------------MSILYEERLDGALPD----VDRTSVLMALREHVPGLEIL
B.P.Gam_7       ---------------------MNILYDERLDGPLPQ----VDKDGLLAELRLRLPDLELL
B.P.Bet_10      ---------------------MSIFYDERVDGVLPD----VDKAALLEELRRVLPDVEVL
B.P.Gam_6       ---------------------MNILYDERVDGVLPD----VDKAALLHALQTRLPQLEVL
B.P.Bet_6       ----------------------------------------MLSPAFLSKLRSVLPAHCVL
B.P.Gam_5       ---------------------MSNRQ--------------ARQNQLANAFHQFLPTHSVL
B.P.Gam_2       ---------------------------------------------MLAALKTLLPAEALI
B.P.Gam_29      ---------------------MSHTPN-------------IDKPALIRALQQQLPAELIL
B.P.Gam_13      -----------------MEEIMSELPAAHAAGAGAPAPENDAKARMRAALTAELPEEIVL
B.P.Gam_4       ---------------------MSSFN--------------TNRALLLAALQDIQPQPLIL
B.P.Bet_11      ---------------------MPHQPEKTV----------ARNAGLIKALRDFLPPESVL
B.P.Gam_10      ---------------------MRPANLEEPRAVSA-----RERDALIRELLDVVPSHGVL
                                                                            

B.P.Bet_13      TELSEITPYECDALAAFTRLPLAVVLPETEAQVQTVLKTCMRLGVPVVARGAGTGLTGSA
B.P.Gam_3       FDTEQCSPYECDGLSAYREKPMAVVLPANVEEVKTALRICKEHQVPVITRGSGTGLAGGA
O.b             ------------------------------------------------------------
B.P.Gam_1       SGAENTRPFECDGLSVYKQEPLAVVLPSEVGQIKKVLEICRQNNTPVVTRGAGTGLSGGA
B.P.Gam_26      VDKETLHPYECDGLSVYCSLPTCVVLPANTEEVMAVMALCHQHSVTVVARGAGTGLSAGA
B.P.Gam_19      WNSEDTTPYECDGLTAYRQRPLVVALPETYAQVQAVLKACHALDVPVVARGAGTGLSGGA
B.P.Bet_2       YRDEDTVAYDCDGLAAYRRLPLAVALPETESQVQRIVQICHRLGVPIVPRGAGTGLSGGA
B.P.Bet_3       YRDEDTAPYECDGLAAYRQLPLAVVLPETESQVRRVLQTCHRLDVPVVPRGAGTGLSGGA
B.P.Gam_22      VDSETQKPYECDGLSMYCEMPMLVVLPERISEVQKVLRICHQYNIPIVPRGAGTGLCAGA
B.P.Gam_12      HEPEALKVYECDGLTAYRRLPLMAVLPDTVEQVKEVMRICSKASVPVVARGAGTGLSGGA
B.P.Gam_27      DDDETMKPYECDGMSMYCEMPMLVVLPETVEQVQDVMRLCHANDVPVVARGAGTGLSAGA
B.P.Gam_28      TDEETLKPYECDGLSMYCVMPLLVVLPETVEQVQQVMRLCHQFGIPVVARGAGTGLSAGA
B.P.Bet_7       ADPGRLRAYECDGLMLVREMPLAVALPTTEAQVVAVLRTCHRLGVPVVPRGAGTGLSGGA
B.P.Gam_16      HGAEDLRPYECDGLAAVRELPLCVALPTDREGVQAVLQICQRHGVAVVPRGAGTGLSGGA
B.P.Gam_17      SSAEELRPYECDGLSVLRELPLCVVLPTDRESVQAVLHICQRYGVAVVPRGAGTGLSGGA
B.P.Gam_11      VEESERRAYECDGLSAFREVPGAVALPASMEQLQLCLKTCREHGVPVVPRGAGTGLSGGA
B.P.Gam_18      TEAEDLHPYECDGLSVYRGVPLAVALPATAEAAAQVLRLCREAGVPVIARGAGTGLSGGA
B.P.Bet_8       HEAEDLRPYECDALSAYRQLPMIVVLPRTEAEIAAILQTCQAERIPVVARGSGTGLSGGA
B.P.Bet_9       YETEDLRPYECDGLSAYRQLPLVVVLPRTEEQIIKILKLCYATQTPVVARGAGTGLSGGA
B.P.Gam_14      FEKEALKPFECDGLSAYHCVPWLVVLPETIEQIQRILRLCYQQGVPVVARGAGTGLAGGA
B.P.Gam_15      AEAEALRPYECDGLSVYRCPPWLVLLPETVEQIQQILRICYREGVPVVARGAGTGLAGGA
B.P.Gam_21      HREEDLRPFECDGLAAYRVLPMLVALPENLEQVEALLKRCHALDVPVVTRGAGTGLSGGA
B.P.Bet_12      HREEDLRPYECDGLAAYRTVPLLAVLPERVEQVESILRICHARRVPVVARGAGTGLSGGA
B.P.Gam_20      YKDEDLAPYECDGLSAYRTKPLLVVLPETVDQVQKIMKICHDFGAPVVARGAGTGLSGGA
B.P.Bet_1       HAKEDLRPFECDGLSAYRITPMLVALPGTIDEVQALLQYAHAHGVPVVARGAGTGLSGGA
B.P.Gam_23      HTDEEITPYECDGLSAYRTRPLLVVLPKQIEQVAAILAVCHRLRVPVVTRGAGTGLSGGA
B.P.Gam_24      HTDEEIIPYECDGLSAYRTRPLLVVLPKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGA
B.P.Gam_7       HAAEDLRPYECDGLSAYRCTPLLVALPERIEQVQGLLALCHRLKVPVVARGAGTGLSGGA
B.P.Bet_10      SDAEDLKPYECDGLSAYRATPLLVILPETIDQVQTLLRLCHARQVPVVARGAGTGLSGGA
B.P.Gam_6       HEREQLAPYECDGLSAYRTTPLLVALPRHLDEVQELLRICHQMRVPVVARGAGTGLSGGA
B.P.Bet_6       NEREDLVPFESDGLAAYRNVPDVVALPENEAQVAAVLQLCHENRVAVVARGAGTGLAAGA
B.P.Gam_5       IHEEELRPYECDGLSAYRKMPLIVVLPKTIEQIQNILQVCREQDVPIVCRGAGTSLSGGA
B.P.Gam_2       HEPEALHPYECDGLPTYRQMPLLVVLPETLEQLQQVVRLCHQQRVPVVARGAATGLSGGA
B.P.Gam_29      HEQEALRPYECDGLSAYRQVPLLVVLPENAEQVQRVMQCCHRLGVPVVARGAATGLSGGA
B.P.Gam_13      HAEEDLRPFECDGLSAYRRLPMLAVLPSTIEQVQAVLRICHAHDTPVVARGAGTGLSGGA
B.P.Gam_4       NQPEQLKPYECDGLSAYRSVPLLVVLPETVEQVQAILKICQAQRVPVVARGAGTGLSGGA
B.P.Bet_11      DQREQLRPFECDGLSVYRQLPMVVVLPETIAQVQGIMRLCHAQDIPVVARGAGTGLSGGA
B.P.Gam_10      HDDEDLRPYECDGLSAYRRKPMLVVLPETIEQVQQVLRLCQAHQVPVVARGAGTGLSGGA
                                                                            

B.P.Bet_13      MPTPDGIVLAMSRFNRILNIDKQARTATVQPGVRNLAVSEAAAPHGLFYAPDPSSQLACS
B.P.Gam_3       LPLADGIVLGLSKMNQILHVDPLARTAVLQPGVRNISVTQAVEPYGLYYAPDPSSQVACS
O.b             ------------------------------------------------------------
B.P.Gam_1       MPLKDSVVLGLSKLTNIISIDQNARTAVVQPGVRNLAISEAAEEFGLYYAPDPSSQIACT
B.P.Gam_26      LPIEGGIVLSLARLNQILDIKNESGLALVQPGVRNLAISESASKYGLYYAPDPSSQIACS
B.P.Gam_19      MPHKLGVTLSLAKFNKILKLDAASRTAVVQGGVRNLAISEAAAPLGLYYAPDPSSQIACT
B.P.Bet_2       MPIRHGVVVSLARFKKIIEVDSYARTATVQPGVRNLSISEAAAPYGLYYAPDPSSQIACT
B.P.Bet_3       MPLRDGIVLSLARLNKIINIDPYARTATLQPGVRNLAISEAAAPYGLYYAPDPSSQIACT
B.P.Gam_22      MPSASGVVLSMAKFDQIIAIDPLARTARLEPGVTNLAISEAASEFGLYYAPDPSSQVACT
B.P.Gam_12      LPLEDGVLLVLARFNRILEVDRINRTALVQPGVRNLAISEHVAPLGLYYAPDPSSQIACS
B.P.Gam_27      MPSSNGVLLSLAKFNRVLQIDPLARTARLQPGVRNLAISEEVAQYGLYYGPDPSSQIACT
B.P.Gam_28      MPDAGGVVLSLAKFNRILHIDPLARSARLQSGVRNLAISEAAADYGLYYGPDPSSQIACT
B.P.Bet_7       TPHKQGIVLSTARLNRIVSVDRLAQQAVVQPGVRNLAVSEAAAPYGLYYAPDPSSQIACS
B.P.Gam_16      RPLRDAVLLSLARLRHIVAIDRENRTARVQPGVRNLAISEAARPLGLYYAPDPSSQIACS
B.P.Gam_17      RPIRGAVLLSLARLRNILAIDLENRTARVQPGVRNLAISDAARPLGLYYAPDPSSQIACS
B.P.Gam_11      LPSAEGLLLSMARFNRILEIDADNRCAVVQPGVRNLAISEATAPAGLYYAPDPSSQIACS
B.P.Gam_18      TPRAGTVVLSLARLNRILEIDPLARVARVQPGVRNLAISEAAAPLGLYYAPDPSSQIACT
B.P.Bet_8       LPHAEGVLLSLARLNHILEIDPAAGTARVQPGVRNLAISEAAAYYGMYYAPDPSSQIACS
B.P.Bet_9       LPHAQGVLLSLAKLNQIIAIDPLARMARVQPGVRNLAISEAVAAYGLYYAPDPSSQIACS
B.P.Gam_14      MPLANGVLLSLAKLNQVLEIDIANRLAVVQPGVRNLAISQAVAPFGLYYAPDPSSQIACT
B.P.Gam_15      LPLDNGVLLGLAKLNRILEVDPRNRLARVQPGVRNIAVSEAARPYGLFYAPDPSSQIACT
B.P.Gam_21      LPLEQGVLLVMSRFNKILSVDPDARMARVQPGVRNLAISEAAAPYGLYYAPDPSSQIACS
B.P.Bet_12      LPLAQGVLLVMARFNRILELNPKGRYARVQPGVRNLAISQAAAPYELYYAPDPSSQIACS
B.P.Gam_20      LPIEQGVLLVLAKLNKILEINPEGRFARVQPGVRNLAISEASAPYGLYYAPDPSSQIACS
B.P.Bet_1       LPLEKGMLLVMSRFNRILHIDPDAGIARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACS
B.P.Gam_23      LPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACS
B.P.Gam_24      LPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACS
B.P.Gam_7       LPLENGVLLVMARFRRILEIDPLGRFARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACS
B.P.Bet_10      MPLEKGVLLVMARFKRVLSVDPDARVARLEPGVRNLAISEAAAPYGLYYAPDPSSQIACS
B.P.Gam_6       LPLEKGLLLVMARFDKILHIDPGARTARVQPGVRNLAISQAAAPFGLYYAPDPSSQIACS
B.P.Bet_6       LPVDGAVLLVLAKLNRVKAIDPLARTAVVEPGVRNLAISEAVAPHGLYYAPDPSSQIACS
B.P.Gam_5       LPLNDGVLLSVAKFNRILEIDPVNRTARVQPGVRNLAISQSVAPYGLYYAPDPSSQIACS
B.P.Gam_2       LPLADGVLLGLAKFNRILEIDPLARTARVEPGVRNLAISQAVAPHGLYYAPDPSSQIACT
B.P.Gam_29      LPLADGVLMSLAKLNRILHIDPLNRTARVQPGVRNLAISEAVAAQGLYYAPDPSSQIACT
B.P.Gam_13      LPLESGVLLSLAKFNRILDIDTANRRATVQPGVRNLAISQAVDHLGLYYAPDPSSQIACS
B.P.Gam_4       LPHEQGVLLSLAKFNKILDINPERRTATVQPGVRNLSITQAVDHLGLYYAPDPSSQIACT
B.P.Bet_11      LPLANGVLLSLAKFRNILHIDPHNAMATVQPGVRNLAISEAAAAYGLYYAPDPSSQIACT
B.P.Gam_10      FPLANGVLLGLAKFNRILAIDPDNRSARVQPGVRNLAISEAAAAHGLYYAPDPSSQIACS
                                                                            
                                                                        <---
B.P.Bet_13      IGGNVAQNSGGLHCLKYGLTTHNVLKIRAVTIDGSILELGGEAYDAPGLELLPLFIGSEG
B.P.Gam_3       IGGNVAENSGGVHCLKYGLTVHNVLSITVINMNGDILVLDEK---DDGVDLLALLNGSEG
O.b             --------------------------------------------------------GSEG
B.P.Gam_1       IGGNVAENAGGVHCLKYGLTVQNIESLKILTIDGDELVFSRQ---DDGLGLLALMTGSEG
B.P.Gam_26      IGGNVAENAGGVHCLKYGLTVHNIVSLIFVTAEGERIEVGDKSADIAGFDFLALLTGSEG
B.P.Gam_19      IGGNVAENSGGVHCLKYGLTVHNVLKVKGFTIEGEEVEFGGDALNSPGFDLLSIIIGSEG
B.P.Bet_2       IGGNVSENSGGVHCLKYGLTVHNVLRVRAVTMEGEIVEFGSLGPDAPGLDLLAVLIGSEG
B.P.Bet_3       IGGNVAENAGGVHCLKYGLTVHNVLRVRAITMEGDLVEFGSLGPDCAGLDLLAVLIGSEG
B.P.Gam_22      IGGNVAENSGGVHCLKYGLTIHNVLRLKILTVEGDLLTFGSEGLDCAGLDMLAIFIGSEG
B.P.Gam_12      IGGNVAENAGGLHCLKYGLTVHNILELKVITIAGDEITVGGEALDSPGYDLLALMTGSEG
B.P.Gam_27      IGGNVAENSGGVHCLKYGLTVHNILSVEMVTVEGERIIVGSDGLDSCGMDLLALSTGSEG
B.P.Gam_28      IGGNVGENSGGVHCLKYGLTTHNILSVEMVTVDGERVVIGSDGLDSCGMDLLALITGSEG
B.P.Bet_7       IGGNVAENSGGVHCLKYGLTVHNVLRVRMVNMAGEVMEIGSAAPDSAGYDLLAVTIGSEG
B.P.Gam_16      IGGNVAENSGGVHCLKYGLTVHNILELDVLTATGETLRIGSQALDSPGYDLLALMTGSEG
B.P.Gam_17      IGGNVAENSGGVHCLKYGLTVHNILALEVLTAAGEALQIGSQAPDSPGYDLLALMTGSEG
B.P.Gam_11      IGGNVAENAGGVHCLKYGLTVHNVTGLEFVTLDGEVIRVGGKTLDTEGLDLLAFLIGSEG
B.P.Gam_18      IGGNVAENSGGVHCLKYGLTVHNLLRLKVATIDGEIIELGAEALDAPGYDLLALFTGSEG
B.P.Bet_8       IGGNVAENSGGVHCLKYGLTVHNILRLRVLTIEGDLLEIGADALDSPGFDLLALMTGSEG
B.P.Bet_9       IGGNVAENSGGVHCLKYGLTVHNILKLRVLTIDGECLEIGGESLDSAGYDLLALMTGSEG
B.P.Gam_14      IGGNVAENSGGVHCLKYGLTTHNLLRVKMLTMGGELVTIGSHGLDSAGLDLLALIAGSEG
B.P.Gam_15      LGGNVAENSGGVHCLKYGLTTHNVLEVKLVTMEGELLTLGGGGLEGPGLDLLAVAIGSEG
B.P.Gam_21      IGGNVAENAGGVHCLKYGLTVHNVLRVDVLTIEGERMTLGAESLDAPGFDLLALMNGSEG
B.P.Bet_12      IGGNVAENAGGVHCLKYGLTVHNVMKIEVLTMEGERITLGADALDAPGFDLLALFTGSEG
B.P.Gam_20      IGGNVAENAGGVHCLKYGLTVHNLLKINIITVEGEFLTLGSDALDTAGFDLLALFTGSEG
B.P.Bet_1       IGGNVAENAGGVHCLKYGLTVHNILRVEIVTIDGERLTLGAEALDTPGFDLLALITGSEG
B.P.Gam_23      IGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGETLTLGSDALDSPGFDLLALFTGSEG
B.P.Gam_24      IGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGSDALDSPGFDLLALFTGSEG
B.P.Gam_7       IGGNVAENAGGVHCLKYGLTVHNLLQVDIVTLEGERLSLGSSALDSAGFDLLALFTGSEG
B.P.Bet_10      IGGNVAENAGGVHCLKYGLTVHNVMKVDMLTIEGERMTLGSDALDSPGFDLLALYTGSEG
B.P.Gam_6       IGGNVAENAGGVHCLKYGLTVHNLLRIEVLTVDGEPLTLGSDALDAPGFDLLALFTGSEG
B.P.Bet_6       IGGNVAENSGGVHCLKYGLTVHNIMKLRALTIAGDVLEIGSDALDAPGYDLLALLTGSEG
B.P.Gam_5       IGGNVSENAGGVHCLKYGLTVHNVLQVTFLTIDGELITLGSSGLDGPGYDLLAVLTGSEG
B.P.Gam_2       IGGNVAENSGGVHCLKYGLTVHNILELKLVTAEGELITLGSGALDTPGYDLLALLNGSEG
B.P.Gam_29      IGGNVAENSGGVHCLKYGLTVHNVLQLKLVTADGELITLGAEALDAPGFDLLALLIGSEG
B.P.Gam_13      IGGNVAENSGGVHCLKYGLTTNNIVQIEIVTIEGERLTIGSPALDSPGYDLLALMTGSEG
B.P.Gam_4       IGGNVAENSGGVHCLKYGLTVHNILQIKIVTIDGELLTIGGHSLDSAGYDLLALLTGSEG
B.P.Bet_11      IGGNVAENSGGVHCLKYGLTVHNILMLKVVTAEGELLTIGAETLDAPGYDLLALMTGSEG
B.P.Gam_10      IGGNVAENAGGVHCLKYGLTVHNILELKVVTIDGELITLGGQSLDSPGYDLLALMTGSEG
                                                                        ****
                ---1------->                              <----2---->
B.P.Bet_13      MFAVVTEVVLKLVPLPETAKVIQVSFDDMGKAGHAVADVIAAGIIPAGLEMMDGAATRAV
B.P.Gam_3       LLGVIVEVKVKLLPKPDTAQLVMAGFDSVGACADAVTTVLEQGIIPAGLEMMDKFSIMAA
O.b             LLGVITEITVKLTPKPELARLVMAGFSSVRDCADTVAEIIKNGIIPSGLEMMDKFAIEAS
B.P.Gam_1       LLGVITEITVKLTPKPELAKLVMAGFDSVRDCAQAVADIIKNGVIPAGLEMMDEFAIEAA
B.P.Gam_26      MLGLVTEITVRLLPIPELARVILAGFDTVENAANAVNAIISDGIIPAGLEMMDRYAIQAA
B.P.Gam_19      MLAVTTEVTVKLVPKPRLARCIMASFDDLRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAV
B.P.Bet_2       MFSIVTEVTVKLIPKPQTAQVIMASFDDVVKGGDAVAGIIAAGIIPAGLEMMDKPATRAV
B.P.Bet_3       MFAVVTEVTVRLLPKPQVAQVIMASFDDVVKGGAAAAAIIAAGIVPAGLDMMDQLATHAV
B.P.Gam_22      LLGVVTEVLVKLLPVPEKAQVVMAGFGTIVAAGDAVAAVIAQGIIPAGLEMMDEHAIIAA
B.P.Gam_12      LLGVVVEVRVRLLPKPACAKVLLAAFDDIQSAGQAVGEIIAAGIIPGGLEMMDNLAIRAT
B.P.Gam_27      MLGIITEVKVKLLPKPEKAQVVMAGFDSIQNAGDAVGGIIAHGIIPGGLEMMDGYAITAA
B.P.Gam_28      LLGIITEVQVKLLPTQEIARVVMAGFGTVDEAGAAVGGIIAQGIIPAGLEMMDSHAIIAV
B.P.Bet_7       LLGVVTEVTVKLVPKPRVARCVLAAFADIRKAGQAVADVIAAGIIPAGLEMMDQATTAAV
B.P.Gam_16      LLGVVTECTVRLLPMPEHVLVLLAAFSSVEAAAESVSAIIASGIIPAGLEMMDRLAIEAA
B.P.Gam_17      LLGVVTECTVRLLPVPEHTLVLLAAFASVAAAAESVSAIIAAGIIPAGLELMDQLAIEAA
B.P.Gam_11      MLGIVTEVTVRLLPRPERTQVLMASFDDVETAGAAVAGIIAAGLIPAGLEMMDNAAIRAA
B.P.Gam_18      LLGVVVEATVRLIPKPECARVVLAAFDDLGKAGQAVADIIGAGIIPAGLELMDQPAIAAV
B.P.Bet_8       MLGIVTEITVRLLPKPETVKLVMAVFDDVRKAGEAVASVIQAGIIPAGMEMMDKITIHAV
B.P.Bet_9       MLGIVTEVTVKLIPLPEKAQLVMAAFDDVHKAGNAVANVIGAGIIPAGMEMMDRITIHAV
B.P.Gam_14      MLGIIVEITVKLLPTPEQAQVVLAAFDDIEKAGQAVADIVAAGLIPAGLEMMDKAAIKAA
B.P.Gam_15      LLGVAVEITVKLLPLPEDTQVLLAAFDAVEKAGQAVAGIIAAGLLPAGLEMMDHTIIQAA
B.P.Gam_21      MLGVVTEITVKLLPKPETAKVLMASFDDVEKAGRAVGDIIAAGIIPGGLEMMDKLAIKAA
B.P.Bet_12      MLGIVTEVTVKLLPKPRVARVLMASFDSVEAAGKAVADIIGAGIIPGGLEMMDKLAIQAA
B.P.Gam_20      MLGIVVEVTVKLLPKPKVAKVLMASFDDIGKAGQAVGNIIAAGIIPGGLEMMDNLAIKAA
B.P.Bet_1       MLGVVVEVTVKLLTKPQSAKVLLASFDEIEKAGDAVAQIIGAGVIPGGLEMMDNLAIRAA
B.P.Gam_23      MLGVTTEVTVKLLPKPPVARVLLASFGSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAA
B.P.Gam_24      MLGVTPEVTVKLLPKPPVARVLLASFDSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAA
B.P.Gam_7       LLGVVVEVTVRLLPRPPVAKVLLASFDDVESAGRAVADLIGAGIVPAGLEMMDNLSIRAA
B.P.Bet_10      MLGVAVEITVKLLPKPQMAKVLLASFDDVDKAGRAVGDIIAAGIIPGGLEMMDNLSIRAA
B.P.Gam_6       MLGVITEVTVKLLPKPQTAKVLLAAFDSVEQAGRAVADIIAAGIIPGGLEMMDNLAIRAA
B.P.Bet_6       MLAVITEVTVKLLPRPERAQVVLAAFDDVAKAGAAVGNIIAAGVIPAGLEMMDRLAIRAA
B.P.Gam_5       MLGVIVEITVKLLPKPPQVQVLLAAFNNIEDAGTAVAKIIGAGIIPAGLEMMDNPAIRAA
B.P.Gam_2       MLGIVVEVVVKLLPAPERAQVLLAAFDDLALAADAVGEIIAAGIIPAGLEMMDGLAIRAA
B.P.Gam_29      MLGIVVEVLVKLLPTPERAQVLLAAFDDVSKAANAVGDVIAAGIIPAGLEMMDGLAIRAA
B.P.Gam_13      LLGVIVEVVVKLLPKPELAQCALIAFDDVRKAGNAVAEIIKAGIVPAGLEMLDHPAILAT
B.P.Gam_4       LLGVIVEVTVKLLPKPERVQVLLAAFDDVIKAGAAVGAIISDGIIPAGLEMMDGFAIKAA
B.P.Bet_11      MLGIIVEVTVKLLARPERAQVVLAAFDDVVKAGEAVGAIIAAGIIPAGLEMMDRLAIQAA
B.P.Gam_10      MLGVIVEITVKLLPRPERAQVLLAAFDSVERAGEAVAAIIGSGIIPAGLEMMDNNAIRAA
                ::.:  *  :.* .    .      *  :   . :.  ::  *::*.*::::*     * 
                             <---3--->  A
B.P.Bet_13      DDYLNAGFDRKAEAVLLCESDGMA-EEVEAEVAEMQAIFRRSGAIDMKVSRNEIERTAIW
B.P.Gam_3       EEYAKVGYPLEAEALLLCEVDGSF-DQVKVDTRRIADILTQSGATTITVSQNEAERIALW
O.b             EAFAHPGYPLDAQALLLCELDGAI-DSVNEDLNKVLSLL--SNATTTRVSENEDERLLFW
B.P.Gam_1       EDFAKPGYPLMAKALLLCELDGSI-ELVNNDVSVVKNLL--SKATSIRVSETEEERLLLW
B.P.Gam_26      EDFAHAGYPKDAEALLLCELDGTA-DDVNHQLQLAKTLLESAGATSLRVSNNEEERALMW
B.P.Gam_19      EDFVHAGYDLSAEAILLCESDGTP-EEVEEEIGRMSEVLRRCGATAIAVSRDEAERLRFW
B.P.Bet_2       EEFVHAGYDLDAAAILLCESDGTP-EEVADEIVRMTAVLREHGATRIAISRTENERLRFW
B.P.Bet_3       EEFVQAGYDLEAQAILLCESDGTP-DEVADEIERMTAVLHAHGATRIQISRSEAERLKFW
B.P.Gam_22      EAYVNAGYPLESKALLLCELDGTE-GEVEQYIAVVAGIFKDLGAQSIRISSSAAERALLW
B.P.Gam_12      DDFCKAGYPTEAAAVLLCELDGIE-EEVMDQIVDAKGIFEACGASELRIAEDDAERARFW
B.P.Gam_27      EDFAHAGYPRDAQALLLCEVDGTA-EEVQEHIEQAENLFRSFGATSVRTSQSEEERALLW
B.P.Gam_28      EAFTGAGYPVEAAALLLCEVDGTK-EEVQEHIEKAEALFRDFGATSIRTSKDDAERALLW
B.P.Bet_7       EQFVHAGYPLDAAAILLCESDGTE-EEVQDEIARVRVLLEAAGATEIRISSDEAERLRFW
B.P.Gam_16      EDFVHAGYPRDAAAILLCELDGPA-VELEEQLREVETLLQRHGARAIRIAEDAATRLLLW
B.P.Gam_17      EDFVHAGYPRDAAAILLCELDGSA-VELKERRQEVEVILQRHGAGAIRMAEDAATRLLLW
B.P.Gam_11      EDFVHAGYPVDAAAILLCELDGSN-SEVSESVMFVREKLLGLGATEVRTAQDDAERTRFW
B.P.Gam_18      EPFVHAGYPLDAAAILLCESDGTP-EEVAEEIVRMEAVMSAAGATDCRVSRDEAERLRFW
B.P.Bet_8       EDFVHAGYDLEGAAILLCESDGMA-EEVADEIERIRTILQASGATRISLAQDEAERQRFW
B.P.Bet_9       EEFLHAGYDLDAAAILLCESDGGT-EEVADEIERIYAIMQQSGATKISTSRNEAERLRFW
B.P.Gam_14      EDFIHAGYPNNAEAILLCELDGAR-EQVEEELDKAVALLTDGGAIDVRVAQSEQERQKMW
B.P.Gam_15      EDFIGAGYPVEAEAVLIVEFDGMR-EQVEQDLERAAYLLKACGAYRLDIAATPEDRLKAW
B.P.Gam_21      EDFVKAGYPLDAEAILLCELDGVE-ADVDDDCETVRRVLEKAGATQIQQARDELERAKFW
B.P.Bet_12      EDFIHAGYPVEAEAILLCELDGVE-LDVAEDIERVRAVLDEAGATAVSLARDEAERALFW
B.P.Gam_20      EDFIHAGYPIDAQAILLCELDGVE-SDVDEDCQIVRSVLENSGATAIQMAKDEAERQRFW
B.P.Bet_1       EDFIHAGYPVDAEALLLCEVDGAE-SDVEEDCARVDSLLRAAGATDIRLAANEAERQRFW
B.P.Gam_23      EDFIHAGYPVDAEAILLCELDGVE-SDVQEDCERVNDILRKAGATDVRLAQDEAERVRFW
B.P.Gam_24      EDFIHAGYPVDAEAILLCELDGVE-SDVQEDCERVNDILLKAGATDVRLAQDEAERVRFW
B.P.Gam_7       EDFIHAGYPVDAAAILLCELDGVE-ADVHEDCERVRELFEAAGATSVRQAQDEAERQRFW
B.P.Bet_10      EDFIHAGYPVDAEAILLCELDGAE-ADVHADCERVSHIVRAAGATDVRQARDEAERQRFW
B.P.Gam_6       EDFIHAGYPVDAQAILLCELDGVE-ADVHDDCNRVRQVLEQAGASEVRQARDEAERVRFW
B.P.Bet_6       EAFVHAGYPLDCEALLLCEVDGVN-EEVSADIYTVRQVLEASGATEIRTADSEEQRLKFW
B.P.Gam_5       EDFIHAGYPKEAEAILLCELDGNNAEEVSEQVAQVSDLLQSCHATEVRVAKDEQERQKIW
B.P.Gam_2       EAFAHAGYPKDAAAILLCELDGIN-EEVSVHLKLVHDLLLQVGATEVRTARDEAERQLFW
B.P.Gam_29      EDFVHAGYPVDAQAILLCELDGAN-EEVSAHLARVRQQLLDSGATEVRTARDEDERTLFW
B.P.Gam_13      EEFVHAGYPTDAAAILLCEIDGTE-GEVADDMARVREVVEASGATDIRISRDDVERALFW
B.P.Gam_4       EEFAHAGYPTDAAAILLCELDGTN-AEVAEQLSRVHDILLHSEATEVRTAKDAQERATFW
B.P.Bet_11      EDFVHAGYPRDAEAILLCELDGTN-AEVSEYIMTMRRILTDSGATEVRTAVDEAERQLFW
B.P.Gam_10      EDFVHAGYPVEAEAILLCELDGTN-AEVSEDIMKVRNLLIAQGATEVRTAGDDQERLRFW
                : :   *:     *:*: * **     :          .    *     :     *   *
                 <----------4----------->                       <----5------
B.P.Bet_13      AGRKAVFPATARLAPDSYCMDGTIPRRKISAMLAFTAGLSQKYGLQCINVFHAGDGNMHP
B.P.Gam_3       QGRKNAFPAVGRFSPDYYCMDGTIPRKRLAYVLQEIEKLSQKYQLEVANVFHAGDGNLHP
O.b             KGRKAAFPSVGRLSPDYYCMDGTIPKRHLATVLEKISELSAHYKLRVANVFHAGDGNLHP
B.P.Gam_1       KGRKSAFPAVGRISPDYYCMDGTIPKRHLGDVLEKINKLSRHYNLRVANVFHAGDGNLHP
B.P.Gam_26      KGRKSAFPAVGRLSPDYYCMDGTIPRRQLAPVLAEIHRLSEQYGLRVANVFHAGDGNLHP
B.P.Gam_19      SGRKNAFPASGRISPDYMCMDSTIPRKRLADILLAIAEMEKKYRLRCANVFHAGDGNLHP
B.P.Bet_2       SGRKNAFPAAGRISPDYYCMDGTVPRRSIGPLLSRIEEMEKKYRLRCINVFHAGDGNMHP
B.P.Bet_3       SGYKNAFAAAGRISPDYYCMDGTVPRRAIGPLLARIAEMEKQYGLRCMNVFHAGDGNMRS
B.P.Gam_22      QGRKSAFPAIGRISPDYYCMDGTIPRGQLANVLTAMERRASALGLRVANVFHAGDGNLHP
B.P.Gam_12      AGRKAAFPAAGRISPDYLCMDGTIPKRELPKVLNAMQALSQASGLRIMNVFHAGDGNLHP
B.P.Gam_27      KGRKSAFPAVGRISPDYYCMDGTIPRGQLAHVLTEMQNMSERFKLRVANVFHAGDGNLHP
B.P.Gam_28      KGRKNAFPAMGRISPDYYCMDGTIPRAHLGQVLNEMQDMSKRFGLRVANVFHAGDGNLHP
B.P.Bet_7       AGRKAAFPAAGRIAPDYYCMDGTIPRQRLADMLEAMETMAKKYDLGLLNVFHAGDGNLHP
B.P.Gam_16      KGRKAAFPAVGRLAPDYYCMDGTIPRQRLAEVLERITAWSAEYGLRVANVFHAGDGNLHP
B.P.Gam_17      KGRKAAFPAVGRLAPDYYCMDGTIPRQRLAEVLEQIAAWSVEYGLRVANVFHAGDGNLHP
B.P.Gam_11      AGRKAAFPAAGRISPDYYCMDGTIPRHQLGYVLERIDALSAEHGLGVCNVFHAGDGNLHP
B.P.Gam_18      AGRKAAFPAVGRISPDYYCMDGSIPKKCLAAVLEAIRGMERKYGLRCANVFHAGDGNLHP
B.P.Bet_8       AGRKAAFPAAGRVSPDYYCMDGTIPRKHLAHVLEQIEQLSAEYGLRCMNVFHAGDGNLHP
B.P.Bet_9       AGRKAAFPAAGRVSPDYYCMDGTIPRKHLADVLDGIEKLSQEYGLRCMNVFHAGDGNLHP
B.P.Gam_14      AGRKSAFPAVGRISPDYYCMDGTIPRRFLAKILKNIGDLSEKYGLAVANVFHAGDGNLHP
B.P.Gam_15      AGRKAAFPAAGRISPDYYCMDGTIPRRFLADTLKKIAELSTQYGLTVANVFHAGDGNLHP
B.P.Gam_21      AGRKNAFPAVGRMSPDYYCMDGTIPRCELPRVLKGIAALSEQSGLAVANVFHAGDGNMHP
B.P.Bet_12      AGRKNAFPAVGRMSPDYYCMDGTIPRRHLPKVLRGTAELSEQYGLRVANVFHAGDGNMHP
B.P.Gam_20      AGRKNAFPAVGRISPDYYCMDGTIPRRELPNVLTGIQALSEEYGLAVANVFHAGDGNMHP
B.P.Bet_1       AGRKNAFPAVGRISPDYYCMDGTIPRRELARVLRGIADLSAQYGLRVANVFHAGDGNMHP
B.P.Gam_23      AGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMHP
B.P.Gam_24      AGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMPP
B.P.Gam_7       AGRKNAFPAVGRISPDYYCMDGSIPRRELPRVLHGIAELSREYGLRVANVFHAGDGNMHP
B.P.Bet_10      AGRKNAFPAVGRISPDYYCMDGTIPRRELPKVLKGIAALSEKHGLRVANVFHAGDGNMHP
B.P.Gam_6       AGRKNAFPAVGRLAPDYYCMDGTIPRRQLAGVLQAIAALSAAYNLRVANVFHAGDGNMHP
B.P.Bet_6       AGRKAAFPAVGRLAPDYYCMDGTIPRAQLPHVLKRISEMSDEFGLRVANVFHAGDGNLHP
B.P.Gam_5       AGRKSAFPAVGRISPDYYCMDGTIPRKQLPYVLNKIKELSKTYDLQVANVFHAGDGNLHP
B.P.Gam_2       KGRKSAFPAVGRLSPDYYCMDGTVPRKRLAEVLTGISRLSEHYGLAVANVFHAGDGNLHP
B.P.Gam_29      KGRKSAFPAVGRISPDYYCMDGTVPRKRLAEVLLETSRLSERYQLPVANVFHAGDGNLHP
B.P.Gam_13      AGRKAAFPAMGRISPDYYCMDGTIPRRALADVLIGIGELSEQYGQRVANVFHAGDGNLHP
B.P.Gam_4       KGRKSAFPAVGRISPDYYCMDGTIPRKHLPKVLHAINQLSEQFGLAVANVFHAGDGNLHP
B.P.Bet_11      KGRKSAFPAVGRISPDYYCMDGTIPRRQLPHVLRRISEMSEEYGLAVANVFHAGDGNLHP
B.P.Gam_10      AGRKAAFPAVGRLSPDYYCMDGTIPRKNLGQILRRIGEMSGEFGLRVANVFHAGDGNLHP
                 * * .*.: .*.:**  ***.::*.  :   *               *********: .
                ---->                             <---6--->
B.P.Bet_13      LILFD-NQKGEWPAAEAFGADILEECVRLGGTITGEHGVGLEKINGMCTQFSEAEREIFW
B.P.Gam_3       LILYDANQPGQLEQTEKFGAEILKLCLDVGGTITGEHGVGVEKLDSMCHQFDTAELEIFH
O.b             LILYNASRPGELEKTEAFGMDILKLCVEMGGSITGEHGVGIEKLDAMCHQYSSAELDVFH
B.P.Gam_1       LILYDAGIPGELEKTEEFGNKILKICIEAGGSITGEHGVGVEKLDAMCYQYSEAELDVFH
B.P.Gam_26      LILFDANVPGELEQTEAFGADILRVCVEAGGCITGEHGVGLEKIEQMHYQFNDAELAQFL
B.P.Gam_19      LILFDANDPDQLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCVQFSAEENEQMF
B.P.Bet_2       LILFNGNDKDEWHRAEAFGSDILEACVELGGTVTGEHGVGIEKINSMCVQFSPEERDAFH
B.P.Bet_3       LILFDGNDPDEWRRAEAFGAQMLETCVGLDGTITGEHGVGIEKTDAMCVQFCAEERDALL
B.P.Gam_22      LILFDDSVPGEFQKAEQLGAWILEYCVAVGGSITGEHGVGVEKIRQMPIQFTDREIAQFH
B.P.Gam_12      LILYDANKEGELEKAEAVGARILEICVEAGGTITGEHGVGVEKINQMCVQFETLELAQFH
B.P.Gam_27      LILFDANVPGEFERTEAFGSAILELCVAVGGCITGEHGVGIEKIRQMAVQFRDDELIQFH
B.P.Gam_28      LILFDANKEGELERAEAFGSDILELCVKVGGCITGEHGVGVEKIRQMPMQFTDPEIEQLN
B.P.Bet_7       LILFDSNDPDSVRRAEAFGVDILELSVELGGTITGEHGVGLEKINQMCSQFGADELDMFH
B.P.Gam_16      LILYDANAEGQLHTAEEFGRRILELCVSVGGSVTGEHGVGVEKLDSMCVQFNAAELAQLH
B.P.Gam_17      LILYDANAEGQLHAAETFGQRILELCVAVGGSVTGEHGVGVEKLDSMCVQFNAAELAQLH
B.P.Gam_11      LILYDASQPGQIETAETFGEAILELCVAVGGTVTGEHGVGVEKLDGMCVQFASAELEQFH
B.P.Gam_18      LILFDANKPDELHRTEAFGGEILELCVRHGGSITGEHGVGIEKIDQMCVQFGSEELEVFH
B.P.Bet_8       LILYDANQPGELQKAEAFGARILEICIEAGGSLTGEHGVGIEKLNQMCLQFNDAERNRFH
B.P.Bet_9       LILYDANQPGELERTEEFGGKILEMCIHAGGTITGEHGVGMEKINQMCSQFNTGELEMFH
B.P.Gam_14      LILYNANHAGELEKAEQFGGDILKLSVEVGGTITGEHGVGVEKINHMCIQFANNELTQFH
B.P.Gam_15      LILYDAAKPGELDKAEQLGGAILALCVEVGGTITGEHGVGIEKMNHMCLQFSASELRQFH
B.P.Gam_21      LILFDANKEGELALAEEVGGKILELCVAAGGSITGEHGVGREKINQMCSQFQADEISVFH
B.P.Bet_12      LILFDANEPGALERAEELGGKILELCVAVGGTITGEHGVGREKINQMCVQFNVDELSFFH
B.P.Gam_20      LILFDANQPGELEKAEALGGKILELCVKVGGSITGEHGVGREKINQMCSQFNNDEIEVFH
B.P.Bet_1       LILFDANAPGEMDRAEALGARILELCVEVGGSITGEHGVGREKINQMCAQFNSDELTFFH
B.P.Gam_23      LILFDANEPGEFARAEALGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFH
B.P.Gam_24      LILFDANEPGEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFH
B.P.Gam_7       LILFDANLAGELERAEALGGRILELCVAVGGSNTGEHGVGREKINQMCAQFNADELTLFH
B.P.Bet_10      LILFDANLPGEMERAEALGGEILELCVAVGGSITGEHGVGREKINQMCAQFNSDELEMFH
B.P.Gam_6       LILFDANQPGELDRAEALGGKILELCVKVGGSITGEHGVGREKINQMCAQFNSDELTLFH
B.P.Bet_6       LILFDANQAGELQKAEDFGGRILELCVEAGGTITGEHGVGLEKIRQMCAQFAPPELTRFH
B.P.Gam_5       LILYDANQPGELERAEEFGGRILEVCVEVGGTITGEHGVGIEKINQMCVQFNSSELEQFH
B.P.Gam_2       LILFDANQPGELKRAEDLGAEILELSVRVGGTITGEHGVGHEKLHQMCVQFSPAELEQFR
B.P.Gam_29      LILYDANQPGELKRAEDLGAEILELCVRVGGTITGEHGVGHEKIHQMCVQFSSTELNQFH
B.P.Gam_13      LILYDANQPGELENTEAFGGAICRLCLEYGGTITGEHGVGVEKIDQMCVQFPSAELTQFH
B.P.Gam_4       LILFDANKTGELERAEAFGGKILELCVEVGGTITGEHGVGMEKINQMCVQFNSLELTQFH
B.P.Bet_11      LILFDANKEGELHRAEELGQGILQLCVEVGGTITGEHGVGMEKIDQMCIQFRSAELAQFH
B.P.Gam_10      LILYDADTPGQLERAEDFGGRILELCVEYGGTVTGEHGVGIEKLNQMCTQFTPDELTQFH
                ***::    .     * .*  :   .:  .*  :****:* **   *  *:   *   : 

B.P.Bet_13      GVKAAFDPPKLLNRDKVLPTKVRCAEYRQVR-GGSVAERFPHLERF------
B.P.Gam_3       AIKQVFDDTGLLNPGKAVPTLHRCAEVGQMH-VHNNQLPFPELERF------
O.b             QIKNAFDPISLLNPGKAVPTLHRCAELGNMH-VHDGELPHPELERF------
B.P.Gam_1       QIKAAFDPHALLNPGKAVPTLHRCAELGNMH-VHHGNLPHPELERF------
B.P.Gam_26      RVKAAFDPDNLLNPGKGIPTPKHCQEHTVM----KHSLSQRGSTNG------
B.P.Gam_19      GVKRAFDSKGLLNPGKVIPTLNRCAEYGKML-VRAGQIKHPDLPRF------
B.P.Bet_2       AVKRAFDPPGLLNPDKGIPTRARCAEYGKMH-VRGGLLPHPELPRF------
B.P.Bet_3       AVKRAFDPPGLLNPGKDIPTRARCAEYGKMR-GHQGLLPHPELPRR------
B.P.Gam_22      ALKNAFDPLATLNPGKGIPLLKNCQEYRALRQIHSG-------EQL------
B.P.Gam_12      ALKAAFDPEGLLNPGKAIPTLQRCAEYGAMH-VKGGVLPFADIERF------
B.P.Gam_27      ALKAAFDPNGLLNPGKGVPTLRQCQEYRALQ-------PSKQAAEA------
B.P.Gam_28      AVKSAFDPQGTLNPGKGVPTLRNCQEYRAI----NAKPQAPEVQHA------
B.P.Bet_7       RVKAAFDPAGLMNPGKAVPTLHRCAEMGRMH-VHHGELPHPDLPRF------
B.P.Gam_16      RIKHAFDPEGRLNPGKAVPSLHRCAELGAMH-VHHGQLPFPELERF------
B.P.Gam_17      RIKYAFDPEGRLNPGKAVPSLHRCAELGAMH-VHHGQLPFPELERF------
B.P.Gam_11      ALRSAFDPRGLLNPGKAVPTLARCAEFGRQH-VRSAQPPHPDLPRF------
B.P.Gam_18      ALKHAFDPEGLLNPGKAVPTLHRCAEFGRMK-VHGGQLPHPELPRF------
B.P.Bet_8       AIKAAFDPQSLLNPGKAIPELHRCAEFGAMH-IHRGAEKFPEIPRF------
B.P.Bet_9       AVKAAFDPAGLLNPGKAVPTLHRCAELGAMH-VHRGEEKFAELPRF------
B.P.Gam_14      AVKRAFDEKGLLNPGKAVPTLHRCAELGAMH-VHQGEVAHPELDRF------
B.P.Gam_15      ALKRAFDEKGLLNPGKAIPSLHRCAEWGAMH-VHQGNVRFPEIERF------
B.P.Gam_21      ALKAAFDPKRLLNPGKNIPTLARCAEFGAMH-VHNNELPHPELPRF------
B.P.Bet_12      AVKAAFDEHALLNPGKNIPTLRRCAENGAMR-VHQGKMPFPELERF------
B.P.Gam_20      AVKAAFDPKTLLNPGKNIPTLHRCAEFGKMH-IHHGELPFPELERF------
B.P.Bet_1       AVKAAFDPAGLLNPGKNVPTLHRCAEFGAMH-VHHGALPHPELERF------
B.P.Gam_23      AVKAAFDPDGLLNPGKNIPTLHRCAEFGAMH-VHHGHLPFPELERF------
B.P.Gam_24      AVKAAFDPDGLLNPGKNIPTLHRCAEFGAMH-VHHGHLPFPELERF------
B.P.Gam_7       AVKAAFDPAGLLNPGKNVPTLHRCAEFGAMH-VRHGRLPFPELERF------
B.P.Bet_10      AVKAAFDPDRLLNPGKNIPSLHRCAEFGAMH-VHHGKLPFPELDRF------
B.P.Gam_6       AVKAAFDPAGLLNPGKNIPTLHRCAEFGAMH-VHGGQLPFPELERF------
B.P.Bet_6       EVKAAFDPDTLLNPGKAVPELHRCAEWGAMH-VHAGRLPHPELPRF------
B.P.Gam_5       ALKQAFDPNKLLNPGKAIPTLARCVEFGAMH-VHGGQLPFSGIERF------
B.P.Gam_2       AVKRAFDPDGLLNPGKAIPQPRHCSEYKSL---GSDTLTAPSRRGG------
B.P.Gam_29      AVKKAFDPQGLLNPGKAIPQPRHCSEYKAL---GSDTLTAPSARDQGARKGV
B.P.Gam_13      AVKAAFDAKTLLNPDKAVPTLHRCAEFGAMH-VHHGQLPHPELERL------
B.P.Gam_4       AVKAAFDPQGLLNPEKAVPTLHRCAEFGAMH-VHHGQLSHPELERF------
B.P.Bet_11      AVKAAFDPSGLLNPGKAVPTLQRCAEFGAMH-VHHGKLSHPELERF------
B.P.Gam_10      AVKAAFDPRGLLNPGKAVPTLHRCAEFGAMH-VHHGQLPHPDIPRF------
                 :. .**    :*  * :*   .* *                        
                                       l

b) Alignement avec Gblock 


Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 38
Alignment assumed to be: Protein
New number of positions: 266 (selected positions are underlined in blue)
                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   -----------------MIKEYGVMSISEQTGGLGM----RQRVGLQEKLRREWAEMRVL
Bac_Pro_Gam_3_[  -------------------------------------------MSVIQQLIKALPQDRVI
ORFprot_b)       ------------------------------------------------------------
Bac_Pro_Gam_1_[  -------------------------------------------MSIISQLTKSLPKHTVI
Bac_Pro_Gam_26   -----------------------------------------MDAVIFEALESIVGSEFII
Bac_Pro_Gam_19   ---------------------MNAPTEAWQQHPLERR---ERQVQVVRALQAVLPAHALL
Bac_Pro_Bet_2_[  ---------------------MNAPAELSAEVLA------QRQREVVQALMAVLPNHCLL
Bac_Pro_Bet_3_[  ---------------------MNASVEPSPEAIA------ARQREVVQALTTVLPPHCLL
Bac_Pro_Gam_22   ----------------------------MVDSSVKN----ISKQQLAKLFKTFINPDFVI
Bac_Pro_Gam_12   MINPKSHRKTMNPSHSTTLSPGKSASGASPLGTPPDFDRKERRLALLHAFRRFLPESCLI
Bac_Pro_Gam_27   ---------------------MSAAPK-------------IDRAELARRLRSFIDPQFVI
Bac_Pro_Gam_28   ---------------------MNTDSKPLNTDASK-----PDKAELAKMFREFIDPQFVI
Bac_Pro_Bet_7_[  ---------------------MSALPQAHEAASSTPDIR-IDRAALIAELSRVLPEDCLI
Bac_Pro_Gam_16   ---------------------MPAS---------------PYPTALLAELQAALSADAVL
Bac_Pro_Gam_17   ---------------------MWRASRSSVGVCAAR----QLSNAFLAELRAALSADAVL
Bac_Pro_Gam_11   ---------------------MSAVTTPQ-----------PGLAAVIDTLREQLPPEALI
Bac_Pro_Gam_18   ---------------------MNAAPS-------------ASAAALLPRLRAALPGEALL
Bac_Pro_Bet_8_[  ----------------------------------------MNTNQLIEAFRKFLPAEAIL
Bac_Pro_Bet_9_[  ----------------------------------------MSPQELVNNLRSFLPPEAVL
Bac_Pro_Gam_14   ---------------------MHHQ---------------IDRNVLINEFRTFLPQASII
Bac_Pro_Gam_15   ---------------------MRHP---------------ADRRRLLEEFKRWLPPASIL
Bac_Pro_Gam_21   ---------------------MNILFDERLDGELAR----RDKTEVLTDIQQAVPTLTLL
Bac_Pro_Bet_12   ---------------------MNILYNEEIDGPLSK----VDRADLFAELRQAMPDLLIL
Bac_Pro_Gam_20   ---------------------MNILHDERIDGKLPR----VDRSALVQELIAHLPSLHLL
Bac_Pro_Bet_1_[  ---------------------MTYAYDERLDGPLRD----HDKAAIVRDLHTLLPDLQLL
Bac_Pro_Gam_23   ---------------------MSILYEERLDGALPD----VDQTSVLMALREHVPGLEIL
Bac_Pro_Gam_24   ---------------------MSILYEERLDGALPD----VDRTSVLMALREHVPGLEIL
Bac_Pro_Gam_7_[  ---------------------MNILYDERLDGPLPQ----VDKDGLLAELRLRLPDLELL
Bac_Pro_Bet_10   ---------------------MSIFYDERVDGVLPD----VDKAALLEELRRVLPDVEVL
Bac_Pro_Gam_6_[  ---------------------MNILYDERVDGVLPD----VDKAALLHALQTRLPQLEVL
Bac_Pro_Bet_6_[  ----------------------------------------MLSPAFLSKLRSVLPAHCVL
Bac_Pro_Gam_5_[  ---------------------MSNRQ--------------ARQNQLANAFHQFLPTHSVL
Bac_Pro_Gam_2_[  ---------------------------------------------MLAALKTLLPAEALI
Bac_Pro_Gam_29   ---------------------MSHTPN-------------IDKPALIRALQQQLPAELIL
Bac_Pro_Gam_13   -----------------MEEIMSELPAAHAAGAGAPAPENDAKARMRAALTAELPEEIVL
Bac_Pro_Gam_4_[  ---------------------MSSFN--------------TNRALLLAALQDIQPQPLIL
Bac_Pro_Bet_11   ---------------------MPHQPEKTV----------ARNAGLIKALRDFLPPESVL
Bac_Pro_Gam_10   ---------------------MRPANLEEPRAVSA-----RERDALIRELLDVVPSHGVL
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   TELSEITPYECDALAAFTRLPLAVVLPETEAQVQTVLKTCMRLGVPVVARGAGTGLTGSA
Bac_Pro_Gam_3_[  FDTEQCSPYECDGLSAYREKPMAVVLPANVEEVKTALRICKEHQVPVITRGSGTGLAGGA
ORFprot_b)       ------------------------------------------------------------
Bac_Pro_Gam_1_[  SGAENTRPFECDGLSVYKQEPLAVVLPSEVGQIKKVLEICRQNNTPVVTRGAGTGLSGGA
Bac_Pro_Gam_26   VDKETLHPYECDGLSVYCSLPTCVVLPANTEEVMAVMALCHQHSVTVVARGAGTGLSAGA
Bac_Pro_Gam_19   WNSEDTTPYECDGLTAYRQRPLVVALPETYAQVQAVLKACHALDVPVVARGAGTGLSGGA
Bac_Pro_Bet_2_[  YRDEDTVAYDCDGLAAYRRLPLAVALPETESQVQRIVQICHRLGVPIVPRGAGTGLSGGA
Bac_Pro_Bet_3_[  YRDEDTAPYECDGLAAYRQLPLAVVLPETESQVRRVLQTCHRLDVPVVPRGAGTGLSGGA
Bac_Pro_Gam_22   VDSETQKPYECDGLSMYCEMPMLVVLPERISEVQKVLRICHQYNIPIVPRGAGTGLCAGA
Bac_Pro_Gam_12   HEPEALKVYECDGLTAYRRLPLMAVLPDTVEQVKEVMRICSKASVPVVARGAGTGLSGGA
Bac_Pro_Gam_27   DDDETMKPYECDGMSMYCEMPMLVVLPETVEQVQDVMRLCHANDVPVVARGAGTGLSAGA
Bac_Pro_Gam_28   TDEETLKPYECDGLSMYCVMPLLVVLPETVEQVQQVMRLCHQFGIPVVARGAGTGLSAGA
Bac_Pro_Bet_7_[  ADPGRLRAYECDGLMLVREMPLAVALPTTEAQVVAVLRTCHRLGVPVVPRGAGTGLSGGA
Bac_Pro_Gam_16   HGAEDLRPYECDGLAAVRELPLCVALPTDREGVQAVLQICQRHGVAVVPRGAGTGLSGGA
Bac_Pro_Gam_17   SSAEELRPYECDGLSVLRELPLCVVLPTDRESVQAVLHICQRYGVAVVPRGAGTGLSGGA
Bac_Pro_Gam_11   VEESERRAYECDGLSAFREVPGAVALPASMEQLQLCLKTCREHGVPVVPRGAGTGLSGGA
Bac_Pro_Gam_18   TEAEDLHPYECDGLSVYRGVPLAVALPATAEAAAQVLRLCREAGVPVIARGAGTGLSGGA
Bac_Pro_Bet_8_[  HEAEDLRPYECDALSAYRQLPMIVVLPRTEAEIAAILQTCQAERIPVVARGSGTGLSGGA
Bac_Pro_Bet_9_[  YETEDLRPYECDGLSAYRQLPLVVVLPRTEEQIIKILKLCYATQTPVVARGAGTGLSGGA
Bac_Pro_Gam_14   FEKEALKPFECDGLSAYHCVPWLVVLPETIEQIQRILRLCYQQGVPVVARGAGTGLAGGA
Bac_Pro_Gam_15   AEAEALRPYECDGLSVYRCPPWLVLLPETVEQIQQILRICYREGVPVVARGAGTGLAGGA
Bac_Pro_Gam_21   HREEDLRPFECDGLAAYRVLPMLVALPENLEQVEALLKRCHALDVPVVTRGAGTGLSGGA
Bac_Pro_Bet_12   HREEDLRPYECDGLAAYRTVPLLAVLPERVEQVESILRICHARRVPVVARGAGTGLSGGA
Bac_Pro_Gam_20   YKDEDLAPYECDGLSAYRTKPLLVVLPETVDQVQKIMKICHDFGAPVVARGAGTGLSGGA
Bac_Pro_Bet_1_[  HAKEDLRPFECDGLSAYRITPMLVALPGTIDEVQALLQYAHAHGVPVVARGAGTGLSGGA
Bac_Pro_Gam_23   HTDEEITPYECDGLSAYRTRPLLVVLPKQIEQVAAILAVCHRLRVPVVTRGAGTGLSGGA
Bac_Pro_Gam_24   HTDEEIIPYECDGLSAYRTRPLLVVLPKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGA
Bac_Pro_Gam_7_[  HAAEDLRPYECDGLSAYRCTPLLVALPERIEQVQGLLALCHRLKVPVVARGAGTGLSGGA
Bac_Pro_Bet_10   SDAEDLKPYECDGLSAYRATPLLVILPETIDQVQTLLRLCHARQVPVVARGAGTGLSGGA
Bac_Pro_Gam_6_[  HEREQLAPYECDGLSAYRTTPLLVALPRHLDEVQELLRICHQMRVPVVARGAGTGLSGGA
Bac_Pro_Bet_6_[  NEREDLVPFESDGLAAYRNVPDVVALPENEAQVAAVLQLCHENRVAVVARGAGTGLAAGA
Bac_Pro_Gam_5_[  IHEEELRPYECDGLSAYRKMPLIVVLPKTIEQIQNILQVCREQDVPIVCRGAGTSLSGGA
Bac_Pro_Gam_2_[  HEPEALHPYECDGLPTYRQMPLLVVLPETLEQLQQVVRLCHQQRVPVVARGAATGLSGGA
Bac_Pro_Gam_29   HEQEALRPYECDGLSAYRQVPLLVVLPENAEQVQRVMQCCHRLGVPVVARGAATGLSGGA
Bac_Pro_Gam_13   HAEEDLRPFECDGLSAYRRLPMLAVLPSTIEQVQAVLRICHAHDTPVVARGAGTGLSGGA
Bac_Pro_Gam_4_[  NQPEQLKPYECDGLSAYRSVPLLVVLPETVEQVQAILKICQAQRVPVVARGAGTGLSGGA
Bac_Pro_Bet_11   DQREQLRPFECDGLSVYRQLPMVVVLPETIAQVQGIMRLCHAQDIPVVARGAGTGLSGGA
Bac_Pro_Gam_10   HDDEDLRPYECDGLSAYRRKPMLVVLPETIEQVQQVLRLCQAHQVPVVARGAGTGLSGGA
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   MPTPDGIVLAMSRFNRILNIDKQARTATVQPGVRNLAVSEAAAPHGLFYAPDPSSQLACS
Bac_Pro_Gam_3_[  LPLADGIVLGLSKMNQILHVDPLARTAVLQPGVRNISVTQAVEPYGLYYAPDPSSQVACS
ORFprot_b)       ------------------------------------------------------------
Bac_Pro_Gam_1_[  MPLKDSVVLGLSKLTNIISIDQNARTAVVQPGVRNLAISEAAEEFGLYYAPDPSSQIACT
Bac_Pro_Gam_26   LPIEGGIVLSLARLNQILDIKNESGLALVQPGVRNLAISESASKYGLYYAPDPSSQIACS
Bac_Pro_Gam_19   MPHKLGVTLSLAKFNKILKLDAASRTAVVQGGVRNLAISEAAAPLGLYYAPDPSSQIACT
Bac_Pro_Bet_2_[  MPIRHGVVVSLARFKKIIEVDSYARTATVQPGVRNLSISEAAAPYGLYYAPDPSSQIACT
Bac_Pro_Bet_3_[  MPLRDGIVLSLARLNKIINIDPYARTATLQPGVRNLAISEAAAPYGLYYAPDPSSQIACT
Bac_Pro_Gam_22   MPSASGVVLSMAKFDQIIAIDPLARTARLEPGVTNLAISEAASEFGLYYAPDPSSQVACT
Bac_Pro_Gam_12   LPLEDGVLLVLARFNRILEVDRINRTALVQPGVRNLAISEHVAPLGLYYAPDPSSQIACS
Bac_Pro_Gam_27   MPSSNGVLLSLAKFNRVLQIDPLARTARLQPGVRNLAISEEVAQYGLYYGPDPSSQIACT
Bac_Pro_Gam_28   MPDAGGVVLSLAKFNRILHIDPLARSARLQSGVRNLAISEAAADYGLYYGPDPSSQIACT
Bac_Pro_Bet_7_[  TPHKQGIVLSTARLNRIVSVDRLAQQAVVQPGVRNLAVSEAAAPYGLYYAPDPSSQIACS
Bac_Pro_Gam_16   RPLRDAVLLSLARLRHIVAIDRENRTARVQPGVRNLAISEAARPLGLYYAPDPSSQIACS
Bac_Pro_Gam_17   RPIRGAVLLSLARLRNILAIDLENRTARVQPGVRNLAISDAARPLGLYYAPDPSSQIACS
Bac_Pro_Gam_11   LPSAEGLLLSMARFNRILEIDADNRCAVVQPGVRNLAISEATAPAGLYYAPDPSSQIACS
Bac_Pro_Gam_18   TPRAGTVVLSLARLNRILEIDPLARVARVQPGVRNLAISEAAAPLGLYYAPDPSSQIACT
Bac_Pro_Bet_8_[  LPHAEGVLLSLARLNHILEIDPAAGTARVQPGVRNLAISEAAAYYGMYYAPDPSSQIACS
Bac_Pro_Bet_9_[  LPHAQGVLLSLAKLNQIIAIDPLARMARVQPGVRNLAISEAVAAYGLYYAPDPSSQIACS
Bac_Pro_Gam_14   MPLANGVLLSLAKLNQVLEIDIANRLAVVQPGVRNLAISQAVAPFGLYYAPDPSSQIACT
Bac_Pro_Gam_15   LPLDNGVLLGLAKLNRILEVDPRNRLARVQPGVRNIAVSEAARPYGLFYAPDPSSQIACT
Bac_Pro_Gam_21   LPLEQGVLLVMSRFNKILSVDPDARMARVQPGVRNLAISEAAAPYGLYYAPDPSSQIACS
Bac_Pro_Bet_12   LPLAQGVLLVMARFNRILELNPKGRYARVQPGVRNLAISQAAAPYELYYAPDPSSQIACS
Bac_Pro_Gam_20   LPIEQGVLLVLAKLNKILEINPEGRFARVQPGVRNLAISEASAPYGLYYAPDPSSQIACS
Bac_Pro_Bet_1_[  LPLEKGMLLVMSRFNRILHIDPDAGIARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACS
Bac_Pro_Gam_23   LPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACS
Bac_Pro_Gam_24   LPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACS
Bac_Pro_Gam_7_[  LPLENGVLLVMARFRRILEIDPLGRFARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACS
Bac_Pro_Bet_10   MPLEKGVLLVMARFKRVLSVDPDARVARLEPGVRNLAISEAAAPYGLYYAPDPSSQIACS
Bac_Pro_Gam_6_[  LPLEKGLLLVMARFDKILHIDPGARTARVQPGVRNLAISQAAAPFGLYYAPDPSSQIACS
Bac_Pro_Bet_6_[  LPVDGAVLLVLAKLNRVKAIDPLARTAVVEPGVRNLAISEAVAPHGLYYAPDPSSQIACS
Bac_Pro_Gam_5_[  LPLNDGVLLSVAKFNRILEIDPVNRTARVQPGVRNLAISQSVAPYGLYYAPDPSSQIACS
Bac_Pro_Gam_2_[  LPLADGVLLGLAKFNRILEIDPLARTARVEPGVRNLAISQAVAPHGLYYAPDPSSQIACT
Bac_Pro_Gam_29   LPLADGVLMSLAKLNRILHIDPLNRTARVQPGVRNLAISEAVAAQGLYYAPDPSSQIACT
Bac_Pro_Gam_13   LPLESGVLLSLAKFNRILDIDTANRRATVQPGVRNLAISQAVDHLGLYYAPDPSSQIACS
Bac_Pro_Gam_4_[  LPHEQGVLLSLAKFNKILDINPERRTATVQPGVRNLSITQAVDHLGLYYAPDPSSQIACT
Bac_Pro_Bet_11   LPLANGVLLSLAKFRNILHIDPHNAMATVQPGVRNLAISEAAAAYGLYYAPDPSSQIACT
Bac_Pro_Gam_10   FPLANGVLLGLAKFNRILAIDPDNRSARVQPGVRNLAISEAAAAHGLYYAPDPSSQIACS
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   IGGNVAQNSGGLHCLKYGLTTHNVLKIRAVTIDGSILELGGEAYDAPGLELLPLFIGSEG
Bac_Pro_Gam_3_[  IGGNVAENSGGVHCLKYGLTVHNVLSITVINMNGDILVLDEK---DDGVDLLALLNGSEG
ORFprot_b)       --------------------------------------------------------GSEG
Bac_Pro_Gam_1_[  IGGNVAENAGGVHCLKYGLTVQNIESLKILTIDGDELVFSRQ---DDGLGLLALMTGSEG
Bac_Pro_Gam_26   IGGNVAENAGGVHCLKYGLTVHNIVSLIFVTAEGERIEVGDKSADIAGFDFLALLTGSEG
Bac_Pro_Gam_19   IGGNVAENSGGVHCLKYGLTVHNVLKVKGFTIEGEEVEFGGDALNSPGFDLLSIIIGSEG
Bac_Pro_Bet_2_[  IGGNVSENSGGVHCLKYGLTVHNVLRVRAVTMEGEIVEFGSLGPDAPGLDLLAVLIGSEG
Bac_Pro_Bet_3_[  IGGNVAENAGGVHCLKYGLTVHNVLRVRAITMEGDLVEFGSLGPDCAGLDLLAVLIGSEG
Bac_Pro_Gam_22   IGGNVAENSGGVHCLKYGLTIHNVLRLKILTVEGDLLTFGSEGLDCAGLDMLAIFIGSEG
Bac_Pro_Gam_12   IGGNVAENAGGLHCLKYGLTVHNILELKVITIAGDEITVGGEALDSPGYDLLALMTGSEG
Bac_Pro_Gam_27   IGGNVAENSGGVHCLKYGLTVHNILSVEMVTVEGERIIVGSDGLDSCGMDLLALSTGSEG
Bac_Pro_Gam_28   IGGNVGENSGGVHCLKYGLTTHNILSVEMVTVDGERVVIGSDGLDSCGMDLLALITGSEG
Bac_Pro_Bet_7_[  IGGNVAENSGGVHCLKYGLTVHNVLRVRMVNMAGEVMEIGSAAPDSAGYDLLAVTIGSEG
Bac_Pro_Gam_16   IGGNVAENSGGVHCLKYGLTVHNILELDVLTATGETLRIGSQALDSPGYDLLALMTGSEG
Bac_Pro_Gam_17   IGGNVAENSGGVHCLKYGLTVHNILALEVLTAAGEALQIGSQAPDSPGYDLLALMTGSEG
Bac_Pro_Gam_11   IGGNVAENAGGVHCLKYGLTVHNVTGLEFVTLDGEVIRVGGKTLDTEGLDLLAFLIGSEG
Bac_Pro_Gam_18   IGGNVAENSGGVHCLKYGLTVHNLLRLKVATIDGEIIELGAEALDAPGYDLLALFTGSEG
Bac_Pro_Bet_8_[  IGGNVAENSGGVHCLKYGLTVHNILRLRVLTIEGDLLEIGADALDSPGFDLLALMTGSEG
Bac_Pro_Bet_9_[  IGGNVAENSGGVHCLKYGLTVHNILKLRVLTIDGECLEIGGESLDSAGYDLLALMTGSEG
Bac_Pro_Gam_14   IGGNVAENSGGVHCLKYGLTTHNLLRVKMLTMGGELVTIGSHGLDSAGLDLLALIAGSEG
Bac_Pro_Gam_15   LGGNVAENSGGVHCLKYGLTTHNVLEVKLVTMEGELLTLGGGGLEGPGLDLLAVAIGSEG
Bac_Pro_Gam_21   IGGNVAENAGGVHCLKYGLTVHNVLRVDVLTIEGERMTLGAESLDAPGFDLLALMNGSEG
Bac_Pro_Bet_12   IGGNVAENAGGVHCLKYGLTVHNVMKIEVLTMEGERITLGADALDAPGFDLLALFTGSEG
Bac_Pro_Gam_20   IGGNVAENAGGVHCLKYGLTVHNLLKINIITVEGEFLTLGSDALDTAGFDLLALFTGSEG
Bac_Pro_Bet_1_[  IGGNVAENAGGVHCLKYGLTVHNILRVEIVTIDGERLTLGAEALDTPGFDLLALITGSEG
Bac_Pro_Gam_23   IGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGETLTLGSDALDSPGFDLLALFTGSEG
Bac_Pro_Gam_24   IGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGSDALDSPGFDLLALFTGSEG
Bac_Pro_Gam_7_[  IGGNVAENAGGVHCLKYGLTVHNLLQVDIVTLEGERLSLGSSALDSAGFDLLALFTGSEG
Bac_Pro_Bet_10   IGGNVAENAGGVHCLKYGLTVHNVMKVDMLTIEGERMTLGSDALDSPGFDLLALYTGSEG
Bac_Pro_Gam_6_[  IGGNVAENAGGVHCLKYGLTVHNLLRIEVLTVDGEPLTLGSDALDAPGFDLLALFTGSEG
Bac_Pro_Bet_6_[  IGGNVAENSGGVHCLKYGLTVHNIMKLRALTIAGDVLEIGSDALDAPGYDLLALLTGSEG
Bac_Pro_Gam_5_[  IGGNVSENAGGVHCLKYGLTVHNVLQVTFLTIDGELITLGSSGLDGPGYDLLAVLTGSEG
Bac_Pro_Gam_2_[  IGGNVAENSGGVHCLKYGLTVHNILELKLVTAEGELITLGSGALDTPGYDLLALLNGSEG
Bac_Pro_Gam_29   IGGNVAENSGGVHCLKYGLTVHNVLQLKLVTADGELITLGAEALDAPGFDLLALLIGSEG
Bac_Pro_Gam_13   IGGNVAENSGGVHCLKYGLTTNNIVQIEIVTIEGERLTIGSPALDSPGYDLLALMTGSEG
Bac_Pro_Gam_4_[  IGGNVAENSGGVHCLKYGLTVHNILQIKIVTIDGELLTIGGHSLDSAGYDLLALLTGSEG
Bac_Pro_Bet_11   IGGNVAENSGGVHCLKYGLTVHNILMLKVVTAEGELLTIGAETLDAPGYDLLALMTGSEG
Bac_Pro_Gam_10   IGGNVAENAGGVHCLKYGLTVHNILELKVVTIDGELITLGGQSLDSPGYDLLALMTGSEG
                                                                         ####


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   MFAVVTEVVLKLVPLPETAKVIQVSFDDMGKAGHAVADVIAAGIIPAGLEMMDGAATRAV
Bac_Pro_Gam_3_[  LLGVIVEVKVKLLPKPDTAQLVMAGFDSVGACADAVTTVLEQGIIPAGLEMMDKFSIMAA
ORFprot_b)       LLGVITEITVKLTPKPELARLVMAGFSSVRDCADTVAEIIKNGIIPSGLEMMDKFAIEAS
Bac_Pro_Gam_1_[  LLGVITEITVKLTPKPELAKLVMAGFDSVRDCAQAVADIIKNGVIPAGLEMMDEFAIEAA
Bac_Pro_Gam_26   MLGLVTEITVRLLPIPELARVILAGFDTVENAANAVNAIISDGIIPAGLEMMDRYAIQAA
Bac_Pro_Gam_19   MLAVTTEVTVKLVPKPRLARCIMASFDDLRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAV
Bac_Pro_Bet_2_[  MFSIVTEVTVKLIPKPQTAQVIMASFDDVVKGGDAVAGIIAAGIIPAGLEMMDKPATRAV
Bac_Pro_Bet_3_[  MFAVVTEVTVRLLPKPQVAQVIMASFDDVVKGGAAAAAIIAAGIVPAGLDMMDQLATHAV
Bac_Pro_Gam_22   LLGVVTEVLVKLLPVPEKAQVVMAGFGTIVAAGDAVAAVIAQGIIPAGLEMMDEHAIIAA
Bac_Pro_Gam_12   LLGVVVEVRVRLLPKPACAKVLLAAFDDIQSAGQAVGEIIAAGIIPGGLEMMDNLAIRAT
Bac_Pro_Gam_27   MLGIITEVKVKLLPKPEKAQVVMAGFDSIQNAGDAVGGIIAHGIIPGGLEMMDGYAITAA
Bac_Pro_Gam_28   LLGIITEVQVKLLPTQEIARVVMAGFGTVDEAGAAVGGIIAQGIIPAGLEMMDSHAIIAV
Bac_Pro_Bet_7_[  LLGVVTEVTVKLVPKPRVARCVLAAFADIRKAGQAVADVIAAGIIPAGLEMMDQATTAAV
Bac_Pro_Gam_16   LLGVVTECTVRLLPMPEHVLVLLAAFSSVEAAAESVSAIIASGIIPAGLEMMDRLAIEAA
Bac_Pro_Gam_17   LLGVVTECTVRLLPVPEHTLVLLAAFASVAAAAESVSAIIAAGIIPAGLELMDQLAIEAA
Bac_Pro_Gam_11   MLGIVTEVTVRLLPRPERTQVLMASFDDVETAGAAVAGIIAAGLIPAGLEMMDNAAIRAA
Bac_Pro_Gam_18   LLGVVVEATVRLIPKPECARVVLAAFDDLGKAGQAVADIIGAGIIPAGLELMDQPAIAAV
Bac_Pro_Bet_8_[  MLGIVTEITVRLLPKPETVKLVMAVFDDVRKAGEAVASVIQAGIIPAGMEMMDKITIHAV
Bac_Pro_Bet_9_[  MLGIVTEVTVKLIPLPEKAQLVMAAFDDVHKAGNAVANVIGAGIIPAGMEMMDRITIHAV
Bac_Pro_Gam_14   MLGIIVEITVKLLPTPEQAQVVLAAFDDIEKAGQAVADIVAAGLIPAGLEMMDKAAIKAA
Bac_Pro_Gam_15   LLGVAVEITVKLLPLPEDTQVLLAAFDAVEKAGQAVAGIIAAGLLPAGLEMMDHTIIQAA
Bac_Pro_Gam_21   MLGVVTEITVKLLPKPETAKVLMASFDDVEKAGRAVGDIIAAGIIPGGLEMMDKLAIKAA
Bac_Pro_Bet_12   MLGIVTEVTVKLLPKPRVARVLMASFDSVEAAGKAVADIIGAGIIPGGLEMMDKLAIQAA
Bac_Pro_Gam_20   MLGIVVEVTVKLLPKPKVAKVLMASFDDIGKAGQAVGNIIAAGIIPGGLEMMDNLAIKAA
Bac_Pro_Bet_1_[  MLGVVVEVTVKLLTKPQSAKVLLASFDEIEKAGDAVAQIIGAGVIPGGLEMMDNLAIRAA
Bac_Pro_Gam_23   MLGVTTEVTVKLLPKPPVARVLLASFGSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAA
Bac_Pro_Gam_24   MLGVTPEVTVKLLPKPPVARVLLASFDSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAA
Bac_Pro_Gam_7_[  LLGVVVEVTVRLLPRPPVAKVLLASFDDVESAGRAVADLIGAGIVPAGLEMMDNLSIRAA
Bac_Pro_Bet_10   MLGVAVEITVKLLPKPQMAKVLLASFDDVDKAGRAVGDIIAAGIIPGGLEMMDNLSIRAA
Bac_Pro_Gam_6_[  MLGVITEVTVKLLPKPQTAKVLLAAFDSVEQAGRAVADIIAAGIIPGGLEMMDNLAIRAA
Bac_Pro_Bet_6_[  MLAVITEVTVKLLPRPERAQVVLAAFDDVAKAGAAVGNIIAAGVIPAGLEMMDRLAIRAA
Bac_Pro_Gam_5_[  MLGVIVEITVKLLPKPPQVQVLLAAFNNIEDAGTAVAKIIGAGIIPAGLEMMDNPAIRAA
Bac_Pro_Gam_2_[  MLGIVVEVVVKLLPAPERAQVLLAAFDDLALAADAVGEIIAAGIIPAGLEMMDGLAIRAA
Bac_Pro_Gam_29   MLGIVVEVLVKLLPTPERAQVLLAAFDDVSKAANAVGDVIAAGIIPAGLEMMDGLAIRAA
Bac_Pro_Gam_13   LLGVIVEVVVKLLPKPELAQCALIAFDDVRKAGNAVAEIIKAGIVPAGLEMLDHPAILAT
Bac_Pro_Gam_4_[  LLGVIVEVTVKLLPKPERVQVLLAAFDDVIKAGAAVGAIISDGIIPAGLEMMDGFAIKAA
Bac_Pro_Bet_11   MLGIIVEVTVKLLARPERAQVVLAAFDDVVKAGEAVGAIIAAGIIPAGLEMMDRLAIQAA
Bac_Pro_Gam_10   MLGVIVEITVKLLPRPERAQVLLAAFDSVERAGEAVAAIIGSGIIPAGLEMMDNNAIRAA
                 ############################################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   DDYLNAGFDRKAEAVLLCESDGMA-EEVEAEVAEMQAIFRRSGAIDMKVSRNEIERTAIW
Bac_Pro_Gam_3_[  EEYAKVGYPLEAEALLLCEVDGSF-DQVKVDTRRIADILTQSGATTITVSQNEAERIALW
ORFprot_b)       EAFAHPGYPLDAQALLLCELDGAI-DSVNEDLNKVLSLL--SNATTTRVSENEDERLLFW
Bac_Pro_Gam_1_[  EDFAKPGYPLMAKALLLCELDGSI-ELVNNDVSVVKNLL--SKATSIRVSETEEERLLLW
Bac_Pro_Gam_26   EDFAHAGYPKDAEALLLCELDGTA-DDVNHQLQLAKTLLESAGATSLRVSNNEEERALMW
Bac_Pro_Gam_19   EDFVHAGYDLSAEAILLCESDGTP-EEVEEEIGRMSEVLRRCGATAIAVSRDEAERLRFW
Bac_Pro_Bet_2_[  EEFVHAGYDLDAAAILLCESDGTP-EEVADEIVRMTAVLREHGATRIAISRTENERLRFW
Bac_Pro_Bet_3_[  EEFVQAGYDLEAQAILLCESDGTP-DEVADEIERMTAVLHAHGATRIQISRSEAERLKFW
Bac_Pro_Gam_22   EAYVNAGYPLESKALLLCELDGTE-GEVEQYIAVVAGIFKDLGAQSIRISSSAAERALLW
Bac_Pro_Gam_12   DDFCKAGYPTEAAAVLLCELDGIE-EEVMDQIVDAKGIFEACGASELRIAEDDAERARFW
Bac_Pro_Gam_27   EDFAHAGYPRDAQALLLCEVDGTA-EEVQEHIEQAENLFRSFGATSVRTSQSEEERALLW
Bac_Pro_Gam_28   EAFTGAGYPVEAAALLLCEVDGTK-EEVQEHIEKAEALFRDFGATSIRTSKDDAERALLW
Bac_Pro_Bet_7_[  EQFVHAGYPLDAAAILLCESDGTE-EEVQDEIARVRVLLEAAGATEIRISSDEAERLRFW
Bac_Pro_Gam_16   EDFVHAGYPRDAAAILLCELDGPA-VELEEQLREVETLLQRHGARAIRIAEDAATRLLLW
Bac_Pro_Gam_17   EDFVHAGYPRDAAAILLCELDGSA-VELKERRQEVEVILQRHGAGAIRMAEDAATRLLLW
Bac_Pro_Gam_11   EDFVHAGYPVDAAAILLCELDGSN-SEVSESVMFVREKLLGLGATEVRTAQDDAERTRFW
Bac_Pro_Gam_18   EPFVHAGYPLDAAAILLCESDGTP-EEVAEEIVRMEAVMSAAGATDCRVSRDEAERLRFW
Bac_Pro_Bet_8_[  EDFVHAGYDLEGAAILLCESDGMA-EEVADEIERIRTILQASGATRISLAQDEAERQRFW
Bac_Pro_Bet_9_[  EEFLHAGYDLDAAAILLCESDGGT-EEVADEIERIYAIMQQSGATKISTSRNEAERLRFW
Bac_Pro_Gam_14   EDFIHAGYPNNAEAILLCELDGAR-EQVEEELDKAVALLTDGGAIDVRVAQSEQERQKMW
Bac_Pro_Gam_15   EDFIGAGYPVEAEAVLIVEFDGMR-EQVEQDLERAAYLLKACGAYRLDIAATPEDRLKAW
Bac_Pro_Gam_21   EDFVKAGYPLDAEAILLCELDGVE-ADVDDDCETVRRVLEKAGATQIQQARDELERAKFW
Bac_Pro_Bet_12   EDFIHAGYPVEAEAILLCELDGVE-LDVAEDIERVRAVLDEAGATAVSLARDEAERALFW
Bac_Pro_Gam_20   EDFIHAGYPIDAQAILLCELDGVE-SDVDEDCQIVRSVLENSGATAIQMAKDEAERQRFW
Bac_Pro_Bet_1_[  EDFIHAGYPVDAEALLLCEVDGAE-SDVEEDCARVDSLLRAAGATDIRLAANEAERQRFW
Bac_Pro_Gam_23   EDFIHAGYPVDAEAILLCELDGVE-SDVQEDCERVNDILRKAGATDVRLAQDEAERVRFW
Bac_Pro_Gam_24   EDFIHAGYPVDAEAILLCELDGVE-SDVQEDCERVNDILLKAGATDVRLAQDEAERVRFW
Bac_Pro_Gam_7_[  EDFIHAGYPVDAAAILLCELDGVE-ADVHEDCERVRELFEAAGATSVRQAQDEAERQRFW
Bac_Pro_Bet_10   EDFIHAGYPVDAEAILLCELDGAE-ADVHADCERVSHIVRAAGATDVRQARDEAERQRFW
Bac_Pro_Gam_6_[  EDFIHAGYPVDAQAILLCELDGVE-ADVHDDCNRVRQVLEQAGASEVRQARDEAERVRFW
Bac_Pro_Bet_6_[  EAFVHAGYPLDCEALLLCEVDGVN-EEVSADIYTVRQVLEASGATEIRTADSEEQRLKFW
Bac_Pro_Gam_5_[  EDFIHAGYPKEAEAILLCELDGNNAEEVSEQVAQVSDLLQSCHATEVRVAKDEQERQKIW
Bac_Pro_Gam_2_[  EAFAHAGYPKDAAAILLCELDGIN-EEVSVHLKLVHDLLLQVGATEVRTARDEAERQLFW
Bac_Pro_Gam_29   EDFVHAGYPVDAQAILLCELDGAN-EEVSAHLARVRQQLLDSGATEVRTARDEDERTLFW
Bac_Pro_Gam_13   EEFVHAGYPTDAAAILLCEIDGTE-GEVADDMARVREVVEASGATDIRISRDDVERALFW
Bac_Pro_Gam_4_[  EEFAHAGYPTDAAAILLCELDGTN-AEVAEQLSRVHDILLHSEATEVRTAKDAQERATFW
Bac_Pro_Bet_11   EDFVHAGYPRDAEAILLCELDGTN-AEVSEYIMTMRRILTDSGATEVRTAVDEAERQLFW
Bac_Pro_Gam_10   EDFVHAGYPVEAEAILLCELDGTN-AEVSEDIMKVRNLLIAQGATEVRTAGDDQERLRFW
                 ######################    #############   ##################


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   AGRKAVFPATARLAPDSYCMDGTIPRRKISAMLAFTAGLSQKYGLQCINVFHAGDGNMHP
Bac_Pro_Gam_3_[  QGRKNAFPAVGRFSPDYYCMDGTIPRKRLAYVLQEIEKLSQKYQLEVANVFHAGDGNLHP
ORFprot_b)       KGRKAAFPSVGRLSPDYYCMDGTIPKRHLATVLEKISELSAHYKLRVANVFHAGDGNLHP
Bac_Pro_Gam_1_[  KGRKSAFPAVGRISPDYYCMDGTIPKRHLGDVLEKINKLSRHYNLRVANVFHAGDGNLHP
Bac_Pro_Gam_26   KGRKSAFPAVGRLSPDYYCMDGTIPRRQLAPVLAEIHRLSEQYGLRVANVFHAGDGNLHP
Bac_Pro_Gam_19   SGRKNAFPASGRISPDYMCMDSTIPRKRLADILLAIAEMEKKYRLRCANVFHAGDGNLHP
Bac_Pro_Bet_2_[  SGRKNAFPAAGRISPDYYCMDGTVPRRSIGPLLSRIEEMEKKYRLRCINVFHAGDGNMHP
Bac_Pro_Bet_3_[  SGYKNAFAAAGRISPDYYCMDGTVPRRAIGPLLARIAEMEKQYGLRCMNVFHAGDGNMRS
Bac_Pro_Gam_22   QGRKSAFPAIGRISPDYYCMDGTIPRGQLANVLTAMERRASALGLRVANVFHAGDGNLHP
Bac_Pro_Gam_12   AGRKAAFPAAGRISPDYLCMDGTIPKRELPKVLNAMQALSQASGLRIMNVFHAGDGNLHP
Bac_Pro_Gam_27   KGRKSAFPAVGRISPDYYCMDGTIPRGQLAHVLTEMQNMSERFKLRVANVFHAGDGNLHP
Bac_Pro_Gam_28   KGRKNAFPAMGRISPDYYCMDGTIPRAHLGQVLNEMQDMSKRFGLRVANVFHAGDGNLHP
Bac_Pro_Bet_7_[  AGRKAAFPAAGRIAPDYYCMDGTIPRQRLADMLEAMETMAKKYDLGLLNVFHAGDGNLHP
Bac_Pro_Gam_16   KGRKAAFPAVGRLAPDYYCMDGTIPRQRLAEVLERITAWSAEYGLRVANVFHAGDGNLHP
Bac_Pro_Gam_17   KGRKAAFPAVGRLAPDYYCMDGTIPRQRLAEVLEQIAAWSVEYGLRVANVFHAGDGNLHP
Bac_Pro_Gam_11   AGRKAAFPAAGRISPDYYCMDGTIPRHQLGYVLERIDALSAEHGLGVCNVFHAGDGNLHP
Bac_Pro_Gam_18   AGRKAAFPAVGRISPDYYCMDGSIPKKCLAAVLEAIRGMERKYGLRCANVFHAGDGNLHP
Bac_Pro_Bet_8_[  AGRKAAFPAAGRVSPDYYCMDGTIPRKHLAHVLEQIEQLSAEYGLRCMNVFHAGDGNLHP
Bac_Pro_Bet_9_[  AGRKAAFPAAGRVSPDYYCMDGTIPRKHLADVLDGIEKLSQEYGLRCMNVFHAGDGNLHP
Bac_Pro_Gam_14   AGRKSAFPAVGRISPDYYCMDGTIPRRFLAKILKNIGDLSEKYGLAVANVFHAGDGNLHP
Bac_Pro_Gam_15   AGRKAAFPAAGRISPDYYCMDGTIPRRFLADTLKKIAELSTQYGLTVANVFHAGDGNLHP
Bac_Pro_Gam_21   AGRKNAFPAVGRMSPDYYCMDGTIPRCELPRVLKGIAALSEQSGLAVANVFHAGDGNMHP
Bac_Pro_Bet_12   AGRKNAFPAVGRMSPDYYCMDGTIPRRHLPKVLRGTAELSEQYGLRVANVFHAGDGNMHP
Bac_Pro_Gam_20   AGRKNAFPAVGRISPDYYCMDGTIPRRELPNVLTGIQALSEEYGLAVANVFHAGDGNMHP
Bac_Pro_Bet_1_[  AGRKNAFPAVGRISPDYYCMDGTIPRRELARVLRGIADLSAQYGLRVANVFHAGDGNMHP
Bac_Pro_Gam_23   AGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMHP
Bac_Pro_Gam_24   AGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMPP
Bac_Pro_Gam_7_[  AGRKNAFPAVGRISPDYYCMDGSIPRRELPRVLHGIAELSREYGLRVANVFHAGDGNMHP
Bac_Pro_Bet_10   AGRKNAFPAVGRISPDYYCMDGTIPRRELPKVLKGIAALSEKHGLRVANVFHAGDGNMHP
Bac_Pro_Gam_6_[  AGRKNAFPAVGRLAPDYYCMDGTIPRRQLAGVLQAIAALSAAYNLRVANVFHAGDGNMHP
Bac_Pro_Bet_6_[  AGRKAAFPAVGRLAPDYYCMDGTIPRAQLPHVLKRISEMSDEFGLRVANVFHAGDGNLHP
Bac_Pro_Gam_5_[  AGRKSAFPAVGRISPDYYCMDGTIPRKQLPYVLNKIKELSKTYDLQVANVFHAGDGNLHP
Bac_Pro_Gam_2_[  KGRKSAFPAVGRLSPDYYCMDGTVPRKRLAEVLTGISRLSEHYGLAVANVFHAGDGNLHP
Bac_Pro_Gam_29   KGRKSAFPAVGRISPDYYCMDGTVPRKRLAEVLLETSRLSERYQLPVANVFHAGDGNLHP
Bac_Pro_Gam_13   AGRKAAFPAMGRISPDYYCMDGTIPRRALADVLIGIGELSEQYGQRVANVFHAGDGNLHP
Bac_Pro_Gam_4_[  KGRKSAFPAVGRISPDYYCMDGTIPRKHLPKVLHAINQLSEQFGLAVANVFHAGDGNLHP
Bac_Pro_Bet_11   KGRKSAFPAVGRISPDYYCMDGTIPRRQLPHVLRRISEMSEEYGLAVANVFHAGDGNLHP
Bac_Pro_Gam_10   AGRKAAFPAVGRLSPDYYCMDGTIPRKNLGQILRRIGEMSGEFGLRVANVFHAGDGNLHP
                 ############################################################


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_13   LILFD-NQKGEWPAAEAFGADILEECVRLGGTITGEHGVGLEKINGMCTQFSEAEREIFW
Bac_Pro_Gam_3_[  LILYDANQPGQLEQTEKFGAEILKLCLDVGGTITGEHGVGVEKLDSMCHQFDTAELEIFH
ORFprot_b)       LILYNASRPGELEKTEAFGMDILKLCVEMGGSITGEHGVGIEKLDAMCHQYSSAELDVFH
Bac_Pro_Gam_1_[  LILYDAGIPGELEKTEEFGNKILKICIEAGGSITGEHGVGVEKLDAMCYQYSEAELDVFH
Bac_Pro_Gam_26   LILFDANVPGELEQTEAFGADILRVCVEAGGCITGEHGVGLEKIEQMHYQFNDAELAQFL
Bac_Pro_Gam_19   LILFDANDPDQLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCVQFSAEENEQMF
Bac_Pro_Bet_2_[  LILFNGNDKDEWHRAEAFGSDILEACVELGGTVTGEHGVGIEKINSMCVQFSPEERDAFH
Bac_Pro_Bet_3_[  LILFDGNDPDEWRRAEAFGAQMLETCVGLDGTITGEHGVGIEKTDAMCVQFCAEERDALL
Bac_Pro_Gam_22   LILFDDSVPGEFQKAEQLGAWILEYCVAVGGSITGEHGVGVEKIRQMPIQFTDREIAQFH
Bac_Pro_Gam_12   LILYDANKEGELEKAEAVGARILEICVEAGGTITGEHGVGVEKINQMCVQFETLELAQFH
Bac_Pro_Gam_27   LILFDANVPGEFERTEAFGSAILELCVAVGGCITGEHGVGIEKIRQMAVQFRDDELIQFH
Bac_Pro_Gam_28   LILFDANKEGELERAEAFGSDILELCVKVGGCITGEHGVGVEKIRQMPMQFTDPEIEQLN
Bac_Pro_Bet_7_[  LILFDSNDPDSVRRAEAFGVDILELSVELGGTITGEHGVGLEKINQMCSQFGADELDMFH
Bac_Pro_Gam_16   LILYDANAEGQLHTAEEFGRRILELCVSVGGSVTGEHGVGVEKLDSMCVQFNAAELAQLH
Bac_Pro_Gam_17   LILYDANAEGQLHAAETFGQRILELCVAVGGSVTGEHGVGVEKLDSMCVQFNAAELAQLH
Bac_Pro_Gam_11   LILYDASQPGQIETAETFGEAILELCVAVGGTVTGEHGVGVEKLDGMCVQFASAELEQFH
Bac_Pro_Gam_18   LILFDANKPDELHRTEAFGGEILELCVRHGGSITGEHGVGIEKIDQMCVQFGSEELEVFH
Bac_Pro_Bet_8_[  LILYDANQPGELQKAEAFGARILEICIEAGGSLTGEHGVGIEKLNQMCLQFNDAERNRFH
Bac_Pro_Bet_9_[  LILYDANQPGELERTEEFGGKILEMCIHAGGTITGEHGVGMEKINQMCSQFNTGELEMFH
Bac_Pro_Gam_14   LILYNANHAGELEKAEQFGGDILKLSVEVGGTITGEHGVGVEKINHMCIQFANNELTQFH
Bac_Pro_Gam_15   LILYDAAKPGELDKAEQLGGAILALCVEVGGTITGEHGVGIEKMNHMCLQFSASELRQFH
Bac_Pro_Gam_21   LILFDANKEGELALAEEVGGKILELCVAAGGSITGEHGVGREKINQMCSQFQADEISVFH
Bac_Pro_Bet_12   LILFDANEPGALERAEELGGKILELCVAVGGTITGEHGVGREKINQMCVQFNVDELSFFH
Bac_Pro_Gam_20   LILFDANQPGELEKAEALGGKILELCVKVGGSITGEHGVGREKINQMCSQFNNDEIEVFH
Bac_Pro_Bet_1_[  LILFDANAPGEMDRAEALGARILELCVEVGGSITGEHGVGREKINQMCAQFNSDELTFFH
Bac_Pro_Gam_23   LILFDANEPGEFARAEALGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFH
Bac_Pro_Gam_24   LILFDANEPGEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFH
Bac_Pro_Gam_7_[  LILFDANLAGELERAEALGGRILELCVAVGGSNTGEHGVGREKINQMCAQFNADELTLFH
Bac_Pro_Bet_10   LILFDANLPGEMERAEALGGEILELCVAVGGSITGEHGVGREKINQMCAQFNSDELEMFH
Bac_Pro_Gam_6_[  LILFDANQPGELDRAEALGGKILELCVKVGGSITGEHGVGREKINQMCAQFNSDELTLFH
Bac_Pro_Bet_6_[  LILFDANQAGELQKAEDFGGRILELCVEAGGTITGEHGVGLEKIRQMCAQFAPPELTRFH
Bac_Pro_Gam_5_[  LILYDANQPGELERAEEFGGRILEVCVEVGGTITGEHGVGIEKINQMCVQFNSSELEQFH
Bac_Pro_Gam_2_[  LILFDANQPGELKRAEDLGAEILELSVRVGGTITGEHGVGHEKLHQMCVQFSPAELEQFR
Bac_Pro_Gam_29   LILYDANQPGELKRAEDLGAEILELCVRVGGTITGEHGVGHEKIHQMCVQFSSTELNQFH
Bac_Pro_Gam_13   LILYDANQPGELENTEAFGGAICRLCLEYGGTITGEHGVGVEKIDQMCVQFPSAELTQFH
Bac_Pro_Gam_4_[  LILFDANKTGELERAEAFGGKILELCVEVGGTITGEHGVGMEKINQMCVQFNSLELTQFH
Bac_Pro_Bet_11   LILFDANKEGELHRAEELGQGILQLCVEVGGTITGEHGVGMEKIDQMCIQFRSAELAQFH
Bac_Pro_Gam_10   LILYDADTPGQLERAEDFGGRILELCVEYGGTVTGEHGVGIEKLNQMCTQFTPDELTQFH
                 ##### ######################################################


                        490       500       510       520       530
                 =========+=========+=========+=========+=========+==
Bac_Pro_Bet_13   GVKAAFDPPKLLNRDKVLPTKVRCAEYRQVR-GGSVAERFPHLERF------
Bac_Pro_Gam_3_[  AIKQVFDDTGLLNPGKAVPTLHRCAEVGQMH-VHNNQLPFPELERF------
ORFprot_b)       QIKNAFDPISLLNPGKAVPTLHRCAELGNMH-VHDGELPHPELERF------
Bac_Pro_Gam_1_[  QIKAAFDPHALLNPGKAVPTLHRCAELGNMH-VHHGNLPHPELERF------
Bac_Pro_Gam_26   RVKAAFDPDNLLNPGKGIPTPKHCQEHTVM----KHSLSQRGSTNG------
Bac_Pro_Gam_19   GVKRAFDSKGLLNPGKVIPTLNRCAEYGKML-VRAGQIKHPDLPRF------
Bac_Pro_Bet_2_[  AVKRAFDPPGLLNPDKGIPTRARCAEYGKMH-VRGGLLPHPELPRF------
Bac_Pro_Bet_3_[  AVKRAFDPPGLLNPGKDIPTRARCAEYGKMR-GHQGLLPHPELPRR------
Bac_Pro_Gam_22   ALKNAFDPLATLNPGKGIPLLKNCQEYRALRQIHSG-------EQL------
Bac_Pro_Gam_12   ALKAAFDPEGLLNPGKAIPTLQRCAEYGAMH-VKGGVLPFADIERF------
Bac_Pro_Gam_27   ALKAAFDPNGLLNPGKGVPTLRQCQEYRALQ-------PSKQAAEA------
Bac_Pro_Gam_28   AVKSAFDPQGTLNPGKGVPTLRNCQEYRAI----NAKPQAPEVQHA------
Bac_Pro_Bet_7_[  RVKAAFDPAGLMNPGKAVPTLHRCAEMGRMH-VHHGELPHPDLPRF------
Bac_Pro_Gam_16   RIKHAFDPEGRLNPGKAVPSLHRCAELGAMH-VHHGQLPFPELERF------
Bac_Pro_Gam_17   RIKYAFDPEGRLNPGKAVPSLHRCAELGAMH-VHHGQLPFPELERF------
Bac_Pro_Gam_11   ALRSAFDPRGLLNPGKAVPTLARCAEFGRQH-VRSAQPPHPDLPRF------
Bac_Pro_Gam_18   ALKHAFDPEGLLNPGKAVPTLHRCAEFGRMK-VHGGQLPHPELPRF------
Bac_Pro_Bet_8_[  AIKAAFDPQSLLNPGKAIPELHRCAEFGAMH-IHRGAEKFPEIPRF------
Bac_Pro_Bet_9_[  AVKAAFDPAGLLNPGKAVPTLHRCAELGAMH-VHRGEEKFAELPRF------
Bac_Pro_Gam_14   AVKRAFDEKGLLNPGKAVPTLHRCAELGAMH-VHQGEVAHPELDRF------
Bac_Pro_Gam_15   ALKRAFDEKGLLNPGKAIPSLHRCAEWGAMH-VHQGNVRFPEIERF------
Bac_Pro_Gam_21   ALKAAFDPKRLLNPGKNIPTLARCAEFGAMH-VHNNELPHPELPRF------
Bac_Pro_Bet_12   AVKAAFDEHALLNPGKNIPTLRRCAENGAMR-VHQGKMPFPELERF------
Bac_Pro_Gam_20   AVKAAFDPKTLLNPGKNIPTLHRCAEFGKMH-IHHGELPFPELERF------
Bac_Pro_Bet_1_[  AVKAAFDPAGLLNPGKNVPTLHRCAEFGAMH-VHHGALPHPELERF------
Bac_Pro_Gam_23   AVKAAFDPDGLLNPGKNIPTLHRCAEFGAMH-VHHGHLPFPELERF------
Bac_Pro_Gam_24   AVKAAFDPDGLLNPGKNIPTLHRCAEFGAMH-VHHGHLPFPELERF------
Bac_Pro_Gam_7_[  AVKAAFDPAGLLNPGKNVPTLHRCAEFGAMH-VRHGRLPFPELERF------
Bac_Pro_Bet_10   AVKAAFDPDRLLNPGKNIPSLHRCAEFGAMH-VHHGKLPFPELDRF------
Bac_Pro_Gam_6_[  AVKAAFDPAGLLNPGKNIPTLHRCAEFGAMH-VHGGQLPFPELERF------
Bac_Pro_Bet_6_[  EVKAAFDPDTLLNPGKAVPELHRCAEWGAMH-VHAGRLPHPELPRF------
Bac_Pro_Gam_5_[  ALKQAFDPNKLLNPGKAIPTLARCVEFGAMH-VHGGQLPFSGIERF------
Bac_Pro_Gam_2_[  AVKRAFDPDGLLNPGKAIPQPRHCSEYKSL---GSDTLTAPSRRGG------
Bac_Pro_Gam_29   AVKKAFDPQGLLNPGKAIPQPRHCSEYKAL---GSDTLTAPSARDQGARKGV
Bac_Pro_Gam_13   AVKAAFDAKTLLNPDKAVPTLHRCAEFGAMH-VHHGQLPHPELERL------
Bac_Pro_Gam_4_[  AVKAAFDPQGLLNPEKAVPTLHRCAEFGAMH-VHHGQLSHPELERF------
Bac_Pro_Bet_11   AVKAAFDPSGLLNPGKAVPTLQRCAEFGAMH-VHHGKLSHPELERF------
Bac_Pro_Gam_10   AVKAAFDPRGLLNPGKAVPTLHRCAEFGAMH-VHHGQLPHPDIPRF------
                 ##############################                      






Parameters used
Minimum Number Of Sequences For A Conserved Position: 20
Minimum Number Of Sequences For A Flanking Position: 32
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 5
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 4 selected block(s)
Flanks: [237  322]  [327  339]  [343  425]  [427  510]  

New number of positions in input.fasta-gb:  266  (50% of the original 532 positions)



Protein Domains

PROTOCOLE:

EBI-EMBL, InterproScan5 - paramètres par défaut.


ANALYSE DES RÉSULTATS:


Voici nos résultats sous forme de tableau :


____________________________________________________________________________

           |                |                |               |             |                              

Domaines   | N° d'Accession |  Dénomination  |  Coordonnées  |  E-values   |                                          

Protéiques |   ( IPR )      |                |               |             |                          

___________|________________|________________|_______________|_____________|

           |                |                |               |             |

   a       | non renseignée | non renseignée |  1 - 281      |   2.7e-133  |    

           |                |                |               |             |    

___________|________________|________________|_______________|_____________|

           |                | FAD-linked     |               |             |

   b       | IPR016164      | oxidase-like   |  1 - 260      |  2.78e-65   |    

           |                | C-terminal     |               |             |    

___________|________________|________________|_______________|_____________|

           |                | FAD-linked     |               |             |

   c       | IPR004113      |   oxidase,     |  19- 257      |  3.3e-60    |    

           |                |  C-terminal    |               |             |    

___________|________________|________________|_______________|_____________|

           |                |Vanillyl-alcohol|               |             |

   d       | IPR016171      |   oxidase,     |  219 - 258    |  4.1e-11    |    

           |                |  C-terminal    |               |             |    

___________|________________|subdomain_2_____|_______________|_____________|

           |                |                |               |             |

   e       | non renseignée | non renseignée |  1 - 281      |   2.7e-133  |    

           |                |                |               |             |    

___________|________________|________________|_______________|_____________|

_____________________________________________________________

           |                |                |               |                            

Domaines   |       Banque   |Intutilé banque |  Intitulé     |                                          

Protéiques | d'origine      |    d'origine   |   Interpro    |                                        

___________|________________|________________|_______________|

           |                |                |               |            

   a       |     Panther    | PTHR11748:SF9  |  non renseigné|        

           |                |                |               |            

___________|________________|________________|_______________|

           |                |                | FAD-linked    |            

   b       |   Superfamily  |   SSF55103     |  oxidase-like |        

           |                |                | C-terminal    |                  

___________|________________|________________|_______________|

           |                |PF02913   FAD   | FAD-linked    |      

   c       |      Pfam      |linkes oxidases,| oxidase,      |    

           |                | C-ter domain   | C-terminal    |                

___________|________________|________________|_______________|

           |                |                |Vanillyl-alcohol|            

   d       |    Gene3D      |G3DSA:1.10.45.10|oxidase,       |    

           |                |                |   C-terminal  |                

___________|________________|________________|subdomain_2____|

           |                |                |               |

   e       |      Panther   |   PTHR11748    |non renseigné  |    

           |                |                |               |    

___________|________________|________________|_______________|




On remarque que les cinq domaines protéiques sont redondants, en effet ils se chevauchent tous : trois d'entre eux commencent au premier acide aminé de notre séquence protéique ( a), b) et e) ) et se terminent entre le 260ème et le 281ème acide aminé; le domaine c) garde le même profil de taille en commençant au 19ème acide aminé et finissant au 257ème; seul le domaine  d) est plus petit et situé vers l'extrémité 3' de l'ORF traduit, il commence au 219ème et se termine au 258ème, et est tout de même chevauché par les quatre autres domaines.

Puisqu'ils sont tous redondants, on ne pourra choisir qu'un seul domaine protéique.


Bien que les domaines a) et e) présentent des e-values très significatives, nous constatons qu'il ne sont pas informatifs car ils ne sont pas annotés. En effet ils ne sont pas associés à des fonctions, ils ne peuvent donc rien apporter à notre analyse.


Aussi, nous allons nous concentrer sur les trois domaines protéiques restants.

- Deux d'entre eux présentent la même fonction : une oxydase liée à FAD, C-terminal ( domaines b) et c) ) , le troisième est une alcool vanillylique/oxydase, C-terminal ( domaine d) )

- Les deux premiers domaines sont associés à des e-values du même ordre : 2.78e-65 pour b) et 3.3e-60  pour c)  alors que le domaine d) présente une e-value de 4.1e-11.


Les trois e-values trouvées représentent toutes des valeurs significatives, cependant on distingue un grand écart entre la e-value correspondant au domaine d) et celles associées aux domaines b) et c), de l'ordre de 1e-50. Les domaines b) et c) présentent de meilleures e values, beaucoup plus faibles.

De plus, le domaine d) est beaucoup plus court que les deux autres domaines : 40aa  contre 239aa et 260aa. Aussi les séquences b) et c) recouvrent mieux notre séquence protéique et semblent plus représentatifs.


Ainsi, notre séquence protéique semble présenter la fonction d'une oxydase liée à FAD, puisque deux domaines générés par Interpro présentent cette fonction.


La fonction oxydase liée à FAD est associée à une flavoprotéine, liée de manière covalente à une Flavine adénine dinucléotide (FAD). La flavine joue le rôle de coenzyme dans les réactions l'oxydoréduction de la protéine. La protéine portant le domaine oxydase liée à FAD est une déshydrogénase, oxydant un substrat par transfert d'électrons sur son coenzyme.


Le domaine C-ter est retrouvé dans la structure d'autres protéines (la famille des alcools vanillyliques, les déhydrogénases  D-lactate..). Par conséquent, nous avons une corrélation avec le domaine d) qui lui est associé à une fonction oxydase de l'alcool vanillylique.

Le domaine protéique d) est donc le deuxième domaine de l'oxydase de l'alcool vanillylique (le premier étant oxydase liée à FAD Cter).


Enfin en ce qui concerne le choix du domaine protéique de référence à notre protéine, nous choisissons le b). Etant donné que les e-values sont du même ordre, on privilégie la longueur du domaine protéique (239aa pour le c) contre 260aa pour le b)). Ainsi, le domaine que nous sélectionnons pour notre séquence protéique présente la fonction oxydase liée à FAD qui s'étend du premier acide aminé au 260ème. Aussi, nous supposons que notre séquence protéique porte ce domaine mais nous ne pouvons pas identifier la protéine de laquelle elle provient, étant donné que ce domaine est retrouvé chez différents types de protéines, présentant différents types de fonctions.


Finalement, le blastp de notre séquence protéique nous a permis d'associer ce domaine à une protéine. Cette protéine est une Glycolate oxydase liée à FAD. L'alignement multiple nous a prouvé que le domaine protéique que nous avons choisi est retrouvé et bien conservé chez les homoloques de notre séquence protéique. Ainsi les résultats du blastp et de l'alignement sont cohérents avec ceux d'Interpro étant donné que cette protéine et ses homologues présentent une fonction oxydase liée à FAD.



RÉSULTATS BRUTS:

Résultats au format TSV, car le format TXT n'est pas proposé :


a) EMBOSS_001	9b84c2b641b449b24ae2014219be9afd	286	PANTHER	PTHR11748:SF9		1	281	2.7E-133	T	25-10-2014


b) EMBOSS_001	9b84c2b641b449b24ae2014219be9afd	286	SUPERFAMILY	SSF55103		1	260	C	25-10-2014	IPR016164	FAD-linked oxidase-like, C-terminal	GO:0003824|GO:0050660	


c) EMBOSS_001	9b84c2b641b449b24ae2014219be9afd	286	Pfam	PF02913	FAD linked oxidases, C-terminal domain	19	257	3.3E-60	T	25-10-2014	IPR004113	FAD-linked oxidase, C-terminal	GO:0003824|GO:0050660

	
d) EMBOSS_001	9b84c2b641b449b24ae2014219be9afd	286	Gene3D	G3DSA:1.10.45.10		219	258	4.1E-11	T	25-10-2014	IPR016171	Vanillyl-alcohol oxidase, C-terminal subdomain 2	

	
e) EMBOSS_001	9b84c2b641b449b24ae2014219be9afd	286	PANTHER	PTHR11748		1	281	2.7E-133	T	25-10-2014


Phylogeny

PROTOCOLE:


a) méthode de distance Phylogeny.fr / méthode Neighbor / pas de Bootstrap / groupe extérieur: Protobactérie autres que Gammaprotéobactérie  (pas de bootstrap) 


b) méthode de maximum de vraisemblance Phylogeny.fr / méthode PhyML / substitution model :default  / groupe extérieur: Protéobactérie autres que gammaprotéobactérie  


ANALYSE DES RÉSULTATS:



Dans le cas des deux méthodes, notre groupe d'étude (les gammaprotéobactéries) n'est pas clairement séparé de notre groupe externe (les betaprotéobactéries). 

En effet, que ce soit avec la méthode phyML ou celle de Neignbor, notre groupe d'étude n'est pas représenté seul au sein d'un unique clade. En revanche on remarque un clade qui est formé uniquement de gammaprotéobactéries (c.1), la séquence protéique correspondant à  notre ORF y est représentée. Le deuxième grand clade que nous observons est celui où les gammaprotéobactéries et les bétaprotéobactéries sont mélangées (c.2)


Ainsi nous avons décidé d'enraciner les arbres sur le clade isolé c.2) puisque nous ne pouvons pas isoler toutes les gammaprotéobactéries au sein d'un clade où elles seraient la seule classe représentée. Par conséquent l'arbre n'a pu  être enraciné sur un clade constitué uniquement de séquences du groupe externe.


Nos deux arbres ne respectent pas la phylogénie de référence : on ne retrouve pas l'événement de spéciation qui fit diverger les gammaprotéobactéries des bétaprotéobactéries. En effet le clade c.2) est constitué de séquences des deux classes et on n'aperçoit aucun clade de plus de 2 séquences de betaprotéobactéries qui permet de les isoler des gammaprotéobactéries.



Les séquences du clade c.1) sont paralogues avec celles du clade c.2) : les séquences sont issues d'une duplication suivie d'une différentiation des 2 copies. De plus le nœud séparant les clades c.1) et c.2) possède une très bonne valeur de booststrap, 0.916, ce qui renforce notre hypothèse de duplication puis de différentiation.

Les séquences du clade c.2) ont ensuite subi une spéciation, pour donner les beta et les gammaprotéobactéries. Cependant, cet événement n'est pas représenté sur l'arbre : on ne distingue pas clairement les séquences issues des gamma et des betaprotéobactéries, elles sont au contraire très mélangées.

On peut expliquer cette hétérogénéité du clade c.2) par le choix des séquences ou par des événements de transferts horizontaux des différentes séquences entre les gammaprotéobactéries et les bétaprotéobactéries, ces phénomènes sont très courants chez ces bactéries. Ainsi nous pouvons postuler que les séquences des gammaprotéobactéries sont xénologues avec les séquences des betaprotéobactéries (les séquences concernées sont seulement celles retrouvées au sein du clade c.2) ).

Les valeurs de bootstrap sont significatives pour chacun des noeuds qui illustrent nos propos, de ce fait ces nœuds sont robustes et renforcent notre hypothèse.



Nous avons vu à travers les commentaires précédents que les arbres issus deux deux méthodes étaient très congruents puisqu'ils conservent les mêmes clades digne d'intérêt ( c.1)et.2) ) ainsi que leur phylogénie. Cependant on remarque quelque différences entre les deux méthodes au sein clade c.2): certaines séquences ne sont pas dans le même sous-clade. Par exemple on observe avec la méthode phyML que les gammaprotéobactéries n°2, 4 et 29 sont à part du clade c.2) tandis qu'avec la méthode neighbor ces trois bactéries forment un clade et il est inclut dans  c.2). Le clade c.2) étant défini comme celui où les gammas et les bétaprotéobactéries se mélangent. Ces différences sont issues des différences de critères entre les deux méthodes, PhyML prenant en compte la distance et le caractère et Neighbor se basant uniquement sur la distance. Dans ce cas nous préfèrerons la méthode de maximum de vraisemblance phyML.




Le clade c.1), représenté sur les deux arbres, nous permet de formuler une assignation taxonomique de notre protéine : nous pensons que cette séquence appartient au groupe taxonomique des gammaprotéobactéries. Nous renforçons ce choix par l'observation du nœud robuste qui unit notre protéine à la gammaprotéobactérie n°1.

Les homologues les plus proches de notre protéine sont au nombre de 2, et identiques pour chacun des arbres. Ce sont les séquences appartenant au clade c.1), nommées "28_Bac_Pro_Gam_1", "30_Bac_Pro_Gam_3".


Au regard de nos deux arbres, nous pouvons renseigner l'homologue le plus proche de la séquence traduite de l'ORF. Cette séquence est annotée "28_Bac_Pro_Gam_1", elle appartient à une gammaprotéobactérie, malheureusement nous ne savons pas de quel organisme et de quel sous-ordre elle est issue. En revanche, le deuxième homologue le plus proche est la séquence  "26_Bac_Pro_Gam_2", elle appartient au sous ordre des Thiotrichales,  à la famille des Piscirickettsiaceae, au genre des Thiomicrospira; . Elle est issue de l'organisme Thiomicrospira chilensis.


Nous ne pouvons même pas supposer que notre séquence appartienne au même sous-ordre que le deuxième homologue le plus proche, car les autres séquences du même sous-ordre ne sont même pas représentées dans le clade isolé des gammaprotéobactéries c.1 ) ( "27_Bac_Pro_Gam26",  "26_Bac_Pro_Gam_27", "25_Bac_Pro_Gam_22" et "24_Bac_Pro_Gam_28"). Par conséquent l'assignation taxonomique de notre protéine est réduite à l'ordre des gammaprotéobactéries.






RÉSULTATS BRUTS:


Les noeuds annotés d'un dièse # présentent une valeur de Boostrap supérieure à 0,7 (donc noeud robuste). 
Dans le cas de l'arbre issu de Neighbor, le logiciel ne permet pas l'affichage des valeurs de Bootstrap.

A la droite des arbres des noms de clade ont été annotés sur le modèle "cl." .


a) méthode de distance Phylogeny.fr / méthode Neighbor / pas de Bootstrap / groupe extérieur: Protobactérie autres que Gammaprotéobactérie  (pas de bootstrap) 

                                                                                                      -----0.1----
                                                                                                               _
              +-------------38_Bac_Pro_Gam_27  [Bacteria_Proteobacteria_Gammaproteobacteria]                  |
              |                                                                                               |
       +------++------------------37_Bac_Pro_Gam_28  [Bacteria_Proteobacteria_Gammaproteobacteria]            |
       |      ++                                                                                              |
   +---+       +------------------------36_Bac_Pro_Gam_22  [Bacteria_Proteobacteria_Gammaproteobacteria]      |
   |   |                                                                                                      |
   |   +------------------------35_Bac_Pro_Gam_26  [Bacteria_Proteobacteria_Gammaproteobacteria]              |      c.1)
 +-+                                                                                                          |
 | |                  +------------34_Bac_Pro_Gam_1  [Bacteria_Proteobacteria_Gammaproteobacteria]            |
 | |       +----------+                                                                                       |
 | |       |          +-------------33_ORFprot_b                                                              |
 | +-------+                                                                                                  |
 |         +------------------------32_Bac_Pro_Gam_3  [Bacteria_Proteobacteria_Gammaproteobacteria]           |_
 |
 |                                                                                                             _
 |    +--------------31_Bac_Pro_Gam_4  [Bacteria_Proteobacteria_Gammaproteobacteria]                          |
 |   ++                                                                                                       |
 |   ||             +-------30_Bac_Pro_Gam_29  [Bacteria_Proteobacteria_Gammaproteobacteria]                  |
 |   |+-------------+                                                                                         |
 |   |              +---------29_Bac_Pro_Gam_2  [Bacteria_Proteobacteria_Gammaproteobacteria]                 |
 |   |                                                                                                        |
 |  ++  +--------------28_Bac_Pro_Gam_10  [Bacteria_Proteobacteria_Gammaproteobacteria]                       |
 |  ||+-+                                                                                                     |
 |  ||| |+-----------27_Bac_Pro_Bet_11  [Bacteria_Proteobacteria_Betaproteobacteria]                          |
 |  ||| ++                                                                                                    |
 |  |++  +------------------26_Bac_Pro_Bet_6  [Bacteria_Proteobacteria_Betaproteobacteria]                    |
 |  | |                                                                                                       |
 |  | | +-------------------25_Bac_Pro_Gam_11  [Bacteria_Proteobacteria_Gammaproteobacteria]                  |
 |  | | |                                                                                                     |
 |  | +-+                     +------24_Bac_Pro_Gam_17  [Bacteria_Proteobacteria_Gammaproteobacteria]         | 
 |  |   +---------------------+                                                                               |
 |  |                         +----23_Bac_Pro_Gam_16  [Bacteria_Proteobacteria_Gammaproteobacteria]           |
 | ++                                                                                                         |
 | ||  +-----------------22_Bac_Pro_Gam_5  [Bacteria_Proteobacteria_Gammaproteobacteria]                      | 
 | ||  |                                                                                                      |
 | ||+-+     +------------------------21_Bac_Pro_Gam_15  [Bacteria_Proteobacteria_Gammaproteobacteria]        |
 | ||| +-----+                                                                                                |
 | |||       +--------------20_Bac_Pro_Gam_14  [Bacteria_Proteobacteria_Gammaproteobacteria]                  |
 | |||                                                                                                        |        c.2)
 | |||                                                                                                        |
 | |||        +---------19_Bac_Pro_Gam_6  [Bacteria_Proteobacteria_Gammaproteobacteria]                       |
 | |||        |                                                                                               |
 | |||        |+----------18_Bac_Pro_Gam_7  [Bacteria_Proteobacteria_Gammaproteobacteria]                     |
 | |||       ++|                                                                                              |
 | |++       ||| +--------17_Bac_Pro_Bet_10  [Bacteria_Proteobacteria_Betaproteobacteria]                     |  
 | | |       |||-+                                                                                            |
 | | |       ||| |        +--16_Bac_Pro_Gam_24  [Bacteria_Proteobacteria_Gammaproteobacteria]                 |
 | | |       |++ +--------+                                                                                   |
 | | |+------+ |          +-15_Bac_Pro_Gam_23  [Bacteria_Proteobacteria_Gammaproteobacteria]                  |
 +-+ ||      | |                                                                                              |
   | ||      | +----------14_Bac_Pro_Bet_1 [Bacteria_Proteobacteria_Betaproteobacteria]                       |
   | ||      |                                                                                                |
   | ||      |+------------13_Bac_Pro_Bet_12  [Bacteria_Proteobacteria_Betaproteobacteria]                    |
   | ++      ||                                                                                               |
   |  |      ++ +---------12_Bac_Pro_Gam_20  [Bacteria_Proteobacteria_Gammaproteobacteria]                    |   
   |  |       +-+                                                                                             |
   |  |         +-------------11_Bac_Pro_Gam_21  [Bacteria_Proteobacteria_Gammaproteobacteria]                |
   |  |                                                                                                       |
   |  +-------------------------10_Bac_Pro_Gam_12  [Bacteria_Proteobacteria_Gammaproteobacteria]              |
   |                                                                                                          |
   |+----------------------9_Bac_Pro_Gam_13  [Bacteria_Proteobacteria_Gammaproteobacteria]                    |
   ||                                                                                                         |
   ||      +-----------------8_Bac_Pro_Gam_18  [Bacteria_Proteobacteria_Gammaproteobacteria]                  | 
   ||      |                                                                                                  |
   ||      |                                                                                                  |
   ++   +--+ +-------------------7_Bac_Pro_Bet_7  [Bacteria_Proteobacteria_Betaproteobacteria]                |
    |   |  | |                                                                                                |
    |   |  | |                +--------------6_Bac_Pro_Bet_3  [Bacteria_Proteobacteria_Betaproteobacteria]    |
    |   |  +-+        +-------+                                                                               |
    |   |    |   +----+       +--------5_Bac_Pro_Bet_2  [Bacteria_Proteobacteria_Betaproteobacteria]          |
    |   |    |   |    |                                                                                       |
    +---+    +---+    +------------------4_Bac_Pro_Gam_19  [Bacteria_Proteobacteria_Gammaproteobacteria]      |
        |        |                                                                                            |
        |        +-------------------------------------3_Bac_Pro_Bet_13  [Bacteria_Proteobacteria_Betaproteo] |
        |                                                                                                     |
        |      +------------2_Bac_Pro_Bet_9  [Bacteria_Proteobacteria_Betaproteobacteria]                     |
        +------+                                                                                              |
               +--------------1_Bac_Pro_Bet_8  [Bacteria_Proteobacteria_Betaproteobacteria]                   |_



b) méthode de maximum de vraisemblance Phylogeny.fr / méthode PhyML / substitution model :default  / groupe extérieur: Protéobactérie autres que gammaprotéobactérie  

                                                                                                 --------0.5-------
                                                                                                              _
           +-------------30_Bac_Pro_Gam_3 [Bacteria_Proteobacteria_Gammaproteobacteria]                      |
           |                                                                                                 |
    +------+#    +------29_ORFprot_b                                                                         |
    |      +-----+#                                                                                          |
    |            +-----28_Bac_Pro_Gam_1 [Bacteria_Proteobacteria_Gammaproteobacteria]                        |
 +--+#                                                                                                       |          c.1)
 |  |   +-----------27_Bac_Pro_Gam_26 [Bacteria_Proteobacteria_Gammaproteobacteria]                          |
 |  |   |                                                                                                    |
 |  +---+#     +--26_Bac_Pro_Gam_27 [Bacteria_Proteobacteria_Gammaproteobacteria]                            |
 |      |     |                                                                                              |
 |      +-----+#   +--------------25_Bac_Pro_Gam_22 [Bacteria_Proteobacteria_Gammaproteobacteria]            |
 |            +----+#                                                                                        |
 |                 +--------24_Bac_Pro_Gam_28 [Bacteria_Proteobacteria_Gammaproteobacteria]                  |_
 |                                                                                                           
 |                                                                                                            _
 |         +-----32_Bac_Pro_Gam_2 [Bacteria_Proteobacteria_Gammaproteobacteria]                              |
 | +-------+#                                                                                                |
 | |       +--31_Bac_Pro_Gam_29  [Bacteria_Proteobacteria_Gammaproteobacteria]                               |
 | |                                                                                                         |
 | |                        +38_Bac_Pro_Gam_16 [Bacteria_Proteobacteria_Gammaproteobacteria]                 |
 | |         +--------------+#                                                                               |
 | |      +--+#             +---37_Bac_Pro_Gam_17 [Bacteria_Proteobacteria_Gammaproteobacteria]              |
 | |      |  |                                                                                               |
 | |    +-+# +--------36_Bac_Pro_Gam_11 [Bacteria_Proteobacteria_Gammaproteobacteria]                        |
 | |    | |                                                                                                  |
 | |    | +-----35_Bac_Pro_Gam_10 [Bacteria_Proteobacteria_Gammaproteobacteria]                              |
 | |   ++                                                                                                    |
 | |   || +---------34_Bac_Pro_Bet_6 [Bacteria_Proteobacteria_Betaproteobacteria]                            |
 | |   |+-+#                                                                                                 |
 | |   |  +-----33_Bac_Pro_Bet_11 [Bacteria_Proteobacteria_Betaproteobacteria]                               | 
 | |   |                                                                                                     |
 | |   |       +-----22_Bac_Pro_Gam_14 [Bacteria_Proteobacteria_Gammaproteobacteria]                         |
 | |   | +-----+#                                                                                            |
 | |   | |     +--------------21_Bac_Pro_Gam_15 [Bacteria_Proteobacteria_Gammaproteobacteria]                |           c.2)
 | |   |-+#                                                                                                  |  
 | |   | +-------20_Bac_Pro_Gam_5 [Bacteria_Proteobacteria_Gammaproteobacteria]                              |
 +-+#+-+                                                                                                     |
   | | |      +-----19_Bac_Pro_Gam_7 [Bacteria_Proteobacteria_Gammaproteobacteria]                           |
   | | |      |                                                                                              |   
   | | |      |                                                                                              |
   | | |      |+----18_Bac_Pro_Gam_6 [Bacteria_Proteobacteria_Gammaproteobacteria]                           |  
   | | |      ||                                                                                             | 
   | | |      ||  +------17_Bac_Pro_Gam_21 [Bacteria_Proteobacteria_Gammaproteobacteria]                     |
   | | |      |+--+                                                                                          |
   | | |      ||  +----16_Bac_Pro_Gam_20 [Bacteria_Proteobacteria_Gammaproteobacteria]                       |
   | | |      ||                                                                                             |
   | | |     ++#     +15_Bac_Pro_Gam_23 [Bacteria_Proteobacteria_Gammaproteobacteria]                        |
   | | |     |||+----+#                                                                                      |
   | | |     ||++    +14_Bac_Pro_Gam_24 [Bacteria_Proteobacteria_Gammaproteobacteria]                        |
   | | |     || |                                                                                            | 
   | | |+---#+| +---13_Bac_Pro_Bet_10 [Bacteria_Proteobacteria_Betaproteobacteria]                           |
   | | ||    ||                                                                                              |
   | | ||    |+-----12_Bac_Pro_Bet_1 [Bacteria_Proteobacteria_Betaproteobacteria]                            |
   | | ||    |                                                                                               |
   | | ||    +------11_Bac_Pro_Bet_12 [Bacteria_Proteobacteria_Betaproteobacteria]                           |  
   | | ||                                                                                                    |
   +-+ || +--------------10_Bac_Pro_Gam_12 [Bacteria_Proteobacteria_Gammaproteobacteria]                     |
     | ++ |                                                                                                  |
     |  | |              +--------9_Bac_Pro_Gam_19 [Bacteria_Proteobacteria_Gammaproteobacteria]             | 
     |  | |              |                                                                                   |
     |  | |         +----+#  +-------------------------8_Bac_Pro_Bet_13 [Bacteria_Proteobacteria_Betaproteo] | 
     |  | |         |    |   |                                                                               |
     |  | |         |    +---+#+---7_Bac_Pro_Bet_2 [Bacteria_Proteobacteria_Betaproteobacteria]              |
     |  | |        ++#       +-+#                                                                            |
     |  +-+        ||          |                                                                             |
     |    |        ||          +-------6_Bac_Pro_Bet3 [Bacteria_Proteobacteria_Betaproteobacteria]           |
     |    |    +---+#                                                                                        |
     |    |    |   |+--------5_Bac_Pro_Bet_7 [Bacteria_Proteobacteria_Betaproteobacteria]                    | 
     |    |    |   |                                                                                         |
     |    | +--+#  +--------4_Bac_Pro_Gam_18 [Bacteria_Proteobacteria_Gammaproteobacteria]                   | 
     |    | |  |                                                                                             |
     |    | |  |   +-------3_Bac_Pro_Bet_8 [Bacteria_Proteobacteria_Betaproteobacteria]                      |
     |    +-+# +---+#                                                                                        |
     |      |      +-----2_Bac_Pro_Bet_9 [Bacteria_Proteobacteria_Betaproteobacteria]                        |  
     |      |                                                                                                |
     |      +---------1_Bac_Pro_Gam_13 [Bacteria_Proteobacteria_Gammaproteobacteria]                         |  
     |                                                                                                       |
     +------23_Bac_Pro_Gam_4 [Bacteria_Proteobacteria_Gammaproteobacteria]                                   |_

Taxonomy report

PROTOCOLE:


BLASTp contre NR, paramètres par défaut au NCBI sauf "Number of descriptions_5000", puis outil local "tax_report2", paramètre: Exclure séquences uncultured


ANALYSE DES RÉSULTATS:


Voici les résultats du rapport taxonomique obtenus à partir de Blastp :



      

| phylum                | classe            | Ordre            |  sous ordre      |    gamme de e-value |nb résultats |

|_______________________|___________________|__________________|__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

| [Bactérie]            | [protéobactérie]  |       [Gamma]    | non renseigné    |  1e-168 - 6e-36     |      10     |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |   Thiotrichales  |   5e-141 - 1e-122   |      14     |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |  Pseudomonadales |   1e-130 - 1e-31    |   216       |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |  Chromatiales    |   4e-130 - 1e-34    |   76        |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  | Salinisphaerales |   4e-129 - 3e-121   |   2         |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Methylococcales   |   1e-128 - 1e-35    |   15        |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Acidithiobacillales|   2e-128 - 6e-35   |   9         |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Xanthomonadales   |   8e-128 - 1e-31    |   18        |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Oceanospirillales |   6e-127 - 2e-97    |      34     |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Enterobacteriales |   3e-126 - 6e-44    |     183     |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Vibrionales       |   2e-121 - 8e-104   |     4       |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |Alteromonadales   |   2e-115 - 5e-99    |     19      |

|                       |                   |                  |__________________|_____________________|_____________|

|                       |                   |                  |                  |                     |             |

|                       |                   |                  |  Aeromonadales   |   1e-111 - 1e-92    |     2       |

|                       |                   |__________________|__________________|_____________________|_____________|

|                       |                   |                                     |                     |             |

|                       |                   |           [beta]                    |   5e-130 - 1e-31    |     366     |

|                       |                   |_____________________________________|_____________________|_____________|

|                       |                   |                                     |                     |             |

|                       |                   |        [zeta]                       |        1e-125       |     1       |

|                       |                   |_____________________________________|_____________________|_____________|

|                       |                   |                                     |                     |             |

|                       |                   |        [alpha]                      |  2e-121 - 1e-31     |     505     |

|                       |                   |_____________________________________|_____________________|_____________|

|                       |                   |                                     |                     |             |

|                       |                   |        [delta]                      |  5e-75 - 2e-31      |      143    |

|                       |                   |_____________________________________|_____________________|_____________|

|                       |                   |                                     |                     |             |

|                       |                   |        [epsilon]                    | 9e-48 - 1e-31       |    300      |

|                       |___________________|_____________________________________|_____________________|_____________|

|                       |                   |                                     |                     |             |

|                       |[autres classes]   |                                     |     5e-122 - 1e-31  |   1365      |                    

|_______________________|___________________|_____________________________________|_____________________|_____________|

|                       |                                                         |                     |             |

| [Eucaryote]           |                                                         |     9e-94 - 1e-31   |    94       |                    

|_______________________|_________________________________________________________|_____________________|_____________|

|                       |                                                         |                     |             |

| [Archébactérie]       |                                                         |     5e-66 - 5e-31   |   45        |                    

|_______________________|_________________________________________________________|_____________________|_____________|



Les premières séquences issues du rapport taxonomique sont issues des gammaprotéobactéries, en revanche leur sous-ordre n'est pas renseigné. Elles présentent cependant les meilleures e values (1e-168 - 6e-36), nous avons donc décidé de la représenter tout de même. Nous l’inclurons dans notre groupe d'étude, qui sera les gammaprotéobactéries (voir justification plus bas, section "choix du groupe d'étude").

Nous avons choisi de détailler la classe des protéobactéries, comportant les ordres suivants : gamma-, beta-, alpha-, dela- et epsilon- proteobactéries étant donné que cette classe est la mieux représentée, et présentant les meilleures e values (1e-168 à 1e-31 pour les protéobactéries, alors que les classes suivantes commencent à une e value de 5e-122). De plus, notre groupe d'étude fait partie des protéobactéries, cela permet de le représenter au mieux.

Mais parmi nos résultats, nous avons également les classes suivantes, appartenant au règne des bactéries (regroupées dans "autres classes") : firmicutes, bacteroidetes, actinobacterie, deinococcus, chloroflexi, cyanobactérie, acidobactérie, armatimonadetes, planctomycetes, aquificae, thermodesulfobacterie, nitrospirae, deferribacteres, chlorobi, lentisphaerae, tenericute, thermotogae, spirochaete, synergistete, fusobactérie; synergistetes.


De même, nous n'avons pas représenté dans le tableau toutes les classes d'eucaryotes et d'archébactéries, mais il faut noter que nos résultats comprenaient les classes suivantes :

- eucaryotes : chordés, arthropodes, placozoaires, et ascomycetes

- archébactéries : crenarchaeota, thaumarchaeota, euryarchaeota et Korarchaeota.


Nous avons également choisi de détailler les sous-ordres des gammaprotéobactéries, étant donné que cet ordre est notre groupe d'étude.




- Choix du groupe d'étude


Les résultats présentant les meilleures e values (1e-168 à 1e-31) et meilleurs scores (488 à 144) correspondent à des gammaproteobactéries. Cette ordre est très bien représentée par 12 sous ordres différents.

On observe une rupture au niveau des valeurs maximales de e value entre les gammaprotéobactéries (1e-168) et les autres protéobactéries (betaprotéobactéries 5e-130, zeta 1e-125, alpha 2e-121, delta 1e-77 epsilon 9e-48).On observe la même rupture au niveau des scores maximaux, entre les gammaprotéobactéries (488) et les autres protéobactéries (beta 390, zeta 379, alpha 368, delta 255, epsilon 176).

Nous choisissons donc comme groupe d'étude, le groupe présentant les meilleures valeurs : les gammaprotéobactéries.


On constate que le clade des gammaprotéobactéries présente deux classes d'homologues, une classe présentant un homologue proche de notre séquence protéique (e value élevée de 1e-120 à 1e-130), présentant la fonction glycolate oxydase liée à FAD (sous la dénomination "protéine liée à FAD" ou "glycolate oxidase subunit GlcD"), fonction que nous avons attribuée à notre séquence protéique, après interprétation des résultats d'interpro et de blastp ; et une classe présentant les fonctions dimethylmenaquinone methyltransferase et  D-lactate dehsydrogenase, correspondant à des homologues plus éloignés (e values plus basses, entre 1e-30 et 1e-40).


Il serait donc intéressant de sélectionner ces fonctions homologues, afin de représenter au mieux la diversité phylogénétique du groupe d'étude. Le problème est que, après sélection de ces protéines, notre alignement multiple après curation de G blocks ne présente pas assez d'acides aminés (103 aa seulement), nous ne pouvons donc pas inclure ces fonctions homologues dans notre alignement multiple et donc, dans notre arbre.

L'alignement global est en fait affecté parce que les protéines présentant la fonction glycolate oxydase ont une e value beaucoup plus élevée (1e-120 / 1e-130) alors que celles associées aux fonctions D-lactate déshydrogénase et dimethylmenaquinone methyltransferase présentent des e values plus basses (entre 1e-30 et 1e-40, donc homologues plus éloignés).

Après alignement multiple, nous décidons d'enlever des protéines qui étaient tronquées (3 séquences) afin d'obtenir un meilleur alignement.



- Choix du groupe externe


En ce qui concerne notre groupe externe, il découle du choix de notre groupe d'étude. Si l'on choisit les gammaprotéobactéries en groupe d'étude, notre groupe externe est forcément constitué des betaprotéobactéries. En effet les gammaprotéobactéries partagent leur ancêtre commun le plus proche avec les betaprotéobactéries. La lignée taxonomique des betaprotéobactéries est d'un niveau équivalent à celle des gammaprotéobactéries.




_____________________________

Groupe d'étude: Bactéries, protéobactéries, gammaprotéobactéries


>Bac_Pro_Gam_1 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-168  FAD-binding protein

>Bac_Pro_Gam_2 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-103  FAD-binding protein [endosymbiont of Tevnia jerichonana]

>Bac_Pro_Gam_3 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_5e-141  Bacteria;Proteobacteria;Gammaproteobacteria;Thiotrichales;  glycolate oxidase subunit GlcD

>Bac_Pro_Gam_4 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-128  Bacteria;Proteobacteria;Gammaproteobacteria;Thiotrichales;  FAD-binding protein

>Bac_Pro_Gam_5 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-122  Bacteria;Proteobacteria;Gammaproteobacteria;Thiotrichales;   glycolate oxidase,  subunit D

>Bac_Pro_Gam_6 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-130  Bacteria;Proteobacteria;Gammaproteobacteria;Pseudomonadales; FAD-binding protein

>Bac_Pro_Gam_7 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-119  Bacteria;Proteobacteria;Gammaproteobacteria;Pseudomonadales;  glycolate oxidase subunit glcD

>Bac_Pro_Gam_10 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_4e-130  Bacteria;Proteobacteria;Gammaproteobacteria;Chromatiales;  glycolate oxidase subunit GlcD

>Bac_Pro_Gam_11 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-115  Bacteria;Proteobacteria;Gammaproteobacteria;Chromatialesglycolate oxidase subunit GlcD

>Bac_Pro_Gam_12 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_3e-102  Bacteria;Proteobacteria;Gammaproteobacteria;Chromatiales;  glycolate oxidase subunit GlcD

>Bac_Pro_Gam_13 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_4e-129  Bacteria;Proteobacteria;Gammaproteobacteria;Salinisphaerales; FAD linked oxidase domain-containing protein

>Bac_Pro_Gam_14 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-128  Bacteria;Proteobacteria;Gammaproteobacteria;Methylococcales; glycolate oxidase subunit GlcD

>Bac_Pro_Gam_15 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_6e-114  Bacteria;Proteobacteria;Gammaproteobacteria;Methylococcales; glycolate oxidase subunit GlcD

>Bac_Pro_Gam_16 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-128  Bacteria;Proteobacteria;Gammaproteobacteria;Acidithiobacillales FAD-binding protein

>Bac_Pro_Gam_17 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-110  Bacteria;Proteobacteria;Gammaproteobacteria;Acidithiobacillale| FAD-binding protein

>Bac_Pro_Gam_18 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_8e-128  Bacteria;Proteobacteria;Gammaproteobacteria;Xanthomonadalesglycolate oxidase subunit GlcD

>Bac_Pro_Gam_19 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_3e-100  Bacteria;Proteobacteria;Gammaproteobacteria;Xanthomonadales FAD-binding protein

>Bac_Pro_Gam_20 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_6e-127  Bacteria;Proteobacteria;Gammaproteobacteria;Oceanospirillale ;  FAD-linked oxidoreductase

>Bac_Pro_Gam_21 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-117  Bacteria;Proteobacteria;Gammaproteobacteria;Oceanospirillales; glycolate oxidase subunit GlcD

>Bac_Pro_Gam_22 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-97  Bacteria;Proteobacteria;Gammaproteobacteria;Oceanospirillales; glycolate oxidase subunit D

>Bac_Pro_Gam_23 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_3e-126  Bacteria;Proteobacteria;Gammaproteobacteria;Enterobacteriales; glycolate oxidase subunit glcD

>Bac_Pro_Gam_24 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_7e-123  Bacteria;Proteobacteria;Gammaproteobacteria;Enterobacteriales ;  glycolate oxidase, subunit GlcD

>Bac_Pro_Gam_26 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-121  Bacteria;Proteobacteria;Gammaproteobacteria;Vibrionales; glycolate oxidase subunit GlcD

>Bac_Pro_Gam_27 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-115  Bacteria;Proteobacteria;Gammaproteobacteria;Alteromonadales FAD linked oxidase domain-containing protein

>Bac_Pro_Gam_28 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_9e-107  Bacteria;Proteobacteria;Gammaproteobacteria;Alteromonadales;| FAD-binding protein

>Bac_Pro_Gam_29 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_2e-112  Bacteria;Proteobacteria;Gammaproteobacteria;Sedimenticola;  glycolate oxidase subunit GlcD



___________________________________

Groupe extérieur: Bactéries, protéobactéries, betaprotéobactéries


>Bac_Pro_Bet_1 [Bacteria Proteobacteria Betaproteobacteria]  E-value_5e-130  Bacteria;Proteobacteria;Betaproteobacteria;Burkholderialesglycolate oxidase subunit GlcD

>Bac_Pro_Bet_2 [Bacteria Proteobacteria Betaproteobacteria]  E-value_1e-114  Bacteria;Proteobacteria;Betaproteobacteria;Burkholderiales;Burkholderiaceae; glycolate oxidase subunit GlcD

>Bac_Pro_Bet_3 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-97  Bacteria;Proteobacteria;Betaproteobacteria;Burkholderiales ; FAD-binding protein

>Bac_Pro_Bet_6 [Bacteria Proteobacteria Betaproteobacteria]  E-value_3e-127  Bacteria;Proteobacteria;Betaproteobacteria;Hydrogenophilales ; FAD-binding protein

>Bac_Pro_Bet_7 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-126  Bacteria;Proteobacteria;Betaproteobacteria;Rhodocyclales FAD-binding protein

>Bac_Pro_Bet_8 [Bacteria Proteobacteria Betaproteobacteria]  E-value_5e-126  Bacteria;Proteobacteria;Betaproteobacteria;Nitrosomonadales; FAD-binding protein

>Bac_Pro_Bet_9 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-125  Bacteria;Proteobacteria;Betaproteobacteria;Nitrosomonadales; FAD-binding protein  

>Bac_Pro_Bet_10 [Bacteria Proteobacteria Betaproteobacteria]  E-value_3e-121  Bacteria;Proteobacteria;Betaproteobacteria;Neisseriale ; glycolate oxidase subunit GlcD

>Bac_Pro_Bet_11 [Bacteria Proteobacteria Betaproteobacteria]  E-value_1e-118  Bacteria;Proteobacteria;Betaproteobacteria;Gallionellales; FAD-binding protein

>Bac_Pro_Bet_12 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-116  Bacteria;Proteobacteria;Betaproteobacteria; glycolate oxidase subunit GlcD  

>Bac_Pro_Bet_13 [Bacteria Proteobacteria Betaproteobacteria]  E-value_3e-83  Bacteria;Proteobacteria;Betaproteobacteria;Neisseriales; FAD-binding protein


BLAST rapport taxonomique (5339 hits analysés)


Lineage report

.LUCA
. Bacteria
. .Proteobacteria
. . Gammaproteobacteria
. . .gamma proteobacterium SCGC AAA076-E13........ 488  1e-168 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [gamma proteobacteriu...   
. . .gamma proteobacterium SCGC AAA076-D02........ 477  2e-164 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [gamma proteobacteriu...   
. . .gamma proteobacterium SCGC AAA076-D13........ 474  2e-163 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [gamma proteobacteriu...   
. . .gamma proteobacterium SCGC AAA076-F14........ 473  1e-162 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [gamma proteobacteriu...   
. . .Candidatus Ruthia magnifica.................. 446  3e-152 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [Candidatus Ruthia ma...   
. . .Calyptogena okutanii thioautotrophic gill symbi 437  1e-148 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [Calyptogena okutanii...   
. . .endosymbiont of Riftia pachyptila............ 323  1e-103 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [endosymbiont of Rift...   
. . .endosymbiont of Tevnia jerichonana........... 322  1e-103 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [endosymbiont of Tevn...   
. . .endosymbiont of Riftia pachyptila (vent Ph05) 144  5e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: dimethylmenaquinone methyltransferase [en...   
. . .endosymbiont of Tevnia jerichonana (vent Tica) 144  6e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: dimethylmenaquinone methyltransferase [en...   
. . .Thiomicrospira chilensis..................... 417  5e-141 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glycolate oxidase subunit GlcD [Thiomicro...   
. . .Thiomicrospira sp. Milos-T2.................. 417  1e-140 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glycolate oxidase subunit GlcD [Thiomicro...   
. . .Thiomicrospira kuenenii...................... 414  2e-139 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glycolate oxidase subunit GlcD [Thiomicro...   
. . .Thiomicrospira arctica....................... 403  4e-135 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira arct...   
. . .Hydrogenovibrio marinus...................... 407  4e-137 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glycolate oxidase subunit GlcD [Hydrogeno...   
. . .Cycloclasticus............................... 150  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: MULTISPECIES: oxidoreductase, FAD-binding...   
. . .Cycloclasticus zancles....................... 149  7e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: FAD/FMN-containing dehydrogenase [Cyclocl...   
. . .Cycloclasticus sp. P1........................ 147  4e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: dimethylmenaquinone methyltransferase [Cy...   
. . .Thiothrix nivea.............................. 397  8e-133 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: FAD-binding protein [Thiothrix nivea]          
. . .Thiothrix lacustris.......................... 395  8e-132 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glycolate oxidase subunit GlcD [Thiothrix...   
. . .Thiothrix disciformis........................ 386  2e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: FAD-binding protein [Thiothrix disciformis]    
. . .Beggiatoa alba............................... 382  4e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: FAD-binding protein [Beggiatoa alba]           
. . .Thioploca ingrica............................ 380  4e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: FAD-binding protein [Thioploca ingrica]            
. . .Beggiatoa sp. PS............................. 371  1e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glycolate oxidase,  subunit D [Beggiatoa sp. PS]    
. . .Pseudomonas fragi............................ 392  1e-130 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fragi]        
. . .Pseudomonas monteilii........................ 391  2e-130 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas monteilii]    
. . .Pseudomonas sp. URIL14HWK12:I4............... 391  4e-130 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas chlororaphis..................... 390  6e-130 5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas chlorora...   
. . .Pseudomonas.................................. 389  1e-129 8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas putida........................... 389  2e-129 22 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas chlororaphis subsp. aureofaciens 30 388  4e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas chlorora...   
. . .Pseudomonas chlororaphis O6.................. 388  4e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas chlorora...   
. . .Pseudomonas sp. GM48......................... 388  4e-129 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM48]     
. . .Pseudomonas putida PC9....................... 388  5e-129 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas fluorescens...................... 387  7e-129 9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae......................... 387  7e-129 47 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas fluorescens NCIMB 11764.......... 387  7e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fluoresc...   
. . .Pseudomonas sp. PH1b......................... 387  8e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas putida BIRD-1.................... 387  9e-129 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas putida W619...................... 387  1e-128 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas amygdali......................... 387  1e-128 6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas amygdali]     
. . .Pseudomonas putida S12....................... 387  1e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas syringae pv. tabaci ATCC 11528... 387  1e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas amygdali]     
. . .Pseudomonas savastanoi....................... 387  1e-128 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas savastanoi]   
. . .Pseudomonas syringae pv. glycinea str. B076.. 387  1e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas savastanoi]   
. . .Pseudomonas mandelii......................... 387  2e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. mori str. 301020.... 386  2e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas amygdali]     
. . .Pseudomonas fluorescens Q2-87................ 386  2e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fluoresc...   
. . .Pseudomonas sp. FGI182....................... 386  2e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. FGI182]        
. . .Pseudomonas brassicacearum................... 386  3e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas br...   
. . .Pseudomonas taiwanensis...................... 386  3e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas taiwanen...   
. . .Pseudomonas putida group..................... 385  4e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas sp. H2........................... 385  4e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sp...   
. . .Pseudomonas sp. WCS358....................... 385  4e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sp...   
. . .Pseudomonas putida F1........................ 385  4e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas plecoglossicida.................. 385  4e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas pu...   
. . .Pseudomonas sp. GM80......................... 385  4e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM80]     
. . .Pseudomonas sp. GM17......................... 385  4e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM17]     
. . .Pseudomonas sp. GM33......................... 385  4e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM33]     
. . .Pseudomonas sp. RIT288....................... 385  5e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit D [Pseudomonas sp. R...   
. . .Pseudomonas putida S16....................... 385  5e-128 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas sp. QTF5......................... 385  6e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas putida ND6....................... 385  6e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas putida DOT-T1E................... 385  6e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas putida CSV86..................... 385  6e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas putida NBRC 14164................ 385  6e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. GM49......................... 385  7e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM49]     
. . .Pseudomonas sp. GM18......................... 385  7e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM18]     
. . .Pseudomonas putida UW4....................... 385  8e-128 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. GM84......................... 385  9e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM84]     
. . .Pseudomonas sp. GM55......................... 384  1e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM55]     
. . .Pseudomonas sp. URIL14HWK12:I6............... 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. GM79......................... 384  1e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM79]     
. . .Pseudomonas sp. BAY1662...................... 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sp...   
. . .Pseudomonas syringae pv. lachrymans str. M30131 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas amygdali]     
. . .Pseudomonas sp. URMO17WK12:I8................ 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas corrugata........................ 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. GM25......................... 384  1e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM25]     
. . .Pseudomonas monteilii SB3078................. 384  1e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas monteilii]    
. . .Pseudomonas sp. H1h.......................... 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas rhizosphaerae.................... 384  2e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas rh...   
. . .Pseudomonas vranovensis...................... 384  2e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas putida KT2440.................... 384  2e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas sp. GM50......................... 384  2e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM50]     
. . .Pseudomonas sp. CF161........................ 384  2e-127 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. GM41(2012)................... 384  2e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM41...   
. . .Pseudomonas umsongensis...................... 384  3e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. M47T1........................ 383  3e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. M47T1]    
. . .Pseudomonas sp. GM30......................... 383  3e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM30]     
. . .Pseudomonas stutzeri subgroup................ 383  3e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas sp. Ant30-3...................... 383  3e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas plecoglossicida NB2011........... 383  4e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas resinovorans..................... 383  4e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas lutea............................ 383  4e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas lu...   
. . .Pseudomonas sp. GM102........................ 383  4e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM102]    
. . .Pseudomonas sp. CFII64....................... 383  4e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas putida H8234..................... 383  4e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas putida]       
. . .Pseudomonas nitroreducens.................... 383  4e-127 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. GM78......................... 383  4e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM78]     
. . .Pseudomonas sp. GM21......................... 383  5e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM21]     
. . .Pseudomonas savastanoi pv. savastanoi NCPPB 333 383  5e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas savastanoi]   
. . .Pseudomonas syringae pv. aesculi str. 0893_23 383  5e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas amygdali]     
. . .Pseudomonas mandelii JR-1.................... 382  6e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas ma...   
. . .Pseudomonas sp. G5(2012)..................... 382  6e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase, subunit GlcD [Pseudomo...   
. . .Pseudomonas fuscovaginae..................... 382  7e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fuscovag...   
. . .Pseudomonas sp. Chol1........................ 382  7e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. Chol1]    
. . .Pseudomonas sp. HMP271....................... 382  7e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sp...   
. . .Pseudomonas mendocina........................ 382  7e-127 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas mendocina]    
. . .Pseudomonas putida TRO1...................... 382  8e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas syringae pv. avellanae str. ISPaVe0 382  8e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae]     
. . .Pseudomonas syringae Lz4W.................... 382  8e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. PAMC 25886................... 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. PAMC...   
. . .Pseudomonas sp. GM16......................... 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas stutzeri......................... 382  1e-126 15 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas syringae CC1557.................. 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae CC1557]   
. . .Pseudomonas sp. TS44......................... 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas sp. GM74......................... 382  1e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM74]     
. . .Pseudomonas fluorescens Q8r1-96.............. 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas sp. 45MFCol3.1................... 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. 20_BN........................ 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas s...   
. . .Pseudomonas syringae pv. actinidiae str. M30209 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae]     
. . .Pseudomonas avellanae........................ 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas azotifigens...................... 382  1e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae group genomosp. 3....... 382  1e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae...   
. . .Pseudomonas syringae pv. syringae B728a...... 381  2e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae]     
. . .Pseudomonas syringae pv. syringae SM......... 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glycolate oxidase, subunit GlcD [Pseudomo...   
. . .Pseudomonas mendocina S5.2................... 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas me...   
. . .Pseudomonas fluorescens group................ 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas syringae pv. actinidiae ICMP 19094 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. syringae str. B301D-R 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas avellanae BPIC 631............... 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas av...   
. . .Pseudomonas syringae pv. aceris str. M302273PT 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae]     
. . .Pseudomonas syringae group................... 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas sp. CFII68....................... 381  2e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas stutzeri ATCC 14405 = CCUG 16156. 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas protegens Cab57.................. 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas p...   
. . .Pseudomonas syringae BRIP34876............... 381  3e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. syringae............ 381  3e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas protegens........................ 381  3e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. CF149........................ 381  3e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas fluorescens R124................. 380  3e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fluoresc...   
. . .Pseudomonas mendocina ymp.................... 380  3e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas mendocina]    
. . .Pseudomonas viridiflava...................... 380  3e-126 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. syringae B64........ 380  3e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glycolate oxidase, subunit GlcD [Pseudomo...   
. . .Pseudomonas stutzeri RCH2.................... 380  3e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas mendocina AD6.................... 380  3e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas ps...   
. . .Pseudomonas sp. EGD-AK9...................... 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. EGD-...   
. . .Pseudomonas fluorescens F113................. 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fluoresc...   
. . .Pseudomonas pseudoalcaligenes................ 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas pseudoal...   
. . .Pseudomonas stutzeri A1501................... 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas sp. GM67......................... 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. GM67]     
. . .Pseudomonas taeanensis....................... 380  4e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas stutzeri DSM 4166................ 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas stutzeri ATCC 17588 = LMG 11199.. 380  4e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas mendocina EGD-AQ5................ 380  4e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas sp. GM60......................... 380  5e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas psychrophila..................... 380  5e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas psychrop...   
. . .Pseudomonas sp. P818......................... 380  6e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas brassicacearum subsp. brassicacearu 380  7e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas brassica...   
. . .Pseudomonas sp. M1........................... 380  8e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas fluorescens Pf0-1................ 380  8e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fluoresc...   
. . .Pseudomonas thermotolerans................... 380  8e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas thermoto...   
. . .Pseudomonas sp. AAC.......................... 380  8e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sp...   
. . .Pseudomonas sp. URMO17WK12:I12............... 380  8e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. morsprunorum str. M302 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas amygdali]     
. . .Pseudomonas syringae Cit 7................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae]     
. . .Pseudomonas cichorii JBC1.................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas ci...   
. . .Pseudomonas syringae BRIP39023............... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas moraviensis...................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas moravien...   
. . .Pseudomonas fluorescens HK44................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas fluoresc...   
. . .Pseudomonas sp. MT-1......................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas s...   
. . .Pseudomonas mendocina NK-01.................. 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas mendocina]    
. . .Pseudomonas sp. HYS.......................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. HYS]      
. . .Pseudomonas knackmussii B13.................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glycolate oxidase subunit glcD [Pseudomonas k...   
. . .Pseudomonas sp. MOIL14HWK12:I2............... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. URMO17WK12:I11............... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. maculicola str. ES4326 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae...   
. . .Pseudomonas sp. VLB120....................... 378  4e-125 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. LAMO17WK12:I2................ 378  4e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas stutzeri DSM 10701............... 378  5e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas stutzeri MF28.................... 377  7e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas stutzeri]     
. . .Pseudomonas denitrificans.................... 377  9e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas mosselii......................... 377  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. avellanae str. ISPaVe0 376  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas syringae]     
. . .Pseudomonas sp. HPB0071...................... 376  2e-124 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas fulva............................ 376  2e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas psychrotolerans.................. 376  3e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas psychrot...   
. . .Pseudomonas sp. 12M76_air.................... 375  4e-124 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas s...   
. . .Pseudomonas pelagia.......................... 375  4e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas pelagia]      
. . .Pseudomonas sp. P482......................... 375  5e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase, subunit GlcD [Pseudomonas s...   
. . .Pseudomonas parafulva........................ 375  5e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas luteola.......................... 375  5e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas luteola]      
. . .Pseudomonas aeruginosa....................... 374  1e-123 39 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas mosselii SJ10.................... 374  1e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas mo...   
. . .Pseudomonas bauzanensis...................... 374  2e-123 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas ba...   
. . .Pseudomonas aeruginosa PA7................... 373  3e-123 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa BWHPSA046............. 373  3e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas aeruginosa 3576.................. 373  3e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas aeruginosa BL04.................. 373  3e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas aeruginosa UCBPP-PA14............ 373  3e-123 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa VRFPA01............... 373  4e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas ae...   
. . .Pseudomonas aeruginosa B136-33............... 372  5e-123 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. 2_1_26....................... 372  9e-123 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. 2_1_26]   
. . .Pseudomonas aeruginosa BWHPSA026............. 372  1e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas aeruginosa c7447m................ 370  4e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glycolate dehydrogenase, subunit GlcD [Ps...   
. . .Pseudomonas aeruginosa LESB58................ 370  4e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa CIG1.................. 370  4e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa BWHPSA025............. 370  5e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas aeruginosa PAO1.................. 370  5e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa C41................... 370  5e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas otitidis......................... 370  6e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas aeruginosa NCGM2.S1.............. 370  6e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa M8A.1................. 370  6e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas entomophila...................... 369  9e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas entomoph...   
. . .Pseudomonas aeruginosa NCMG1179.............. 369  1e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa BL09.................. 369  1e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas aeruginosa PA96.................. 369  1e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas ae...   
. . .Pseudomonas aeruginosa M18................... 367  5e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa RP73.................. 367  5e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa BWHPSA001............. 367  6e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas aeruginosa X24509................ 367  7e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas aeruginosa VRFPA05............... 367  8e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas aeruginosa]   
. . .Pseudomonas aeruginosa BWHPSA020............. 367  1e-120 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas sp. P179......................... 366  2e-120 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Pseudo...   
. . .Pseudomonas aeruginosa C51................... 364  1e-119 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit glcD [Pseudomon...   
. . .Pseudomonas sp. LAIL14HWK12:I7............... 363  3e-119 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas sp. CMAA1215..................... 362  8e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Pseudomonas sp. CMAA...   
. . .Pseudomonas viridiflava UASWS0038............ 359  9e-118 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. actinidiae ICMP 19073 348  2e-113 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sy...   
. . .Pseudomonas syringae pv. oryzae str. 1_6..... 311  2e-102 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sy...   
. . .Pseudomonas syringae pv. aptata str. DSM 50252 279  2e-87  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sy...   
. . .Pseudomonas syringae pv. actinidiae ICMP 19070 269  7e-87  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sy...   
. . .Pseudomonas syringae pv. theae ICMP 3923..... 260  1e-83  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomon...   
. . .Pseudomonas syringae pv. actinidiae ICMP 19079 208  1e-63  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sy...   
. . .Pseudomonas syringae pv. actinidiae ICMP 18807 196  3e-59  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Pseudomonas sy...   
. . .Pseudomonas resinovorans NBRC 106553......... 132  1e-31  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: putative D-lactate dehydrogenase [Pseudom...   
. . .Azotobacter vinelandii....................... 384  1e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Azotobacter vinelandii]   
. . .Psychrobacter arcticus....................... 360  4e-118 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: FAD-binding protein [Psychrobacter arcticus]   
. . .Psychrobacter................................ 358  2e-117 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: FAD-binding protein [Psychr...   
. . .Acinetobacter sp. CAG:196.................... 154  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glycolate oxidase subunit GlcD [Acinetoba...   
. . .Thioalkalivibrio sp. ALJ17................... 390  4e-130 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sulfidiphilus............... 387  2e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sul...   
. . .Thioalkalivibrio............................. 374  1e-123 28 hits Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: FAD-binding protein [Thioal...   
. . .Thioalkalivibrio sp. ALgr1................... 369  7e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. AKL11................... 369  1e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALJT.................... 369  2e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. ALMg11.................. 368  3e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. AKL19................... 368  3e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. ALSr1................... 367  7e-121 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. ALJ16................... 366  1e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALE19................... 366  2e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio nitratireducens............. 365  2e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: Glycolate dehydrogenase, subunit GlcD [Th...   
. . .Thioalkalivibrio sp. K90mix.................. 365  4e-120 5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: FAD-binding protein [Thioal...   
. . .Thioalkalivibrio sp. ALM2T................... 365  5e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALE31................... 365  6e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALE30................... 364  8e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALMg9................... 364  8e-120 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALMg13-2................ 364  1e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio thiocyanoxidans ARh 4....... 364  1e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio thiocyan...   
. . .Thioalkalivibrio sp. ALE9.................... 363  1e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALE17................... 363  2e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. ALMg3................... 363  2e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. AKL8.................... 363  2e-119 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALE11................... 355  2e-116 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio thiocyanodenitrificans...... 355  3e-116 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio thi...   
. . .Thioalkalivibrio sp. ALE20................... 353  1e-115 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. ALE23................... 353  1e-115 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. AKL17................... 351  8e-115 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALR17-21................ 350  3e-114 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. ALgr3................... 348  2e-113 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thioalkalivibrio sp....   
. . .Thioalkalivibrio sp. ALJ24................... 343  2e-111 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sp. HK1..................... 320  3e-102 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase subunit GlcD [Thioalkal...   
. . .Thioalkalivibrio sulfidophilus HL-EbGr7...... 154  9e-40  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. HL-Eb18................. 149  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALJ15................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALJ2.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. AKL7.................... 145  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALMg2................... 144  6e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALJ7.................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALJ6.................... 141  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALE16................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio sp. ALE12................... 139  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioalkalivibrio nitratireducens DSM 14787... 138  6e-34  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD - binding oxidase domain - containing...   
. . .Ectothiorhodospira sp. PHS-1................. 386  2e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Ectothiorhodospira s...   
. . .Ectothiorhodospiraceae....................... 381  2e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: glycolate oxidase subunit G...   
. . .Halorhodospira halophila..................... 365  3e-120 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Halorhodospira halop...   
. . .Spiribacter sp. UAH-SP71..................... 356  1e-116 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Spiribacter sp. UAH...   
. . .Spiribacter salinus.......................... 356  1e-116 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD linked oxidase domain-containing prot...   
. . .Alkalilimnicola ehrlichii.................... 348  1e-113 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Alkalilimnicola ehrl...   
. . .Arhodomonas aquaeolei........................ 345  2e-112 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Arhodomonas aquaeolei]   
. . .Nitrococcus mobilis.......................... 239  1e-75  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glycolate oxidase, subunit GlcD [Nitrococ...   
. . .Thiorhodospira sibirica...................... 161  3e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Ectothiorhodospira haloalkaliphila........... 144  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Ec...   
. . .Halorhodospira halochloris................... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Ha...   
. . .uncultured Thiohalocapsa sp. PB-PSB1......... 382  8e-127 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [uncultured Thiohalo...   
. . .Nitrosococcus oceani......................... 375  7e-124 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Nitrosococcus oceani]     
. . .Nitrosococcus watsonii....................... 373  4e-123 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Nitrosococcus watsonii]   
. . .Nitrosococcus halophilus..................... 371  2e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Nitrosococcus haloph...   
. . .Thiocapsa marina............................. 351  4e-114 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thiocapsa marina]         
. . .Thiocystis violascens........................ 347  5e-113 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thiocystis violascens]    
. . .Allochromatium vinosum....................... 345  2e-112 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Allochromatium vinosum]   
. . .Lamprocystis purpurea........................ 344  6e-112 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Lamprocystis purpurea]    
. . .Thiorhodococcus drewsii...................... 341  1e-110 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Thiorhodococcus drew...   
. . .Thiorhodococcus sp. AK35..................... 339  3e-110 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: Glycolate dehydrogenase , subunit GlcD [Thiorh...   
. . .Marichromatium purpuratum 984................ 338  8e-110 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD-binding protein [Marichromatium purpuratum...   
. . .Thioflavicoccus mobilis...................... 328  6e-106 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD/FMN-dependent dehydrogenase [Thioflav...   
. . .Allochromatium vinosum DSM 180............... 159  3e-41  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Al...   
. . .Nitrosococcus oceani ATCC 19707.............. 158  5e-41  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Ni...   
. . .Nitrosococcus watsonii C-113................. 155  8e-40  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Ni...   
. . .Thiorhodococcus drewsii AZ1.................. 151  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thiocapsa marina 5811........................ 147  5e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Nitrosococcus halophilus Nc 4................ 147  6e-37  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Ni...   
. . .Thiorhodovibrio sp. 970...................... 145  2e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Thioflavicoccus mobilis 8321................. 145  2e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: FAD/FMN-dependent dehydrogenase [Thioflav...   
. . .Halothiobacillus neapolitanus................ 144  7e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Ha...   
. . .Thiocystis violascens DSM 198................ 143  2e-35  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: dimethylmenaquinone methyltransferase [Th...   
. . .Salinisphaera hydrothermalis C41B8........... 389  4e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: FAD linked oxidase domain-containing protein [...   
. . .Salinisphaera shabanensis.................... 368  3e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: FAD-binding protein [Salinisphaera shaban...   
. . .gamma proteobacterium L18.................... 387  7e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glycolate oxidase subunit GlcD [gamma pro...   
. . .gamma proteobacterium HIMB30................. 387  9e-129 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glycolate oxidase subunit GlcD [gamma pro...   
. . .Methylobacter luteus......................... 387  1e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glycolate oxidase subunit GlcD [Methyloba...   
. . .Methylobacter marinus........................ 375  4e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glycolate oxidase subunit GlcD [Methyloba...   
. . .Methylobacter tundripaludum.................. 157  1e-40  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: dimethylmenaquinone methyltransferase [Me...   
. . .Methylobacter tundripaludum SV96............. 155  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: dimethylmenaquinone methyltransferase [Me...   
. . .Methylomicrobium alcaliphilum................ 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: FAD-binding protein [Methylomicrobium alc...   
. . .Methylomicrobium buryatense.................. 375  5e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: FAD-binding protein [Methylomicrobium bur...   
. . .Methylococcus capsulatus..................... 373  2e-123 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: FAD-binding protein [Methylococcus capsul...   
. . .Methylococcus capsulatus str. Bath........... 372  5e-123 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: FAD-binding protein [Methylococcus capsul...   
. . .Methylococcaceae bacterium IT-4.............. 369  1e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glycolate oxidase subunit GlcD [Methyloma...   
. . .Methylohalobius crimeensis................... 367  3e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: FAD-binding protein [Methylohalobius crim...   
. . .Methyloglobulus morosus...................... 360  2e-118 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glycolate oxidase subunit GlcD [Methylogl...   
. . .Methylocaldum szegediense.................... 356  1e-116 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glycolate oxidase subunit GlcD [Methyloca...   
. . .Methylosarcina lacus......................... 349  6e-114 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glycolate oxidase subunit GlcD [Methylosa...   
. . .Methylomonas sp. LW13........................ 168  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: FAD-binding protein [Methylomonas sp. LW13]    
. . .Methylovulum miyakonense..................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: dimethylmenaquinone methyltransferase [Me...   
. . .Acidithiobacillus ferrooxidans............... 386  2e-128 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: FAD-binding protein [Acidithiobacillus fe...   
. . .Acidithiobacillus ferrooxidans ATCC 53993.... 384  1e-127 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: FAD-binding protein [Acidithiobacillus fe...   
. . .Acidithiobacillus caldus ATCC 51756.......... 354  5e-116 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: Glycolate dehydrogenase, subunit GlcD [Acidith...   
. . .Acidithiobacillus caldus..................... 351  8e-115 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: FAD-binding protein [Acidithiobacillus ca...   
. . .Acidithiobacillus ferrivorans................ 347  4e-113 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: Glycolate oxidase subunit glcD [Acidithiobaci...   
. . .Acidithiobacillus thiooxidans................ 343  8e-112 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: FAD-binding protein [Acidithiobacillus th...   
. . .Acidithiobacillus ferrivorans SS3............ 341  1e-110 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: FAD-binding protein [Acidithiobacillus fe...   
. . .Acidithiobacillus caldus SM-1................ 141  6e-35  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: dimethylmenaquinone methyltransferase [Ac...   
. . .Thermithiobacillus tepidarius................ 385  4e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glycolate oxidase subunit GlcD [Thermithi...   
. . .Nevskia soli................................. 384  8e-128 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glycolate oxidase subunit GlcD [Nevskia s...   
. . .Nevskia ramosa............................... 370  4e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: FAD-binding protein [Nevskia ramosa]           
. . .Hydrocarboniphaga effusa..................... 380  8e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: FAD-binding protein [Hydrocarboniphaga ef...   
. . .Sinobacter flavus............................ 170  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Si...   
. . .Singularimonas variicoloris.................. 167  1e-44  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Si...   
. . .Rudaea cellulosilytica....................... 319  3e-102 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glycolate oxidase subunit GlcD [Rudaea ce...   
. . .Stenotrophomonas sp. CF318................... 314  3e-100 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: FAD-binding protein [Polaromonas sp. CF318]    
. . .Lysobacter defluvii IMMIB APB-9.............. 145  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein N791_08385 [Lysobacter de...   
. . .Lysobacter defluvii.......................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Ly...   
. . .Rhodanobacter fulvus......................... 144  6e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Rh...   
. . .Lysobacter daejeonensis GH1-9................ 143  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Lysobac...   
. . .Lysobacter concretionis DSM 16239............ 139  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Lysobac...   
. . .Lysobacter capsici AZ78...................... 135  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Lysobac...   
. . .Frateuria aurantia........................... 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: D-lactate dehydrogenase [Frateuria aurantia]   
. . .Dyella japonica.............................. 133  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Dy...   
. . .Lysobacter antibioticus...................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Ly...   
. . .Xylella fastidiosa XfPE...................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Xylella...   
. . .Xylella fastidiosa........................... 130  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: dimethylmenaquinone methyltransferase [Xy...   
. . .Nitrincola sp. AK23.......................... 382  6e-127 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: putative FAD-linked oxidoreductase [Nitrincola...   
. . .Nitrincola lacisaponensis.................... 368  2e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Glycolate dehydrogenase, subunit GlcD [Nitrinc...   
. . .Halomonas smyrnensis......................... 375  6e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas smyrnensis]     
. . .Halomonas sp. B6............................. 373  3e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas...   
. . .Chromohalobacter salexigens.................. 370  5e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Chromohalobacter sal...   
. . .Halomonas jeotgali........................... 370  7e-122 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas jeotgali]       
. . .Chromohalobacter salexigens DSM 3043......... 370  8e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase, subunit GlcD [Chromohalobac...   
. . .Halomonas sp. BJGMM-B45...................... 369  9e-122 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas sp. BJGMM-...   
. . .Halomonas lutea.............................. 366  2e-120 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas...   
. . .Cobetia marina............................... 363  3e-119 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Cobetia marina]     
. . .Halomonas elongata........................... 362  4e-119 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas elongata]       
. . .Halomonas salina............................. 362  5e-119 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas salina]   
. . .Halotalea alkalilenta........................ 362  8e-119 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halotalea...   
. . .Halomonas.................................... 360  3e-118 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: MULTISPECIES: glycolate oxidase subunit G...   
. . .Halomonas sp. A3H3........................... 360  3e-118 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Glycolate oxidase subunit GlcD [Halomonas...   
. . .Halomonas sp. HL-48.......................... 360  3e-118 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas...   
. . .Halomonas sp. HAL1........................... 360  3e-118 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas sp. HAL1]       
. . .Halomonas zhanjiangensis..................... 359  1e-117 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas...   
. . .Halomonas sp. KO116.......................... 358  1e-117 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: D-lactate dehydrogenase (cytochrome) [Halomona...   
. . .Halomonas sp. GFAJ-1......................... 358  3e-117 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas sp. GFAJ-1]     
. . .Halomonas sp. TD01........................... 357  7e-117 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas sp. TD01]       
. . .Halomonas sp. S18214......................... 356  1e-116 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas stevensii]      
. . .Halomonas alkaliantarctica................... 356  1e-116 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas...   
. . .Halomonas anticariensis...................... 356  2e-116 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas anticarien...   
. . .Halomonas boliviensis........................ 356  2e-116 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas boliviensis]    
. . .Halomonas campaniensis....................... 355  2e-116 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Halomonas camp...   
. . .Neptunomonas japonica........................ 350  2e-114 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Neptunomo...   
. . .Hahella chejuensis........................... 337  2e-109 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Hahella chejuensis]       
. . .Halomonas sp. PBN3........................... 335  2e-108 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: FAD-binding protein [Halomonas sp. PBN3]            
. . .Amphritea japonica........................... 323  8e-104 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Amphritea japonica]      
. . .Oceanospirillum beijerinckii................. 314  3e-100 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit GlcD [Oceanospi...   
. . .Neptunomonas sp. Rs1......................... 306  2e-97  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glycolate oxidase subunit D [Osedax symbi...   
. . .Escherichia coli KTE52....................... 380  3e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia.................................. 380  3e-126 7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glycolate oxidase subunit g...   
. . .Escherichia coli KTE159...................... 380  4e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: FAD-binding protein [Escher...   
. . .Escherichia coli............................. 380  5e-126 213 hitsBacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE98....................... 380  5e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli P0301867.1.................. 380  7e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli H489........................ 380  7e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE136...................... 380  7e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli H299........................ 380  8e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli ECA-0157.................... 379  8e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit GlcD [Escherich...   
. . .Escherichia coli KTE165...................... 379  9e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli TA206....................... 379  9e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli MS 185-1.................... 379  9e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE28....................... 379  9e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE47....................... 379  9e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli SEPT362..................... 379  9e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit GlcD [Escherich...   
. . .Escherichia coli UTI89....................... 379  9e-126 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli LF82........................ 379  1e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 07798....................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 2-177-06_S4_C1.............. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia albertii KF1..................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: oxidoreductase [Escherichia albertii KF1]           
. . .Escherichia coli 042......................... 379  1e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli UMEA 3108-1................. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli P0305260.4.................. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli UMEA 3703-1................. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE94....................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli 3-105-05_S4_C2.............. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli MS 84-1..................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia albertii......................... 379  1e-125 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia albertii]     
. . .Escherichia coli UMEA 3163-1................. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KD1......................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli BIDMC 19C................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE25....................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli RN587/1..................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli IHE3034..................... 379  1e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 3-073-06_S1_C1.............. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli HVH 70 (4-2963531).......... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli MS 16-3..................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli MS 200-1.................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli UMEA 3152-1................. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli NC101....................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE44....................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli cloneA_i1................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit GlcD [Escherichia co...   
. . .Escherichia coli 3-073-06_S1_C2.............. 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli KTE192...................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli O127:H6 str. E2348/69....... 379  1e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli SMS-3-5..................... 379  1e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli F11......................... 379  1e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 907701...................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli O25b:H4-ST131 str. EC958.... 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit D [Escherichia ...   
. . .Escherichia coli WV_060327................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glycolate dehydrogenase , subunit GlcD [Escher...   
. . .Escherichia coli 174750...................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli HVH 190 (4-3255514)......... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE186...................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli 3-020-07_S4_C1.............. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli ED1a........................ 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 2-005-03_S4_C3.............. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli SE15........................ 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli P0304777.1.................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli MS 187-1.................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli P0299438.5.................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli 2-005-03_S3_C2.............. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli P0299917.1.................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli P0305260.6.................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli TW10509..................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: FAD-binding protein [Escher...   
. . .Escherichia coli O145:H28 str. 2009C-3292.... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia sp. 1_1_43....................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: FAD-binding protein [Escher...   
. . .Escherichia coli 2-011-08_S1_C1.............. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli P0302308.2.................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli H494........................ 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli DH1......................... 379  2e-125 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli O25:NM str. E2539C1......... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli UMEA 3718-1................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli TA280....................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli UMEA 3124-1................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli O55:H7 str. CB9615.......... 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli UMEA 3052-1................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli M863........................ 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 536......................... 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE54....................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli TA143....................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia albertii TW11588................. 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia sp. TW11...   
. . .Escherichia coli KTE115...................... 379  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli SCD2........................ 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glycolate dehydrogenase, subunit GlcD [Escheri...   
. . .Escherichia coli LT-68....................... 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli UMEA 3592-1................. 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE33....................... 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glycolate oxidase subunit g...   
. . .Escherichia coli KTE147...................... 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli STEC_DG131-3................ 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli MS 78-1..................... 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli DEC5B....................... 378  2e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli E24377A..................... 378  3e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE114...................... 378  3e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli str. K-12 substr. MG1655.... 378  3e-125 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glycolate oxidase subunit, ...   
. . .Escherichia coli P0299438.11................. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli 541-15...................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli P0304816.12................. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli O26:H1 str. 2010C-3051...... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli O69:H11 str. 08-4661........ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli O26:H1 str. 2009C-4760...... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli MS 69-1..................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 199900.1.................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli 1357........................ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli MS 115-1.................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 1-250-04_S3_C2.............. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli TA124....................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli O111:NM str. 2011C-3170..... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli MP021552.7.................. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli STEC_MHI813................. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 2762100..................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli KTE144...................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli ISC7........................ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glycolate dehydrogenase , subunit GlcD [Esche...   
. . .Escherichia coli SCD1........................ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glycolate dehydrogenase, subunit GlcD [Escheri...   
. . .Escherichia coli O118:H16 str. 07-4255....... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli B354........................ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli O86:H34 str. 99-3124........ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli KOEGE 71 (186a)............. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli P0304816.6.................. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli XH001....................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli DEC1A....................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli M605........................ 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli P0302308.1.................. 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli M919........................ 378  4e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli UMEA 3200-1................. 378  4e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia albertii TW07627................. 378  4e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia albertii]     
. . .Escherichia coli B093........................ 378  4e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 2362-75..................... 378  4e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia albertii NBRC 107761............. 378  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit GlcD [Escherichia a...   
. . .Escherichia coli KTE146...................... 378  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli 5-366-08_S3_C3.............. 377  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli 2-316-03_S4_C3.............. 377  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli KTE205...................... 377  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli P0301867.11................. 377  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli 7-233-03_S1_C2.............. 377  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli KTE66....................... 377  5e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli 7-233-03_S1_C3.............. 377  6e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Escherichia coli]           
. . .Escherichia coli HVH 31 (4-2602156).......... 377  6e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli KTE201...................... 377  7e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli Nissle 1917................. 377  7e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glycolate dehydrogenase [Escherichia coli Nis...   
. . .Escherichia coli HVH 27 (4-7449267).......... 377  7e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli NA114....................... 377  7e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE209...................... 377  8e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli str. 'clone D i2'........... 377  8e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli IAI39....................... 377  8e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli KTE21....................... 377  9e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli 5.0959...................... 377  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 3-267-03_S4_C2.............. 377  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli HVH 195 (3-7155360)......... 377  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli P0305260.7.................. 376  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli 53638....................... 376  1e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 180600...................... 376  2e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli BL21(DE3)................... 376  2e-124 4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli MS 182-1.................... 376  2e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 2862600..................... 376  2e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli P0302308.11................. 376  2e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli HVH 107 (4-5860571)......... 376  3e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli N1.......................... 375  3e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 907710...................... 375  3e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli p0305293.10................. 375  3e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli CAG:4....................... 375  4e-124 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit GlcD [Escherich...   
. . .Escherichia coli KTE193...................... 375  4e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli UMEA 3221-1................. 375  5e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherich...   
. . .Escherichia coli 4_1_47FAA................... 375  5e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Escherichia coli 3-267-03_S1_C3.............. 374  8e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli p0305293.2.................. 374  8e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli P0304816.14................. 374  8e-124 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli 2741950..................... 374  2e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli 2875150..................... 374  2e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli 2866450..................... 373  2e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli p0305293.12................. 372  7e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escheric...   
. . .Escherichia coli 908525...................... 290  7e-92  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase, subunit GlcD [Escherichia c...   
. . .Escherichia coli HVH 201 (4-4459431)......... 207  3e-63  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase subunit glcD [Escherichia co...   
. . .Escherichia coli P0302308.14................. 197  1e-56  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD linked oxidase, C-terminal domain protein ...   
. . .Escherichia coli G58-1....................... 163  6e-44  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Escherichia coli]         
. . .Shigella dysenteriae......................... 379  2e-125 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glycolate oxidase [Shigella dysenteriae]       
. . .Shigella flexneri............................ 378  3e-125 13 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella flexneri]        
. . .Shigella flexneri 2850-71.................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella flexneri]        
. . .Shigella flexneri J1713...................... 378  3e-125 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella flexneri]        
. . .Shigella flexneri K-1770..................... 374  1e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella flexneri]        
. . .Shigella flexneri VA-6....................... 374  2e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella flexneri]        
. . .Shigella flexneri Shi06HN006................. 366  2e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: hypothetical protein [Shigella flexneri]       
. . .Shigella boydii.............................. 288  4e-91  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella boydii]          
. . .Shigella dysenteriae 155-74.................. 287  2e-90  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: FAD-binding protein [Shigella dysenteriae]     
. . .uncultured gamma proteobacterium HF0200_24F15 377  7e-126 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD/FMN-containing dehydrogenases [uncultured ...   
. . .uncultured gamma proteobacterium HF4000_06A21 374  1e-123 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD/FMN-containing dehydrogenases [uncultured ...   
. . .uncultured gamma proteobacterium HF0130_26L16 347  5e-114 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD/FMN-containing dehydrogenases [uncultured ...   
. . .uncultured gamma proteobacterium............. 146  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD/FMN-containing dehydrogenases [uncultured...   
. . .Enterovibrio calviensis...................... 368  2e-121 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glycolate oxidase subunit GlcD [Enterovib...   
. . .Enterovibrio norvegicus...................... 366  8e-121 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Enterovibrio norveg...   
. . .Enterovibrio sp. AK16........................ 352  2e-115 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glycolate dehydrogenase , subunit GlcD [G...   
. . .Brucella abortus LMN1........................ 323  8e-104 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: FAD-binding protein [Brucella]   
. . .Marinobacter nanhaiticus..................... 353  2e-115 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD linked oxidase domain-containing prot...   
. . .Marinobacter similis......................... 349  7e-114 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter sp. A3d10]        
. . .Marinobacter santoriniensis.................. 346  8e-113 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glycolate oxidase, FAD-linked subunit [Ma...   
. . .Marinobacter daepoensis...................... 344  4e-112 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glycolate oxidase subunit GlcD [Marinobac...   
. . .Marinobacter algicola........................ 344  5e-112 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter algicola]    
. . .Marinobacter sp. C1S70....................... 343  1e-111 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter sp. C1S70]   
. . .Marinobacter sp. EVN1........................ 343  1e-111 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter sp. EVN1]    
. . .Marinobacter hydrocarbonoclasticus........... 342  2e-111 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter hydroca...   
. . .Marinobacter lipolyticus..................... 342  2e-111 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD linked oxidase domain-containing prot...   
. . .Marinobacter sp. EN3......................... 342  3e-111 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter sp. EN3]     
. . .Marinobacter................................. 341  6e-111 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: FAD-binding protein [Marino...   
. . .Marinobacter sp. HL-58....................... 341  9e-111 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glycolate oxidase subunit GlcD [Marinobac...   
. . .Marinobacter sp. AK21........................ 340  2e-110 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Glycolate dehydrogenase , subunit GlcD [Marino...   
. . .Marinobacter aquaeolei VT8................... 339  4e-110 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter hydroca...   
. . .Marinobacter sp. ELB17....................... 333  7e-108 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter sp. ELB17]   
. . .Marinobacter sp. BSs20148.................... 331  9e-107 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacter sp. BSs...   
. . .Marinobacterium sp. AK27..................... 348  1e-113 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Glycolate dehydrogenase, subunit GlcD [Marinob...   
. . .Marinobacterium rhizophilum.................. 348  2e-113 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Marinobacterium rhiz...   
. . .Microbulbifer agarilyticus................... 310  5e-99  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: FAD-binding protein [Microbulbifer agaril...   
. . .marine gamma proteobacterium HTCC2143........ 347  5e-113 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [marine gamma proteob...   
. . .marine gamma proteobacterium HTCC2148........ 342  2e-112 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: F420H2:quinone oxidoreductase [marine gam...   
. . .Sedimenticola selenatireducens............... 345  2e-112 2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glycolate oxidase subunit GlcD [Sedimenti...   
. . .Oceanimonas sp. GK1.......................... 342  1e-111 3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: FAD-binding protein [Oceanimonas sp. GK1]      
. . .Oceanimonas doudoroffii...................... 288  1e-92  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glycolate oxidase subunit D [Oceanimonas doudo...   
. . .Simiduia agarivorans......................... 316  3e-101 1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: FAD-binding protein [Simiduia agarivorans]     
. . .gamma proteobacterium IMCC2047............... 271  1e-87  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Glycolate dehydrogenase2C subunit GlcD [gamma ...   
. . .Solimonas soli............................... 166  3e-44  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: dimethylmenaquinone methyltransferase [So...   
. . .Polycyclovorans algicola..................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: dimethylmenaquinone methyltransferase [Po...   
. . .gamma proteobacterium Hiromi1................ 145  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: D-lactate dehydrogenase [gamma proteobacteriu...   
. . .Thiobacillus prosperus....................... 144  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glycolate oxidase, subunit GlcD [Thiobacillus ...   
. . Burkholderia sp. RPE64........................ 390  5e-130 9 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia sp. MP-1......................... 390  8e-130 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholderia s...   
. . Burkholderia cepacia.......................... 386  3e-128 13 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cepacia]     
. . Burkholderia cenocepacia...................... 385  9e-128 14 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cenocep...   
. . Burkholderia pyrrocinia....................... 384  1e-127 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholderia p...   
. . Burkholderia cenocepacia H111................. 384  1e-127 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cenocep...   
. . Burkholderia caribensis MBA4.................. 384  1e-127 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia caribensis M...   
. . Burkholderia phymatum......................... 384  2e-127 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia phymatum]    
. . Burkholderia terrae........................... 383  3e-127 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia terrae]      
. . Burkholderia ambifaria........................ 383  3e-127 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia ambifaria]   
. . Burkholderia sp. BT03......................... 382  6e-127 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. BT03]    
. . Burkholderia sp. MSh1......................... 382  6e-127 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia ambifaria AMMD................... 382  1e-126 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia ambifaria]   
. . Burkholderia glathei.......................... 381  2e-126 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholderia g...   
. . Burkholderia sp. UYPR1.413.................... 381  2e-126 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia vietnamiensis AU4i............... 381  3e-126 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate dehydrogenase, subunit GlcD [Bu...   
. . Burkholderia sp. WSM4176...................... 381  3e-126 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. WSM...   
. . Burkholderia ambifaria MEX-5.................. 380  3e-126 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia ambifaria]   
. . Burkholderia lata............................. 379  1e-125 5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia lata]        
. . Burkholderia fungorum......................... 379  1e-125 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia cepacia ATCC 25416............... 379  1e-125 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia sp. K24.......................... 379  2e-125 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia phymatum STM815.................. 378  3e-125 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia phymatum]    
. . Burkholderia oklahomensis..................... 378  4e-125 8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia oklahom...   
. . Burkholderia ambifaria IOP40-10............... 377  5e-125 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia ambifaria]   
. . Burkholderia kururiensis...................... 376  2e-124 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia kururie...   
. . Burkholderia phytofirmans..................... 375  3e-124 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia phytofi...   
. . Burkholderia sp. Ch1-1........................ 372  7e-123 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. Ch1-1]   
. . Burkholderia grimmiae......................... 372  1e-122 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholderia g...   
. . Burkholderia xenovorans....................... 372  1e-122 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia xenovor...   
. . Burkholderia sp. H160......................... 370  5e-122 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. H160]    
. . Burkholderia sp. lig30........................ 362  5e-119 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase (cytochrome) [Burkhold...   
. . Burkholderia multivorans...................... 361  1e-118 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia multivo...   
. . Burkholderia dolosa PC543..................... 360  2e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia dolosa PC543]     
. . Burkholderia ubonensis........................ 360  3e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia ubonensis]   
. . Burkholderia multivorans ATCC 17616........... 360  4e-118 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia multivo...   
. . Burkholderia sp. JPY347....................... 359  6e-118 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. JPY...   
. . Burkholderia ambifaria MC40-6................. 358  3e-117 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia ambifaria]   
. . Burkholderia cepacia GG4...................... 357  5e-117 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cepacia]     
. . Burkholderia sp. MSh2......................... 356  1e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia pseudomallei..................... 356  2e-116 70 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia pseudom...   
. . Burkholderia cenocepacia MC0-3................ 355  2e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cenocep...   
. . Burkholderia.................................. 355  3e-116 5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Burkho...   
. . Burkholderia cepacia complex.................. 354  5e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Burkho...   
. . Burkholderia pseudomallei 354e................ 354  5e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia pseudom...   
. . Burkholderia cenocepacia AU 1054.............. 354  5e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cenocep...   
. . Burkholderia cenocepacia KC-01................ 354  7e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate dehydrogenase, subunit GlcD [Bu...   
. . pseudomallei group............................ 354  8e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [pseudo...   
. . Burkholderia mallei........................... 353  1e-115 21 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia mallei]      
. . Burkholderia pseudomallei BPC006.............. 353  2e-115 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia pseudom...   
. . Burkholderia cenocepacia J2315................ 353  2e-115 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia cenocep...   
. . Burkholderia pseudomallei 1710b............... 353  2e-115 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia pseudom...   
. . Burkholderia pseudomallei K96243.............. 352  4e-115 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia pseudom...   
. . Burkholderia pseudomallei MSHR346............. 352  5e-115 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia pseudom...   
. . Burkholderia graminis......................... 351  9e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia graminis]    
. . Burkholderia sp. URHA0054..................... 351  1e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia phenoliruptrix................... 351  1e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia phenoli...   
. . Burkholderia sp. WSM2230...................... 350  2e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia dilworthii....................... 350  3e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia oxyphila......................... 350  3e-114 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia thailandensis.................... 350  6e-114 9 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia thailan...   
. . Burkholderia thailandensis MSMB121............ 349  6e-114 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia thailan...   
. . Burkholderia bannensis........................ 349  7e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia sp. JPY366....................... 349  8e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia sp. CCGE1001..................... 349  9e-114 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. CCG...   
. . Burkholderia sp. CCGE1003..................... 348  1e-113 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. CCG...   
. . Burkholderia thailandensis E264............... 348  2e-113 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia thailan...   
. . Burkholderia sp. WSM2232...................... 347  3e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia terrae BS001..................... 347  5e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Burkho...   
. . Burkholderia nodosa........................... 346  1e-112 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia ferrariae........................ 345  1e-112 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia mimosarum........................ 345  4e-112 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia phytofirmans PsJN................ 344  4e-112 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia phytofi...   
. . Burkholderia sp. WSM3617...................... 343  1e-111 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia acidipaludis..................... 343  2e-111 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia xenovorans LB400................. 343  2e-111 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia xenovor...   
. . Burkholderia sp. CCGE1002..................... 342  6e-111 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Burkho...   
. . Burkholderia gladioli......................... 341  1e-110 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia gladioli]    
. . Burkholderia sp. A1........................... 338  1e-109 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia glumae........................... 329  5e-106 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia glumae]      
. . Burkholderia sp. TJI49........................ 328  5e-106 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: (S)-2-hydroxy-acid oxidase [Burkholderia sp. T...   
. . Burkholderia sordidicola...................... 328  8e-106 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Burkholde...   
. . Burkholderia sp. SJ98......................... 324  6e-104 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. SJ98]    
. . Burkholderia sp. YI23......................... 323  1e-103 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia sp. YI23]    
. . Burkholderia rhizoxinica...................... 307  2e-97  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderia rhizoxi...   
. . Burkholderia sp. RPE67........................ 138  7e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Burkholderia sp....   
. . Burkholderia sp. OP-1......................... 134  2e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia zhejiange...   
. . Burkholderia andropogonis..................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia andr...   
. . Burkholderia thailandensis H0587.............. 132  8e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia thai...   
. . Burkholderia thailandensis 2002721723......... 132  9e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia thai...   
. . Burkholderia mallei ATCC 10399................ 132  1e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia mallei]   
. . Burkholderia rhizoxinica HKI 454.............. 131  2e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Burkholderia rhi...   
. . Burkholderia gladioli BSR3.................... 131  2e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Burkholderia gla...   
. . Burkholderia pseudomallei MSHR4377............ 131  2e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD binding domain protein [Burkholderia pseud...   
. . Burkholderia pseudomallei 1106a............... 131  2e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia pseu...   
. . Burkholderia mallei ATCC 23344................ 131  2e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia mallei]   
. . Burkholderia pseudomallei MSHR305............. 130  3e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia pseu...   
. . Burkholderia pseudomallei 668................. 130  3e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia pseu...   
. . Burkholderia pseudomallei NCTC 13179.......... 130  3e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia pseu...   
. . Burkholderia pseudomallei NCTC 13178.......... 130  3e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD binding domain protein [Burkholderia pseud...   
. . Burkholderia thailandensis MSMB43............. 130  5e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: 2-hydroxy-acid oxidase [Burkholderia thai...   
. . Cupriavidus taiwanensis....................... 361  2e-118 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus taiwanen...   
. . Cupriavidus taiwanensis LMG 19424............. 360  3e-118 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus taiwanen...   
. . Cupriavidus necator........................... 360  4e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus necator]      
. . Cupriavidus sp. UYPR2.512..................... 359  1e-117 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus sp. UYPR...   
. . Ralstonia solanacearum........................ 357  4e-117 15 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia solanacearum]   
. . Cupriavidus sp. amp6.......................... 357  6e-117 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Cupriavid...   
. . Burkholderiaceae.............................. 357  7e-117 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Burkho...   
. . Ralstonia pickettii........................... 356  1e-116 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Ralstonia...   
. . Ralstonia pickettii OR214..................... 355  2e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD/FMN-dependent dehydrogenase [Ralstoni...   
. . Ralstonia pickettii 12J....................... 355  2e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Betapr...   
. . Ralstonia..................................... 355  2e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Ralsto...   
. . Ralstonia pickettii DTP0602................... 355  3e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia pickettii]      
. . Ralstonia solanacearum CMR15.................. 355  4e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate oxidase subunit glcD [Ralstonia...   
. . Cupriavidus sp. BIS7.......................... 355  4e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus sp. BIS7]     
. . Ralstonia solanacearum K60.................... 355  4e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia solanacearum]   
. . Ralstonia solanacearum CFBP2957............... 354  6e-116 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia solanacearum]   
. . Ralstonia sp. AU12-08......................... 354  6e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia sp. AU12-08]    
. . Ralstonia pickettii 12D....................... 354  9e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia pickettii]      
. . Ralstonia solanacearum Po82................... 354  9e-116 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia solanacearum]   
. . Ralstonia solanacearum PSI07.................. 354  9e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia solanacearum]   
. . Ralstonia solanacearum UW551.................. 354  4e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia solanacearum]   
. . Ralstonia sp. UNC404CL21Col................... 353  2e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Ralstonia...   
. . Cupriavidus sp. SK-3.......................... 352  4e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Cupriavidus sp...   
. . Chitinimonas koreensis........................ 352  4e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Chitinimo...   
. . Cupriavidus metallidurans..................... 352  5e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus metallid...   
. . Ralstonia syzygii R24......................... 352  7e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit glcD [Ralstonia syz...   
. . Cupriavidus necator HPC(L).................... 352  9e-115 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit, FAD-linked [Cu...   
. . Cupriavidus sp. HMR-1......................... 350  2e-114 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit, FAD-linked [Cu...   
. . Cupriavidus pinatubonensis.................... 337  5e-109 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Cupriavidus pinatubo...   
. . Limnobacter sp. MED105........................ 335  3e-108 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Limnobacter sp. MED105]   
. . Ralstonia sp. PBA............................. 333  1e-107 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Ralstonia sp. PBA]        
. . Lautropia mirabilis........................... 333  6e-107 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Lautropia mirabilis]      
. . Polynucleobacter necessarius.................. 331  6e-107 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Polynucleobacter nec...   
. . Pandoraea sp. B-6............................. 331  1e-106 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Pandoraea sp. B-6]        
. . Pandoraea sp. SD6-2........................... 331  1e-106 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Pandoraea sp. SD...   
. . Pandoraea..................................... 330  2e-106 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: glycolate oxidase subunit G...   
. . Pandoraea pnomenusa........................... 330  4e-106 7 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Pandoraea pnom...   
. . Pandoraea sp. RB-44........................... 330  4e-106 7 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Pandoraea sp. RB-44]      
. . Pandoraea pnomenusa 3kgm...................... 326  1e-104 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Pandor...   
. . Ralstonia solanacearum IPO1609................ 286  2e-89  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase (fad-linked subunit) pr...   
. . Ralstonia solanacearum P673................... 132  1e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Ralstonia solana...   
. . Cupriavidus sp. WS............................ 130  5e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Cupriavidus sp. WS]   
. . Alcaligenes................................... 389  1e-129 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: glycolate oxidase subunit G...   
. . Alcaligenes faecalis.......................... 389  1e-129 5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Alcaligenes faecalis]     
. . Pusillimonas noertemannii..................... 388  3e-129 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Pusillimonas noertem...   
. . Oxalobacteraceae bacterium JGI 0001012-C15.... 370  5e-122 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Oxalobact...   
. . Massilia sp. JS1662........................... 369  1e-121 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Massilia sp. J...   
. . Massilia timonae.............................. 369  1e-121 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase, subunit GlcD [Massilia...   
. . Pusillimonas sp. T7-7......................... 362  6e-119 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Pusillimonas sp. T7-7]    
. . Massilia sp. BSC265........................... 360  5e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Massilia sp. B...   
. . Castellaniella defragrans 65Phen.............. 359  9e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate dehydrogenase, subunit GlcD [Castel...   
. . Massilia alkalitolerans....................... 358  2e-117 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Massilia ...   
. . Bordetella petrii............................. 358  3e-117 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetell...   
. . Achromobacter xylosoxidans.................... 357  5e-117 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Achromobacter xyloso...   
. . Achromobacter sp. DH1f........................ 357  6e-117 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Alcaligen...   
. . Achromobacter xylosoxidans NH44784-1996....... 357  6e-117 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate dehydrogenase [Achromobacter xy...   
. . Herminiimonas arsenicoxydans.................. 357  9e-117 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate oxidase subunit glcD [Herminiimonas...   
. . Achromobacter xylosoxidans NBRC 15126......... 357  1e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate dehydrogenase, subunit GlcD [Ac...   
. . Oxalobacteraceae bacterium AB_14.............. 356  1e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Oxalobact...   
. . Janthinobacterium sp. Marseille............... 356  1e-116 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Janthinobacterium sp...   
. . Achromobacter xylosoxidans A8................. 356  3e-116 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Achromobacter xyloso...   
. . Herbaspirillum sp. GW103...................... 355  3e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Herbaspirillum sp. G...   
. . Herminiimonas sp. CN.......................... 355  3e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Herminiim...   
. . Herbaspirillum seropedicae.................... 355  3e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Herbaspirillum serop...   
. . Herbaspirillum massiliense.................... 355  3e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Herbaspirillum massi...   
. . Achromobacter piechaudii...................... 355  4e-116 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Achromobacter piecha...   
. . Achromobacter sp. RTa......................... 355  4e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Achromobacter ...   
. . Bordetella avium.............................. 354  6e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella avium]         
. . Bordetella hinzii............................. 354  6e-116 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetell...   
. . Achromobacter arsenitoxydans.................. 354  8e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Achromobacter arseni...   
. . Bordetella hinzii CA90 BAL1384................ 354  2e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetella hin...   
. . Oxalobacteraceae bacterium JGI 0001004-K23.... 352  2e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Oxalobacteraceae bac...   
. . Herbaspirillum................................ 352  3e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Herbas...   
. . Herbaspirillum frisingense.................... 352  4e-115 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase (FAD-linked subunit) ox...   
. . Herbaspirillum sp. YR522...................... 352  5e-115 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Herbaspirillum sp. Y...   
. . Janthinobacterium lividum..................... 351  8e-115 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate oxidase subunit GlcD [Janthinobacter...   
. . Massilia niastensis........................... 351  1e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Massilia niastensis]      
. . Oxalobacteraceae bacterium IMCC9480........... 351  1e-114 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Oxalobacteraceae bac...   
. . Thiomonas sp. FB-Cd........................... 351  1e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Thiomonas...   
. . Janthinobacterium sp. HH01.................... 351  1e-114 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Janthinob...   
. . Bordetella sp. FB-8........................... 351  2e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella sp. FB-8]      
. . Bordetella petrii DSM 12804................... 350  2e-114 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella petrii]        
. . Bordetella holmesii........................... 350  2e-114 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetell...   
. . Azohydromonas australica...................... 350  4e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Azohydrom...   
. . Bordetella holmesii H558...................... 349  6e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit [Bordetella hol...   
. . Bordetella bronchiseptica 99-R-0433........... 349  7e-114 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetella bro...   
. . Bordetella holmesii F627...................... 349  8e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit [Bordetella hol...   
. . Herbaspirillum sp. CF444...................... 348  8e-114 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Herbaspirillum sp. C...   
. . Bordetella bronchiseptica MBORD707............ 348  9e-114 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetella bro...   
. . Bordetella bronchiseptica F-1................. 348  1e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetella bro...   
. . Bordetella bronchiseptica OSU-O54............. 348  1e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetella bro...   
. . Bordetella bronchiseptica..................... 348  1e-113 13 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit [Bordetella bro...   
. . Bordetella parapertussis...................... 348  1e-113 5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit [Bordetella par...   
. . Bordetella bronchiseptica RB50................ 348  1e-113 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella bronchise...   
. . Bordetella trematum........................... 348  1e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetell...   
. . Duganella violaceinigra....................... 348  1e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Duganella...   
. . Bordetella bronchiseptica CDC-H572-BH......... 348  2e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetella hol...   
. . Bordetella pertussis.......................... 348  2e-113 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Bordetell...   
. . Bordetella pertussis Tohama I................. 348  2e-113 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella pertussis]     
. . Bordetella pertussis 18323.................... 347  3e-113 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella pertussis]     
. . Herbaspirillum lusitanum...................... 347  3e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Herbaspir...   
. . Collimonas fungivorans........................ 347  3e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Collimonas fungivorans]   
. . Advenella kashmirensis W13003................. 347  3e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Advenella kashmirensis W1...   
. . Advenella kashmirensis........................ 347  3e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Advenella...   
. . Caldimonas manganoxidans...................... 347  4e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Caldimonas manganoxi...   
. . Janthinobacterium sp. CG3..................... 346  8e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Janthinobacterium sp...   
. . Simplicispira psychrophila.................... 346  8e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Simplicis...   
. . Bordetella parapertussis 12822................ 346  9e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Bordetella parapertu...   
. . Advenella mimigardefordensis DPN7............. 346  1e-112 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Advenella mimi...   
. . Sphaerotilus natans subsp. natans DSM 6575.... 345  4e-112 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD linked oxidase domain-containing protein [...   
. . Janthinobacterium agaricidamnosum NBRC 102515 = 344  6e-112 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD linked oxidases, C-terminal domain protei...   
. . Duganella zoogloeoides........................ 343  1e-111 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Duganella zoogloeoides]   
. . Comamonadaceae bacterium A1................... 342  5e-111 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD/FMN-containing dehydrogenase [Comamonadac...   
. . Curvibacter lanceolatus....................... 338  1e-109 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Curvibacter lanceola...   
. . Ottowia thiooxydans........................... 338  2e-109 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Ottowia t...   
. . Curvibacter gracilis.......................... 338  2e-109 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Curvibact...   
. . Methylibium petroleiphilum.................... 337  5e-109 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Methylibium petrolei...   
. . Acidovorax sp. JHL-3.......................... 337  6e-109 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Acidovora...   
. . Polaromonas sp. Cr4-12........................ 336  9e-109 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Polaromon...   
. . Polaromonas sp. CG9_12........................ 335  1e-108 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate dehydrogenase , subunit GlcD [Polar...   
. . Thiomonas sp. FB-6............................ 335  2e-108 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Thiomonas sp. FB-6]       
. . Comamonadaceae bacterium URHA0028............. 333  2e-107 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Comamonad...   
. . Leptothrix cholodnii.......................... 333  2e-107 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Leptothrix cholodnii]     
. . Methylibium petroleiphilum PM1................ 332  3e-107 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Methylibium petrolei...   
. . Rhodoferax saidenbachensis.................... 329  2e-106 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Rhodofera...   
. . Comamonas testosteroni TK102.................. 325  3e-104 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas testosteroni TK...   
. . Comamonas testosteroni........................ 325  3e-104 14 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas testosteroni]   
. . Comamonas testosteroni ATCC 11996............. 324  7e-104 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas testosteroni]   
. . Acidovorax sp. CF316.......................... 323  9e-104 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax sp. CF316]     
. . Comamonas testosteroni S44.................... 323  1e-103 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas testosteroni]   
. . Variovorax paradoxus.......................... 322  2e-103 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase, subunit GlcD [Variovor...   
. . Leptothrix cholodnii SP-6..................... 322  4e-103 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Leptothrix cholodnii]     
. . Comamonas testosteroni CNB-2.................. 322  4e-103 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas testosteroni]   
. . Comamonadaceae bacterium B1................... 321  7e-103 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD/FMN-containing dehydrogenase [Comamonadac...   
. . Comamonadaceae bacterium H1................... 320  8e-103 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Comamonad...   
. . Variovorax.................................... 320  2e-102 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: FAD-binding protein [Variov...   
. . Verminephrobacter aporrectodeae............... 319  2e-102 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Verminephrobacter ap...   
. . Variovorax paradoxus S110..................... 319  4e-102 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Variovorax paradoxus]     
. . Thiomonas arsenitoxydans...................... 318  5e-102 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate oxidase subunit glcD [Thiomonas...   
. . Thiomonas intermedia.......................... 318  5e-102 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Thiomonas intermedia]     
. . Delftia acidovorans........................... 318  6e-102 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase, subunit GlcD [Delftia ...   
. . Delftia sp. Cs1-4............................. 318  6e-102 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Delftia sp. Cs1-4]        
. . Thiomonas sp. CB2............................. 318  7e-102 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit, FAD-linked [Thiomo...   
. . Delftia acidovorans CCUG 15835................ 318  7e-102 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase, subunit GlcD [Delftia ...   
. . Aquabacterium sp. NJ1......................... 318  8e-102 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Aquabacterium ...   
. . Burkholderiales bacterium JOSHI_001........... 318  9e-102 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Burkholderiales bact...   
. . Delftia acidovorans SPH-1..................... 318  9e-102 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Delftia acidovorans]      
. . Delftia sp. RIT313............................ 318  1e-101 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD linked oxidase domain protein [Delftia sp....   
. . Ideonella sp. B508-1.......................... 317  2e-101 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Ideonella...   
. . Variovorax paradoxus EPS...................... 317  2e-101 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Variovorax paradoxus]     
. . Acidovorax sp. NO-1........................... 316  6e-101 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax sp. NO-1]      
. . Polaromonas naphthalenivorans................. 315  1e-100 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Polaromonas naphthal...   
. . Comamonas badia............................... 315  1e-100 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Comamonas...   
. . Acidovorax sp. KKS102......................... 315  1e-100 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax sp. KKS102]    
. . Verminephrobacter eiseniae.................... 315  3e-100 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Verminephrobacter ei...   
. . Acidovorax sp. MR-S7.......................... 314  3e-100 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax sp. MR-S7]     
. . Comamonas sp. B-9............................. 313  5e-100 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas sp. B-9]        
. . Polaromonas sp. JS666......................... 313  8e-100 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Polaromonas sp. JS666]    
. . Comamonas aquatica DA1877..................... 312  1e-99  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Comamonas aquatica DA1877]     
. . Acidovorax sp. JHL-9.......................... 312  2e-99  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Acidovora...   
. . Limnohabitans sp. Rim28....................... 311  3e-99  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Limnohabitans sp. Ri...   
. . Acidovorax radicis............................ 311  3e-99  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax radicis]       
. . Acidovorax citrulli........................... 311  3e-99  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax citrulli]      
. . Comamonas composti............................ 310  1e-98  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Comamonas...   
. . Rubrivivax benzoatilyticus.................... 310  2e-98  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Rubrivivax benzoatil...   
. . Limnohabitans sp. Rim47....................... 309  2e-98  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Limnohabitans sp. Ri...   
. . Rubrivivax gelatinosus........................ 309  4e-98  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Rubrivivax gelatinosus]   
. . Acidovorax avenae............................. 308  3e-98  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Acidovora...   
. . Acidovorax oryzae............................. 308  4e-98  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Acidovora...   
. . Acidovorax avenae subsp. avenae ATCC 19860.... 308  6e-98  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax avenae]        
. . Variovorax sp. URHB0020....................... 308  6e-98  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Variovora...   
. . Polaromonas sp. EUR3 1.2.1.................... 308  1e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Polaromon...   
. . Acidovorax sp. JS42........................... 307  2e-97  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax sp. JS42]      
. . Hylemonella gracilis str. Niagara R........... 306  2e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Hylemonella gr...   
. . Hylemonella gracilis.......................... 306  3e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Hylemonella gracilis]     
. . Acidovorax ebreus............................. 306  3e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Acidovorax ebreus]        
. . Albidiferax ferrireducens..................... 305  6e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Albidiferax ferrired...   
. . Derxia gummosa................................ 304  9e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Derxia gu...   
. . Alicycliphilus denitrificans.................. 300  7e-95  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Alicycliphilus denit...   
. . Alicycliphilus denitrificans K601............. 300  8e-95  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Alicycliphilus denit...   
. . Hydrogenophaga sp. PBC........................ 298  8e-94  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: FAD-binding protein [Hydrogenophaga sp. PBC]   
. . Hydrogenophaga intermedia..................... 297  2e-93  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate oxidase subunit glcD [Hydrogenophag...   
. . Herbaspirillum frisingense GSF30.............. 259  2e-79  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glycolate oxidase subunit GlcD [Herbaspir...   
. . Curvibacter putative symbiont of Hydra magnipap 199  1e-55  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glycolate oxidase subunit glcD [Curvibacter p...   
. . Hydrogenophaga sp. T4......................... 179  3e-52  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative FAD-linked oxidoreductase [Hydrogenop...   
. . Thiomonas intermedia K12...................... 137  1e-33  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Thiomonas interm...   
. . Achromobacter piechaudii HLE.................. 136  3e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Achromobacter pi...   
. . Achromobacter piechaudii ATCC 43553........... 135  5e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Achromobacter pi...   
. . Alcaligenes sp. EGD-AK7....................... 135  5e-33  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Alcaligenes sp. ...   
. . Alcaligenes faecalis subsp. faecalis NCIB 8687 135  9e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Alcaligenes faec...   
. . Bordetella bronchiseptica 980-2............... 134  2e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Bordetella bronc...   
. . Bordetella bronchiseptica 1289................ 132  7e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative oxidoreductase [Bordetella bronc...   
. . Bordetella bronchiseptica OSU553.............. 132  7e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative glycolate oxidase, subunit GlcD [Bord...   
. . Bordetella bronchiseptica MO149............... 132  7e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative oxidoreductase [Bordetella bronc...   
. . Bordetella.................................... 132  8e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: oxidoreductase [Bordetella parapertussis]      
. . Bordetella holmesii H934...................... 132  8e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative glycolate oxidase, subunit GlcD [Bord...   
. . Bordetella pertussis CS....................... 132  8e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Bordetella pertu...   
. . Bordetella bronchiseptica 345................. 132  8e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative glycolate oxidase, subunit GlcD [Bord...   
. . Bordetella bronchiseptica 253................. 132  8e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: oxidoreductase [Bordetella bronchiseptica]     
. . Bordetella bronchiseptica E013................ 132  9e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative glycolate oxidase, subunit GlcD [Bord...   
. . Achromobacter sp. SY8......................... 131  1e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Achromobacter ar...   
. . Herbaspirillum seropedicae SmR1............... 130  5e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: D-lactate dehydrogenase [Herbaspirillum s...   
. . Thiobacillus denitrificans.................... 383  3e-127 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: FAD-binding protein [Thiobacillus denitri...   
. . Thiobacillus thioparus........................ 382  7e-127 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: FAD-binding protein [Thiobacillus thioparus]   
. . Methyloversatilis universalis................. 381  2e-126 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Methyloversatilis un...   
. . Methyloversatilis sp. NVD..................... 381  3e-126 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Methyloversatilis sp...   
. . Nitrosomonas europaea......................... 380  5e-126 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: FAD-binding protein [Nitrosomonas europaea]    
. . Sulfuricella denitrificans.................... 380  8e-126 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: FAD-binding protein [Sulfuricella denitri...   
. . Nitrosomonas sp. Is79A3....................... 378  2e-125 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: FAD-binding protein [Nitrosomonas sp. Is7...   
. . Rhodocyclaceae................................ 378  4e-125 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: FAD-binding protein [Rhodoc...   
. . Thiobacillus denitrificans ATCC 25259......... 377  4e-125 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: FAD-binding protein [Thiobacillus denitri...   
. . Thauera terpenica............................. 377  7e-125 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Thauera terpenica]        
. . Nitrosomonas eutropha......................... 376  1e-124 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: FAD-binding protein [Nitrosomonas eutropha]    
. . Nitrosospira sp. APG3......................... 375  2e-124 4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: Glycolate dehydrogenase, subunit GlcD [Ni...   
. . Nitrosospira briensis......................... 369  6e-122 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glycolate oxidase subunit GlcD [Nitrososp...   
. . Nitrosospira multiformis...................... 369  9e-122 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: FAD-binding protein [Nitrosospira multifo...   
. . Azoarcus toluclasticus........................ 369  9e-122 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Azoarcus toluclasticus]   
. . Microvirgula aerodenitrificans................ 368  3e-121 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glycolate oxidase subunit GlcD [Microvirg...   
. . Nitrosomonas sp. AL212........................ 367  5e-121 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: FAD-binding protein [Nitrosomonas sp. AL212]   
. . Ferrovum myxofaciens.......................... 367  6e-121 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: glycolate oxidase subunit GlcD [Ferrovum ...   
. . Tepidiphilus margaritifer..................... 366  1e-120 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: glycolate oxidase subunit GlcD [Tepidiphi...   
. . Aromatoleum aromaticum........................ 365  4e-120 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Aromatoleum aromaticum]   
. . Azoarcus sp. KH32C............................ 362  6e-119 6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: glycolate oxidase (FAD-linked subunit) ox...   
. . Sideroxydans lithotrophicus................... 361  1e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: FAD-binding protein [Sideroxydans lithotr...   
. . Thauera phenylacetica......................... 359  8e-118 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD linked oxidase [Thauera phenylacetica]     
. . Thauera aminoaromatica........................ 358  3e-117 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD linked oxidase [Thauera aminoaromatica]    
. . Thauera sp. MZ1T.............................. 358  4e-117 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Thauera sp. MZ1T]         
. . Thauera sp. 63................................ 355  2e-116 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: glycolate oxidase subunit GlcD [Thauera s...   
. . Thauera sp. 28................................ 353  2e-115 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD linked oxidase [Thauera sp. 28]            
. . Thauera sp. 27................................ 353  2e-115 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD linked oxidase [Thauera sp. 27]            
. . Candidatus Accumulibacter sp. SK-11........... 353  2e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . beta proteobacterium SCGC AAA027-K21.......... 352  7e-115 2 hits  Bacteria:Proteobacteria:Betaproteobacteria: glycolate oxidase subunit GlcD [beta prot...   
. . Candidatus Accumulibacter sp. SK-01........... 352  7e-115 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . Dechloromonas aromatica....................... 350  2e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Dechloromonas aromat...   
. . Candidatus Accumulibacter sp. BA-94........... 349  5e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . Candidatus Accumulibacter sp. SK-02........... 349  7e-114 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . Betaproteobacteria bacterium MOLA814.......... 348  2e-113 2 hits  Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Betap...   
. . Azonexus hydrophilus.......................... 347  2e-113 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: glycolate oxidase subunit GlcD [Azonexus ...   
. . Candidatus Accumulibacter sp. BA-92........... 345  1e-112 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . Azoarcus sp. BH72............................. 345  2e-112 3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Azoarcus sp. BH72]        
. . Candidatus Accumulibacter sp. BA-93........... 343  1e-111 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . Candidatus Accumulibacter phosphatis.......... 341  8e-111 2 hits  Bacteria:Proteobacteria:Betaproteobacteria: FAD-binding protein [Candidatus Accumulib...   
. . Candidatus Accumulibacter sp. SK-12........... 337  4e-109 2 hits  Bacteria:Proteobacteria:Betaproteobacteria: putative FAD-linked oxidoreductase [Candidatus...   
. . Azospira oryzae............................... 332  2e-107 2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD-binding protein [Azospira oryzae]          
. . beta proteobacterium SCGC AAA027-C02.......... 332  4e-107 1 hit   Bacteria:Proteobacteria:Betaproteobacteria: glycolate oxidase subunit GlcD [beta prot...   
. . Neisseria shayeganii.......................... 325  2e-104 1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: FAD-binding protein [Neisseria shayeganii]     
. . beta proteobacterium CB....................... 316  6e-101 3 hits  Bacteria:Proteobacteria:Betaproteobacteria: D-lactate dehydrogenase (Cytochrome) [bet...   
. . Sulfuritalea hydrogenivorans sk43H............ 312  2e-99  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: FAD/FMN-dependent dehydrogenase [Sulfuritalea...   
. . Vitreoscilla stercoraria...................... 307  1e-97  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Vitreoscilla sterco...   
. . Neisseria elongata............................ 280  4e-87  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: FAD-binding protein [Neisseria elongata]       
. . Neisseria weaveri............................. 271  9e-84  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: FAD-binding protein [Neisseria weaveri]        
. . Neisseria weaveri LMG 5135.................... 270  3e-83  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: FAD-binding protein [Neisseria weaveri]        
. . Nitrosospira multiformis ATCC 25196........... 155  8e-40  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: dimethylmenaquinone methyltransferase [Ni...   
. . Sulfuricella denitrificans skB26.............. 148  2e-37  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: dimethylmenaquinone methyltransferase [Su...   
. . Nitrosomonas cryotolerans..................... 146  9e-37  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: dimethylmenaquinone methyltransferase [Ni...   
. . Methylotenera sp. 1P/1........................ 145  3e-36  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: dimethylmenaquinone methyltransferase [Me...   
. . Nitrosomonas europaea ATCC 19718.............. 144  6e-36  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: dimethylmenaquinone methyltransferase [Ni...   
. . Methylophilaceae bacterium 11................. 144  6e-36  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: dimethylmenaquinone methyltransferase [Me...   
. . Nitrosomonas eutropha C91..................... 143  8e-36  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: dimethylmenaquinone methyltransferase [Ni...   
. . Methylotenera versatilis...................... 142  2e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: dimethylmenaquinone methyltransferase [Me...   
. . Methylotenera mobilis......................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: dimethylmenaquinone methyltransferase [Me...   
. . Dechlorosoma suillum PS....................... 134  2e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: 2-hydroxy-acid oxidase [Azospira oryzae]       
. . Laribacter hongkongensis...................... 133  3e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: D-lactate dehydrogenase [Laribacter hongk...   
. . Candidatus Accumulibacter phosphatis clade IIA  131  1e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria: 2-hydroxy-acid oxidase [Candidatus Accumu...   
. . Dechloromonas agitata......................... 130  3e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: 2-hydroxy-acid oxidase [Dechloromonas agi...   
. . Mariprofundus ferrooxydans.................... 379  1e-125 2 hits  Bacteria:Proteobacteria:Zetaproteobacteria:Mariprofundales: FAD-binding protein [Mariprofundus ferroo...   
. . Rhodopseudomonas palustris.................... 368  2e-121 7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas pal...   
. . Rhodopseudomonas palustris BisB5.............. 365  3e-120 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas pal...   
. . Rhodopseudomonas palustris DX-1............... 364  7e-120 4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas pal...   
. . Rhodopseudomonas palustris HaA2............... 364  1e-119 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas pal...   
. . Rhodopseudomonas palustris BisB18............. 359  7e-118 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas pal...   
. . Rhodopseudomonas palustris BisA53............. 337  5e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas pal...   
. . Rhodopseudomonas sp. B29...................... 191  3e-54  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodopseudomonas sp....   
. . Nitrobacter winogradskyi...................... 360  5e-118 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Nitrobacter winograd...   
. . Nitrobacter sp. Nb-311A....................... 356  1e-116 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Nitrobacter sp. Nb-3...   
. . Bradyrhizobium sp. Cp5.3...................... 354  9e-116 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. WSM1743.................... 353  3e-115 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bosea sp. 117................................. 350  3e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bosea sp....   
. . Afipia felis.................................. 343  2e-111 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Afipia f...   
. . Bradyrhizobium sp. ARR65...................... 342  3e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium elkanii........................ 342  6e-111 5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. URHD0069................... 341  7e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Afipia sp. 1NLS2.............................. 340  3e-110 5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Afipia sp. 1NLS2]         
. . Bradyrhizobium sp. Ai1a-2..................... 339  5e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. ORS 278.................... 338  8e-110 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. O...   
. . Bradyrhizobium sp. BTAi1...................... 338  9e-110 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. B...   
. . Bradyrhizobium sp. S23321..................... 338  1e-109 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. S...   
. . Bradyrhizobium sp. ORS 285.................... 338  2e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. O...   
. . Bradyrhizobium sp. Tv2a-2..................... 338  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. WSM2254.................... 338  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. STM 3809................... 338  2e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. S...   
. . Bradyrhizobium sp. URHA0013................... 338  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. ORS 375.................... 338  2e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. O...   
. . Bradyrhizobium sp. URHA0002................... 337  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. WSM1417.................... 337  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Agromonas oligotrophica....................... 337  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Bradyrhi...   
. . Bradyrhizobium japonicum...................... 337  2e-109 10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. WSM1253.................... 337  2e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. W...   
. . Bradyrhizobium diazoefficiens................. 337  4e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium diazo...   
. . Bradyrhizobium diazoefficiens SEMIA 5080...... 337  4e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. STM 3843................... 337  4e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. S...   
. . Bradyrhizobium sp. DOA9....................... 337  5e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. WSM471..................... 336  9e-109 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium sp. W...   
. . Bradyrhizobium sp. Ec3.3...................... 335  1e-108 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium sp. WSM3983.................... 335  2e-108 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium japonicum USDA 6............... 335  2e-108 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium japon...   
. . Bradyrhizobium................................ 333  7e-108 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: glycolate oxidase subunit G...   
. . Bradyrhizobium sp. OHSU_III................... 333  1e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobium japonicum WSM2793.............. 333  1e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobium japon...   
. . Nitrobacter hamburgensis...................... 332  5e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Nitrobacter hamburge...   
. . Afipia clevelandensis......................... 331  6e-107 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Afipia c...   
. . Bradyrhizobium sp. DFCI-1..................... 331  8e-107 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Bradyrhi...   
. . Afipia sp. Bat1............................... 331  9e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Afipia sp. P52-10]             
. . Bradyrhizobium sp. th.b2...................... 330  1e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Bradyrhiz...   
. . Bradyrhizobiaceae bacterium SG-6C............. 329  5e-106 4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Bradyrhizobiaceae ba...   
. . Afipia........................................ 328  7e-106 4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: glycolate oxidase subunit G...   
. . Afipia broomeae............................... 328  8e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Afipia b...   
. . Oligotropha carboxidovorans................... 325  1e-104 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Oligotropha carboxid...   
. . Bradyrhizobium sp. CCGE-LA001................. 295  5e-96  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit [Bradyrhizobium sp. ...   
. . Afipia clevelandensis ATCC 49720.............. 273  1e-84  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Afipia c...   
. . Salinarimonas rosea........................... 259  4e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Salinarim...   
. . Bradyrhizobiaceae............................. 257  3e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Bradyr...   
. . Afipia felis ATCC 53690....................... 248  6e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Afipia]     
. . Bosea sp. LC85................................ 238  3e-71  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glycolate oxidase, subunit GlcD [Bosea sp. LC85]    
. . Methylocella silvestris....................... 352  5e-115 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylocella silvest...   
. . Beijerinckia indica........................... 352  6e-115 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Beijerinckia indica]      
. . Xanthobacter sp. 91........................... 349  7e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Xanthobac...   
. . Xanthobacter autotrophicus.................... 349  9e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Xanthobacter autotro...   
. . Xanthobacter sp. 126.......................... 349  1e-113 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Xanthobac...   
. . Phyllobacterium sp. YR531..................... 345  3e-112 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Phyllobacterium sp. ...   
. . Phyllobacterium sp. UNC302MFCol5.2............ 344  4e-112 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Phyllobac...   
. . Nitratireductor aquibiodomus.................. 344  5e-112 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Nitratireductor aqui...   
. . Nitratireductor pacificus..................... 343  2e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Nitratireductor paci...   
. . Aurantimonas ureilytica....................... 343  2e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Aureimonas ureilytica]    
. . Azorhizobium caulinodans...................... 343  3e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Azorhizobium caulino...   
. . Aurantimonas manganoxydans.................... 342  5e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Aurantimonas mangano...   
. . Amorphus coralli.............................. 341  1e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Amorphus coralli]         
. . Aurantimonas coralicida....................... 341  1e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Aurantimo...   
. . Nitratireductor basaltis...................... 341  1e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD linked oxidase-like protein [Nitratireduct...   
. . Nitratireductor indicus....................... 340  3e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Nitratireductor indi...   
. . Aliihoeflea sp. 2WW........................... 339  6e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Aliihoefl...   
. . Chelativorans sp. J32......................... 339  6e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Chelativo...   
. . Aquamicrobium defluvii........................ 338  9e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Aquamicrobium ...   
. . Fulvimarina pelagi............................ 338  2e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Fulvimarina pelagi]       
. . Chelativorans sp. BNC1........................ 337  2e-109 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Chelativorans sp. BNC1]   
. . Bradyrhizobium sp. WSM4349.................... 337  3e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. WS...   
. . Mesorhizobium sp. URHA0056.................... 333  7e-108 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Pseudaminobacter salicylatoxidans............. 332  2e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Pseudaminobacter sal...   
. . Mesorhizobium sp. LNHC232B00.................. 331  8e-107 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LNHC232...   
. . Hoeflea sp. 108............................... 331  8e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Hoeflea sp. 108]          
. . Mesorhizobium sp. L2C067A000.................. 330  1e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. L2...   
. . Ochrobactrum sp. EGD-AQ16..................... 330  1e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Ochrobactrum sp. EG...   
. . Mesorhizobium loti............................ 330  1e-106 6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium loti]       
. . Mesorhizobium australicum..................... 330  1e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium austra...   
. . Mesorhizobium sp. LNHC229A00.................. 330  2e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium sp. URHC0008.................... 330  2e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Mesorhizobium sp. LNHC220B00.................. 330  2e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium sp. LNHC209A00.................. 330  2e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium opportunistum................... 330  2e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium opport...   
. . Mesorhizobium huakuii 7653R................... 330  2e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD binding domain protein [Mesorhizobium huak...   
. . Mesorhizobium sp. LSJC285A00.................. 330  2e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Methylocapsa acidiphila....................... 329  3e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methyloca...   
. . Mesorhizobium loti R7A........................ 329  3e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Mesorhizobium plurifarium..................... 329  3e-106 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Mesorhizobiu...   
. . Mesorhizobium sp. ORS3359..................... 329  4e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Mesorhizobiu...   
. . Mesorhizobium sp. L103C120A0.................. 329  4e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. L1...   
. . Mesorhizobium sp. LSHC412B00.................. 329  4e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Mesorhizobium sp. LNHC221B00.................. 329  4e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium................................. 329  5e-106 7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Mesorh...   
. . Mesorhizobium sp. LSJC265A00.................. 329  5e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Mesorh...   
. . Mesorhizobium sp. LNJC398B00.................. 328  6e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium sp. LNHC252B00.................. 328  6e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium sp. LSJC269B00.................. 328  6e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Mesorh...   
. . Mesorhizobium sp. L2C084A000.................. 328  7e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Mesorh...   
. . Mesorhizobium ciceri biovar biserrulae WSM1271 328  7e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Mesorh...   
. . Mesorhizobium metallidurans................... 328  8e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Mesorhiz...   
. . Ochrobactrum anthropi......................... 328  8e-106 5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Ochrobactrum anthropi]    
. . Mesorhizobium sp. LSHC422A00.................. 328  8e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Mesorhizobium sp. LNJC395A00.................. 328  8e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Mesorhizobium sp. LNJC391B00.................. 328  8e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Ochrobactrum sp. UNC390CL2Tsu3S39............. 328  9e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Ochrobact...   
. . Mesorhizobium sp. WSM3224..................... 328  1e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Mesorhizobium sp. LNJC403B00.................. 328  1e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LN...   
. . Aminobacter sp. J41........................... 328  1e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Aminobact...   
. . Mesorhizobium amorphae........................ 328  1e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium amorphae]   
. . Mesorhizobium metallidurans STM 4661.......... 328  1e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Mesorhiz...   
. . Mesorhizobium sp. LSHC440B00.................. 328  1e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Mesorhizobium alhagi.......................... 328  2e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium alhagi]     
. . Mesorhizobium sp. LSJC268A00.................. 328  2e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Mesorhizobium sp. SOD10....................... 327  2e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit, FAD-linked [Mesorh...   
. . Mesorhizobium sp. L48C026A00.................. 327  3e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. L4...   
. . Ochrobactrum intermedium...................... 327  3e-105 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Ochrobactrum interme...   
. . Mesorhizobium sp. WSM2561..................... 327  3e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Ochrobactrum intermedium M86.................. 327  3e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: D-lactate dehydrogenase [Ochrobactrum int...   
. . Mesorhizobium sp. LSHC440A00.................. 327  3e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Mesorhizobium ciceri.......................... 327  3e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Mesorhizobium sp. LSJC264A00.................. 327  3e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Mesorh...   
. . Mesorhizobium sp. ORS3324..................... 327  4e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Mesorhizobiu...   
. . Mesorhizobium sp. L103C119B0.................. 327  4e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. L1...   
. . Ochrobactrum sp. CDB2......................... 327  4e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: D-lactate dehydrogenase [Ochrobactrum sp....   
. . Mesorhizobium sp. LSJC280B00.................. 327  4e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Mesorhizobium sp. WSM3626..................... 326  6e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Mesorhizo...   
. . Mesorhizobium sp. L2C054A000.................. 326  7e-105 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. L2...   
. . Ochrobactrum rhizosphaerae.................... 326  8e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Ochrobact...   
. . Brucella inopinata............................ 325  9e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Brucella inopinata]       
. . Mesorhizobium sp. LSHC420B00.................. 324  3e-104 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Mesorhizobium sp. LS...   
. . Brucella abortus str. 2308 A.................. 324  9e-104 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: (S)-2-hydroxy-acid oxidase chain D [Brucella a...   
. . Brucella...................................... 323  7e-104 4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Brucella]   
. . Brucella suis 1330............................ 323  8e-104 6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Brucella]   
. . Brucella abortus.............................. 323  8e-104 13 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Brucella abortus]         
. . Brucella melitensis........................... 323  8e-104 7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Brucella melitensis]      
. . Brucella suis................................. 323  9e-104 12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Brucella suis]            
. . Brucella suis F7/06-5......................... 323  9e-104 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Brucella...   
. . Brucella suis bv. 3 str. 686.................. 323  9e-104 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Brucella suis]            
. . Brucella melitensis ADMAS-G1.................. 323  1e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Brucella melitensis]     
. . Brucella melitensis bv. 1 str. 16M............ 323  2e-103 4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Brucella melitensis]      
. . Brucella melitensis B115...................... 322  2e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Brucella...   
. . Brucella abortus 63/168....................... 322  3e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Brucella...   
. . Brucella abortus 63/294....................... 322  3e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Brucella...   
. . Azorhizobium doebereinerae.................... 322  3e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Azorhizob...   
. . Brucella canis ATCC 23365..................... 322  3e-103 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Brucella]   
. . Brucella abortus 88/217....................... 322  3e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Brucella...   
. . Starkeya novella.............................. 321  7e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Starkeya novella]         
. . Brucella sp. NVSL 07-0026..................... 321  8e-103 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase [Brucella sp. NVSL 07-0026]       
. . Brucella suis 63/252.......................... 320  8e-103 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase, subunit GlcD [Brucella...   
. . Xanthobacteraceae............................. 320  1e-102 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Xantho...   
. . Methylosinus sp. LW3.......................... 317  3e-101 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methylosi...   
. . Methylocystis sp. LW5......................... 316  6e-101 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methylocy...   
. . Methylosinus trichosporium.................... 316  6e-101 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylosinus trichos...   
. . Methylocystis sp. SB2......................... 314  3e-100 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methylocy...   
. . Methylocystis rosea........................... 313  4e-100 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylocystis rosea]      
. . Ochrobactrum intermedium 229E................. 313  6e-100 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Ochrobactrum interme...   
. . Methylocystis sp. SC2......................... 311  3e-99  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylocystis sp. SC2]    
. . Methylocystis parvus.......................... 310  2e-98  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylocystis parvus]     
. . Afifella pfennigii............................ 307  1e-97  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Afifella ...   
. . Chelatococcus sp. GW1......................... 278  1e-86  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Chelatoco...   
. . Rhizobium selenitireducens.................... 272  2e-84  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium...   
. . Ensifer sp. TW10.............................. 271  6e-84  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Ensifer s...   
. . Microvirga lotononidis........................ 271  7e-84  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Microvirga lotononidis]   
. . Sinorhizobium fredii.......................... 271  1e-83  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium fredii]     
. . Agrobacterium vitis........................... 270  2e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium vitis]      
. . Rhizobium/Agrobacterium group................. 270  2e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Rhizob...   
. . Ensifer sp. WSM1721........................... 270  2e-83  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Sinorhizo...   
. . Sinorhizobium fredii HH103.................... 270  2e-83  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium fredii]     
. . Kaistia granuli............................... 270  3e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Kaistia granuli]          
. . Kaistia adipata............................... 269  4e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Kaistia a...   
. . Rhizobium etli................................ 269  4e-83  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium etli]           
. . Rhizobium etli CFN 42......................... 269  5e-83  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium etli]           
. . Rhizobium leguminosarum bv. phaseoli CCGM1.... 269  5e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit D [Rhizobium legumin...   
. . Rhizobium etli bv. mimosae str. IE4771........ 269  6e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium etli...   
. . Methylobacterium.............................. 269  6e-83  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Methyl...   
. . Rhizobium tropici............................. 269  7e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit D protein [Rhiz...   
. . Rhizobium etli CNPAF512....................... 269  1e-82  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase protein, subunit D [Rhizobiu...   
. . Hoeflea sp. BAL378............................ 269  1e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Hoeflea sp. BA...   
. . Rhizobium phaseoli............................ 268  7e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium phaseoli]       
. . Microvirga flocculans......................... 268  2e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Microvirg...   
. . Rhizobium sp. MGL06........................... 268  2e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium...   
. . Hoeflea phototrophica......................... 268  2e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Hoeflea phototrophica]    
. . Ensifer adhaerens............................. 267  2e-82  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Ensifer a...   
. . Sinorhizobium arboris......................... 267  3e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Sinorhizo...   
. . Agrobacterium albertimagni.................... 267  3e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium albert...   
. . Rhizobium..................................... 266  4e-82  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Rhizob...   
. . Rhizobium mongolense.......................... 266  4e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium mongolense]     
. . Rhizobium sp. OR191........................... 266  4e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium...   
. . Rhizobium leguminosarum....................... 266  5e-82  22 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Microvirga sp. BSC39.......................... 266  6e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Microvirga sp....   
. . Rhizobium sp. CF142........................... 266  6e-82  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. CF142]      
. . Hyphomicrobium nitrativorans.................. 266  8e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Hyphomicrobium nitra...   
. . Sinorhizobium medicae......................... 266  9e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium medicae]    
. . Rhizobium sp. CCGE 510........................ 266  1e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. CCGE 510]   
. . Methylobacterium nodulans..................... 265  1e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium nod...   
. . Rhizobium sp. R1-200B2........................ 265  1e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium sp. ...   
. . Sinorhizobium................................. 265  1e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Sinorh...   
. . Sinorhizobium fredii USDA 257................. 265  2e-81  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium fredii]     
. . Rhizobium freirei............................. 265  2e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative glycolate oxidase subunit [Rhizo...   
. . Rhizobium sp. CF122........................... 265  3e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. CF122]      
. . Rhizobium leguminosarum bv. trifolii WSM1689.. 265  3e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosarum b...   
. . Sinorhizobium americanum CCGM7................ 264  3e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit D [Sinorhizobium ame...   
. . Rhizobium grahamii............................ 264  3e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit D [Rhizobium gr...   
. . Rhizobium sp. 2MFCol3.1....................... 264  4e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. 2MFCol...   
. . Rhizobium leguminosarum bv. trifolii WSM597... 264  5e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Rhizobium leguminosarum bv. trifolii WSM2297.. 264  5e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Rhizobium leguminosarum bv. trifolii WSM2304.. 264  5e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Rhizobium leguminosarum bv. viciae WSM1455.... 264  6e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Rhizobium leguminosarum bv. trifolii WSM1325.. 263  8e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Sinorhizobium meliloti........................ 263  9e-81  7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Sinorhizo...   
. . Sinorhizobium meliloti 1021................... 262  2e-80  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium meliloti]   
. . Sinorhizobium meliloti CCNWSX0020............. 262  2e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium meliloti]   
. . Sinorhizobium meliloti Rm41................... 262  2e-80  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium meliloti]   
. . Rhizobium leguminosarum bv. viciae 3841....... 262  3e-80  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Rhizobium leguminosarum bv. trifolii CB782.... 262  3e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosarum b...   
. . Rhizobium sp.................................. 261  6e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glycolate oxidase subunit glcD [Rhizobium sp.]     
. . Sinorhizobium fredii NGR234................... 261  7e-80  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Sinorhizobium fredii]     
. . Ensifer sp. BR816............................. 261  7e-80  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Ensifer s...   
. . Hyphomicrobium zavarzinii..................... 261  1e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Hyphomicrobium zava...   
. . Neorhizobium galegae bv. officinalis bv. offici 260  1e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glycolate oxidase, subunit GlcD [Rhizobium ga...   
. . Rhizobium sp. PDO-076......................... 260  1e-79  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. PDO1-076]   
. . Ensifer sp. USDA 6670......................... 259  2e-79  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Ensifer s...   
. . Rhizobium leguminosarum bv. trifolii WSM2012.. 259  3e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium leguminosa...   
. . Rhizobium sp. CF080........................... 259  3e-79  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. CF080]      
. . Rhizobium etli bv. mimosae str. Mim1.......... 259  3e-79  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD 2 [Rhizobi...   
. . Rhizobium mesoamericanum...................... 259  3e-79  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium...   
. . Neorhizobium galegae bv. orientalis str. HAMBI  258  7e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glycolate oxidase, subunit GlcD [Rhizobium ga...   
. . Beijerinckiaceae bacterium SOP9............... 257  1e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methylofe...   
. . Rhizobium mesoamericanum STM3625.............. 257  2e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium mesoameric...   
. . Shinella zoogloeoides DD12.................... 257  3e-78  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Shinella ...   
. . Agrobacterium larrymoorei..................... 256  3e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Agrobacte...   
. . Rhizobium sp. YS-1r........................... 256  5e-78  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium sp. ...   
. . Rhizobium rubi NBRC 13261..................... 254  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium rub...   
. . Hyphomicrobium................................ 254  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Hyphom...   
. . Martelella sp. AD-3........................... 254  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Martelell...   
. . Methylobacterium sp. 10....................... 253  8e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methyloba...   
. . Agrobacterium tumefaciens LBA4213 (Ach5)...... 253  8e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate dehydrogenase [Agrobacterium tumefac...   
. . Agrobacterium tumefaciens..................... 253  9e-77  9 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Agrobacte...   
. . Agrobacterium sp. 10MFCol1.1.................. 253  1e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium sp. 10...   
. . Agrobacterium tumefaciens 5A.................. 253  1e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium tumefa...   
. . Agrobacterium sp. H13-3....................... 252  1e-76  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium sp. H1...   
. . Agrobacterium tumefaciens F2.................. 251  2e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium tumefa...   
. . Methylobacterium sp. 88A...................... 251  3e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium sp....   
. . Methylobacterium sp. 77....................... 251  3e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium sp....   
. . Meganema perideroedes......................... 251  3e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Meganema perideroedes]   
. . Agrobacterium................................. 251  5e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Agroba...   
. . Agrobacterium tumefaciens CCNWGS0286.......... 250  7e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium tumefa...   
. . Rhizobium sp. IRBG74.......................... 250  8e-76  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhizobium sp. IRBG74]     
. . Agrobacterium sp. Cherry 2E-2-2............... 250  1e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit [Agrobacterium ...   
. . Rhodomicrobium vannielii...................... 250  1e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Rhodomicrobium vanni...   
. . Agrobacterium fabrum.......................... 249  1e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium fabrum]     
. . Martelella mediterranea....................... 249  1e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Martelella mediterra...   
. . Methylobacterium radiotolerans JCM 2831....... 249  1e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: FAD-binding protein [Methyl...   
. . Rhodomicrobium sp. JA643...................... 249  2e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhodomicrobium...   
. . Methylobacterium sp. GXF4..................... 249  2e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium sp....   
. . Agrobacterium tumefaciens GW4................. 249  2e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Agrobacte...   
. . Agrobacterium sp. ATCC 31749.................. 249  2e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium sp. AT...   
. . Methylobacterium sp. EUR3 AL-11............... 249  2e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methyloba...   
. . Rhizobium sp. H41............................. 249  3e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Rhizobium sp. ...   
. . Agrobacterium radiobacter DSM 30147........... 249  3e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Agrobacterium radiobacter...   
. . Methylobacterium oryzae CBMB20................ 248  4e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD linked oxidase domain-containing protein [...   
. . Rhizobium sp. NT-26........................... 248  9e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Putative glycolate oxidase subunit GlcD; FAD-...   
. . Methylobacterium mesophilicum................. 247  2e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD linked oxidase domain-containing prot...   
. . Methylobacterium populi....................... 246  2e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium pop...   
. . Methylobacterium extorquens................... 246  2e-74  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium ext...   
. . Methylobacterium sp. MB200.................... 246  2e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glycolate oxidase subunit GlcD [Methyloba...   
. . Methylobacterium sp. 285MFTsu5.1.............. 246  2e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium sp....   
. . Methylobacterium chloromethanicum CM4......... 246  3e-74  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium ext...   
. . Methylobacterium extorquens PA1............... 246  3e-74  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium ext...   
. . Methylobacterium extorquens AM1............... 246  4e-74  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylobacterium ext...   
. . Lutibaculum baratangense...................... 244  1e-73  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glycolate dehydrogenase, subunit GlcD [Lu...   
. . Methylopila sp. 73B........................... 240  5e-72  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Methylopila sp. 73B]     
. . Methylopila sp. M107.......................... 240  6e-72  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Methylopila sp. M107]     
. . Hyphomicrobium denitrificans.................. 238  4e-71  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Hyphomicrobium denit...   
. . Hyphomicrobium denitrificans ATCC 51888....... 234  1e-69  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: FAD-binding protein [Hyphomicrobium denit...   
. . Rhizobium sp. Pop5............................ 129  1e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: D-lactate dehydrogenase [Rhizobium sp. Pop5]   
. . Kiloniella laminariae......................... 366  2e-120 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Kiloniellales: FAD-binding protein [Kiloniella laminariae]    
. . Sphingobium sp. SYK-6......................... 365  3e-120 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: FAD-binding protein [Sphingobium sp. SYK-6]    
. . Sphingomonas wittichii........................ 362  4e-119 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: FAD-binding protein [Sphingomonas wittichii]   
. . Sphingomonas sp. DC-6......................... 362  4e-119 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: glycolate oxidase subunit GlcD [Sphingomo...   
. . Sphingomonas wittichii RW1.................... 362  5e-119 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: FAD-binding protein [Sphingomonas wittichii]   
. . Sphingomonas sp. YL-JM2C...................... 362  5e-119 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: glycolate oxidase subunit GlcD [Sphingomo...   
. . Sphingomonas sp. KC8.......................... 362  5e-119 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: FAD-binding protein [Sphingomonas sp. KC8]     
. . Ahrensia sp. R2A130........................... 360  2e-118 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ahrensia sp. R2A130]      
. . Novosphingobium pentaromativorans US6-1....... 360  5e-118 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: glycolate oxidase subunit GlcD [Novosphingobiu...   
. . Novosphingobium pentaromativorans............. 360  2e-117 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: FAD-binding protein [Novosphingobium pent...   
. . Geminicoccus roseus........................... 357  3e-117 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [Geminicoc...   
. . Sphingobium sp. DC-2.......................... 357  3e-117 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: glycolate oxidase subunit GlcD [Sphingobi...   
. . Acidocella facilis............................ 355  2e-116 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Acidocell...   
. . Inquilinus limosus............................ 355  3e-116 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Inquilinu...   
. . Pannonibacter phragmitetus.................... 354  5e-116 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Pannonibacter phragm...   
. . Labrenzia aggregata........................... 354  8e-116 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Labrenzia aggregata]      
. . Acidocella sp. MX-AZ02........................ 354  8e-116 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Acidocella sp. MX-AZ02]   
. . Rhodovibrio salinarum......................... 353  2e-115 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Rhodovibr...   
. . Oceanibaculum indicum......................... 351  1e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Oceanibaculum indicum]    
. . alpha proteobacterium BAL199.................. 351  1e-114 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [alpha proteobacteriu...   
. . Fodinicurvata fenggangensis................... 350  2e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Fodinicur...   
. . Labrenzia..................................... 350  2e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: MULTISPECIES: glycolate oxidase subunit G...   
. . Labrenzia sp. C1B10........................... 350  3e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Labrenzia sp. C1B10]           
. . Fodinicurvata sediminis....................... 350  4e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Fodinicurvata sedimi...   
. . Phenylobacterium zucineum..................... 349  6e-114 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: FAD-binding protein [Phenylobacterium zuc...   
. . Caenispirillum salinarum...................... 347  5e-113 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Glycolate dehydrogenase , subunit GlcD [C...   
. . Dongia sp. URHE0060........................... 346  9e-113 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Dongia sp...   
. . Sneathiella glossodoripedis................... 345  1e-112 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sneathiellales: glycolate oxidase subunit GlcD [Sneathiel...   
. . Skermanella stibiiresistens SB22.............. 345  1e-112 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Skermanella stibiiresiste...   
. . Magnetospira sp. QH-2......................... 344  5e-112 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase, subunit GlcD [Magnetospira...   
. . Tistrella mobilis............................. 343  1e-111 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Tistrella mobilis]        
. . Azospirillum lipoferum........................ 341  7e-111 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Azospirillum lipoferum]   
. . Azospirillum brasilense....................... 341  8e-111 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Azospirillum brasile...   
. . Polymorphum gilvum............................ 341  1e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [Polymorphum gilvum]       
. . Nisaea denitrificans.......................... 340  2e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Nisaea de...   
. . Stappia stellulata............................ 340  3e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Stappia s...   
. . Rhodospirillales bacterium URHD0088........... 339  3e-110 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Rhodospir...   
. . Nesiotobacter exalbescens..................... 337  4e-109 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Nesiotoba...   
. . Novospirillum itersonii....................... 335  1e-108 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Novispirillum iterso...   
. . Roseibium sp. TrichSKD4....................... 335  2e-108 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseibium sp. TrichS...   
. . SAR 116 cluster alpha proteobacterium HIMB100. 335  2e-108 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [SAR116 cluster alpha...   
. . Azospirillum sp. B510......................... 335  2e-108 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Azospirillum lipoferum]   
. . Azospirillum halopraeferens................... 335  3e-108 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Azospiril...   
. . Candidatus Puniceispirillum marinum........... 332  3e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [Candidatus Puniceisp...   
. . alpha proteobacterium SCGC AAA240-E13......... 332  4e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [alpha pro...   
. . Inquilinus limosus MP06....................... 331  6e-107 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Inquilinus lim...   
. . Thalassospira xiamenensis..................... 330  1e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Thalassospira xiamen...   
. . Rhodospirillum centenum....................... 329  3e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Rhodospirillum cente...   
. . Novosphingobium acidiphilum................... 328  5e-106 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: glycolate oxidase subunit GlcD [Novosphin...   
. . Pseudovibrio sp. JE062........................ 328  8e-106 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Pseudovibrio sp. JE062]   
. . Pseudovibrio sp. FO-BEG1...................... 328  1e-105 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Pseudovibrio sp. FO-...   
. . Thalassospira permensis NBRC 106175........... 326  6e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Thalassospira permensis N...   
. . alpha proteobacterium SCGC AAA027-L15......... 326  9e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [alpha pro...   
. . unclassified Alphaproteobacteria (miscellaneous 325  9e-105 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: MULTISPECIES: glycolate oxidase subunit G...   
. . alpha proteobacterium HIMB114................. 325  2e-104 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: FAD-binding protein [alpha proteobacteriu...   
. . alpha proteobacterium SCGC AAA288-G21......... 323  6e-104 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [alpha pro...   
. . alpha proteobacterium SCGC AAA028-D10......... 323  8e-104 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [alpha pro...   
. . alpha proteobacterium SCGC AAA023-L09......... 323  9e-104 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [alpha pro...   
. . Nisaea salexigens............................. 320  2e-102 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Thalassob...   
. . alpha proteobacterium SCGC AB-629-G21......... 319  3e-102 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [alpha proteobacteriu...   
. . Candidatus Pelagibacter sp. IMCC9063.......... 318  1e-101 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: FAD-binding protein [Candidatus Pelagibac...   
. . alpha proteobacterium SCGC AAA280-B11......... 317  3e-101 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [alpha proteobacteriu...   
. . Candidatus Pelagibacter ubique................ 316  4e-101 6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: glycolate oxidase subunit GlcD [Candidatu...   
. . Rhodovulum sp. PH10........................... 316  5e-101 2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodovulum sp. PH10]      
. . alpha proteobacterium HIMB5................... 315  2e-100 3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: FAD-binding protein [alpha proteobacteriu...   
. . Candidatus Pelagibacter ubique HIMB083........ 313  4e-100 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: FAD/FMN-dependent dehydrogenase [Candidat...   
. . Sandarakinorhabdus limnophila................. 313  5e-100 1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: FAD-binding protein [Sandarakinorhabdus l...   
. . Candidatus Pelagibacter ubique HTCC1062....... 311  5e-99  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: FAD-binding protein [Candidatus Pelagibac...   
. . Candidatus Pelagibacter ubique HTCC1002....... 309  3e-98  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: FAD-binding protein [Candidatus Pelagibac...   
. . Sandarakinorhabdus sp. AAP62.................. 309  3e-98  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sandarakinorhabdus ...   
. . Thalassospira lucentensis..................... 298  4e-94  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Thalassospira lucent...   
. . Thalassospira sp. NP3b2....................... 298  5e-94  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Thalassos...   
. . Acetobacter papayae........................... 296  2e-93  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Acetobact...   
. . Thalassospira profundimaris................... 295  6e-93  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Thalassospira profun...   
. . Gluconacetobacter diazotrophicus.............. 294  1e-92  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Gluconacetobacter di...   
. . Gluconacetobacter diazotrophicus PAl 5........ 294  2e-92  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Gluconacetobacter di...   
. . Rubritepida flocculans........................ 285  2e-89  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Rubritepi...   
. . Elioraea tepidiphila.......................... 275  2e-85  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Elioraea tepidiphila]     
. . Roseomonas cervicalis......................... 274  1e-84  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Roseomonas cervicalis]    
. . Acidiphilium angustum......................... 273  1e-84  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Acidiphil...   
. . Roseomonas gilardii........................... 273  2e-84  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glycolate oxidase subunit GlcD [Roseomona...   
. . Roseomonas.................................... 271  1e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: MULTISPECIES: FAD-binding protein [Roseom...   
. . Wenxinia marina............................... 270  1e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Wenxinia marina]          
. . Acidiphilium cryptum.......................... 270  4e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Acidiphilium cryptum]     
. . Acidiphilium multivorum....................... 269  4e-83  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Acidiphilium multivo...   
. . Rhodobacter sp. CACIA14H1..................... 269  4e-83  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sp. CACI...   
. . Acidiphilium sp. PM........................... 269  8e-83  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Acidiphilium sp. PM]      
. . Paracoccus sp. TRP............................ 268  1e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccu...   
. . Ruegeria conchae.............................. 268  2e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ruegeria sp. TW15]        
. . Oceanicola sp. HL-35.......................... 268  2e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Oceanicol...   
. . Acetobacteraceae bacterium AT-5844............ 268  2e-82  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Acetobacteraceae bac...   
. . Paracoccus versutus........................... 267  3e-82  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus ver...   
. . Granulibacter bethesdensis CGDNIH3............ 266  1e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: (S)-2-hydroxy-acid oxidase chain D [Granulibac...   
. . Paracoccus pantotrophus....................... 265  2e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccu...   
. . Paracoccus.................................... 265  2e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: MULTISPECIES: glycolate oxidase subunit G...   
. . Granulibacter bethesdensis CGDNIH2............ 265  2e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: (S)-2-hydroxy-acid oxidase chain D [Granulibac...   
. . Granulibacter bethesdensis.................... 265  2e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: FAD-binding protein [Granulibacter bethes...   
. . Paracoccus denitrificans...................... 265  2e-81  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Paracoccus denitrifi...   
. . Rhodobacteraceae bacterium KLH11.............. 263  7e-81  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacteraceae bac...   
. . Ruegeria pomeroyi............................. 263  2e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ruegeria pomeroyi]        
. . Rhodovulum sp. NI22........................... 262  2e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Rhodovulum sp....   
. . Actibacterium mucosum KCTC 23349.............. 262  2e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: glycolate oxidase subunit GlcD [Actibacterium ...   
. . Oceanibulbus indolifex........................ 262  2e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Oceanibulbus indolifex]   
. . Thalassiobium sp. R2A62....................... 262  2e-80  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Thalassiobium sp. R2...   
. . Paracoccus aminophilus........................ 262  3e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase [Paracoccus aminophilus]     
. . Maritimibacter alkaliphilus................... 261  4e-80  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Maritimibacter alkal...   
. . Thalassobacter stenotrophicus................. 261  5e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Thalassobacter...   
. . Ruegeria lacuscaerulensis..................... 261  6e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ruegeria lacuscaerul...   
. . Octadecabacter antarcticus.................... 261  6e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Octadecabacter antar...   
. . Rhodobacter sp. SW2........................... 261  7e-80  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sp. SW2]      
. . Oceanicola nanhaiensis........................ 261  9e-80  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Oceanicol...   
. . Paracoccus halophilus......................... 260  2e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus hal...   
. . Paracoccus zeaxanthinifaciens................. 259  2e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Paracoccus zeaxanthi...   
. . Rhodobacteraceae bacterium PD-2............... 259  3e-79  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacteraceae bac...   
. . Rhodobacter sphaeroides....................... 259  3e-79  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sphaeroi...   
. . Sulfitobacter donghicola...................... 258  7e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Celeribacter baekdonensis..................... 258  7e-79  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Celeribacter baekdon...   
. . Silicibacter sp. TrichCH4B.................... 258  9e-79  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Silicibacter sp. Tri...   
. . Oceanicola sp. 22II-S11g...................... 258  1e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Oceanicola sp....   
. . Candidatus Planktomarina temperata RCA23...... 258  2e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Candidatus Pla...   
. . Ahrensia sp. 13_GOM-1096m..................... 257  2e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Ahrensia ...   
. . Loktanella cinnabarina........................ 257  2e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate dehydrogenase, subunit glcD [Lo...   
. . Roseobacter sp. AzwK-3b....................... 257  2e-78  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter sp. AzwK...   
. . Roseivivax halodurans JCM 10272............... 257  3e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseivivax halodurans JCM...   
. . Oceaniovalibus guishaninsula.................. 256  3e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [Oceaniovalibus guish...   
. . Phaeobacter gallaeciensis..................... 256  3e-78  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Phaeobacter gallaeci...   
. . Octadecabacter arcticus....................... 256  3e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Octadecabacter arcti...   
. . Thioclava pacifica DSM 10166.................. 256  4e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Thioclava pacifica DSM 10...   
. . Roseovarius nubinhibens....................... 256  5e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseovarius nubinhib...   
. . Loktanella vestfoldensis...................... 256  6e-78  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Loktanell...   
. . Sulfitobacter sp. MM-124...................... 256  7e-78  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Loktanella hongkongensis...................... 255  9e-78  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Loktanella hongkonge...   
. . Ruegeria sp. TM1040........................... 255  9e-78  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ruegeria sp. TM1040]      
. . Sulfitobacter mediterraneus................... 255  9e-78  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Sulfitobacter sp. 20_GPM-1509m................ 255  1e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Sulfitobacter sp. H3.......................... 255  1e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitobacter ...   
. . Sediminimonas qiaohouensis.................... 255  1e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sediminim...   
. . Ahrensia kielensis............................ 255  1e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ahrensia kielensis]       
. . Ruegeria sp. R11.............................. 255  1e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Ruegeria sp. R11]         
. . Donghicola xiamenensis........................ 255  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Donghicol...   
. . Thioclava sp. DT23-4.......................... 254  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Thioclava sp. DT23-4]          
. . Sulfitobacter guttiformis..................... 254  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Leisingera methylohalidivorans................ 254  2e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Leisingera methyloha...   
. . Roseobacter sp. MED193........................ 254  2e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter sp. MED193]   
. . Loktanella vestfoldensis SKA53................ 254  3e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Loktanella vestfolde...   
. . Roseivivax sp. 22II-s10s...................... 254  4e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD linked oxidase domain-containing protein [...   
. . Catellibacterium nectariphilum................ 254  4e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Catelliba...   
. . Pelagibaca bermudensis........................ 254  4e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Pelagibaca bermudensis]   
. . Sagittula stellata............................ 254  4e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Sagittula stellata]       
. . Rhodobacteraceae bacterium HTCC2150........... 254  4e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacteraceae bac...   
. . alpha proteobacterium SCGC AAA015-O19......... 253  5e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [alpha proteobacteriu...   
. . Sulfitobacter sp. NB-77....................... 253  5e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Phaeobacter caeruleus......................... 253  5e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Phaeobact...   
. . alpha proteobacterium SCGC AAA298-K06......... 253  5e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . Leisingera daeponensis........................ 253  6e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Phaeobact...   
. . Rhodobacteraceae bacterium HIMB11............. 253  6e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD/FMN-dependent dehydrogenase [Rhodobac...   
. . Roseivivax isoporae LMG 25204................. 253  6e-77  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseivivax isoporae LMG 2...   
. . Rhodobacterales bacterium Y4I................. 253  9e-77  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacterales bact...   
. . Sulfitobacter sp. NB-68....................... 253  1e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitoba...   
. . Paracoccus yeei............................... 252  2e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccu...   
. . Roseovarius mucosus DSM 17069................. 252  2e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD/FMN-containing dehydrogenase [Roseovarius ...   
. . Phaeobacter gallaeciensis DSM 17395........... 252  2e-76  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Phaeobacter gallaeci...   
. . Oceanicola batsensis.......................... 251  2e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Oceanicola batsensis]     
. . Leisingera aquimarina......................... 251  3e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Leisinger...   
. . Paracoccus sp. 39524.......................... 251  3e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus sp....   
. . Roseovarius sp. TM1035........................ 251  3e-76  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseovarius sp. TM1035]   
. . Phaeobacter gallaeciensis DSM 26640........... 251  4e-76  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD/FMN-containing dehydrogenase [Phaeoba...   
. . Leisingera nanhaiensis........................ 251  4e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Leisinger...   
. . Phaeobacter gallaeciensis 2.10................ 251  4e-76  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Phaeobacter gallaeci...   
. . Roseobacter litoralis......................... 251  4e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter litoralis]    
. . Roseobacter sp. GAI101........................ 251  5e-76  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter sp. GAI101]   
. . Roseobacter denitrificans..................... 251  6e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter denitrif...   
. . alpha proteobacterium SCGC AAA076-C03......... 250  7e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: FAD-binding protein [alpha proteobacteriu...   
. . Dinoroseobacter shibae........................ 250  8e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Dinoroseobacter shibae]   
. . Roseovarius sp. 217........................... 250  8e-76  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseovarius sp. 217]      
. . Thalassobacter arenae......................... 250  9e-76  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Glycolate dehydrogenase, subunit GlcD [Th...   
. . Roseibacterium elongatum DSM 19469............ 250  1e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Glycolate dehydrogenase, subunit GlcD [Roseiba...   
. . Rhodobacterales bacterium HTCC2255............ 249  2e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacterales bact...   
. . Rhodobacter sphaeroides WS8N.................. 249  2e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sphaeroi...   
. . Rhodobacter sphaeroides ATCC 17029............ 249  3e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sphaeroi...   
. . Rhodobacter sphaeroides 2.4.1................. 249  3e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sphaeroi...   
. . Rhodobacter sphaeroides KD131................. 249  3e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter sphaeroi...   
. . Rhodobacter sp. AKP1.......................... 249  3e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Glycolate dehydrogenase , subunit GlcD [R...   
. . Sulfitobacter sp. EE-36....................... 248  4e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Sulfitobacter sp. EE...   
. . Sulfitobacter sp. CB2047...................... 248  5e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Sulfitobacter ...   
. . Haematobacter missouriensis................... 248  6e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Haematobacter ...   
. . Roseobacter sp. CCS2.......................... 248  6e-75  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter sp. CCS2]     
. . Paracoccus sp. 4681........................... 248  7e-75  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus sp....   
. . Thioclava dalianensis......................... 247  2e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Thioclava sp. ...   
. . Rubellimicrobium sp. MSL 20................... 246  2e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Glycolate dehydrogenase, subunit GlcD [Rubelli...   
. . Sulfitobacter sp. NAS-14.1.................... 246  3e-74  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Sulfitobacter sp. NA...   
. . Roseobacter sp. SK209-2-6..................... 246  3e-74  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Roseobacter sp. SK20...   
. . Phaeobacter arcticus.......................... 246  5e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Phaeobact...   
. . Haematobacter massiliensis.................... 245  6e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Haematobacter ...   
. . Citreicella sp. 357........................... 245  8e-74  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Citreicella sp. 357]      
. . Oceanicola granulosus......................... 245  8e-74  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Oceanicola granulosus]    
. . Paracoccus sp. Zy-3........................... 242  1e-72  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus sph...   
. . Paracoccus sp. 10990.......................... 242  1e-72  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus sp....   
. . Paracoccus sp. 5503........................... 242  1e-72  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glycolate oxidase subunit GlcD [Paracoccus sp....   
. . Rhodobacter capsulatus........................ 241  2e-72  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter capsulatus]   
. . Oceanicola sp. S124........................... 241  5e-72  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Oceanicola sp. S124]      
. . Rhodobacter capsulatus YW2.................... 240  7e-72  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter capsulatus]   
. . Rhodobacter capsulatus YW1.................... 239  1e-71  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter capsulatus]   
. . Rhodobacter capsulatus B6..................... 239  2e-71  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacter capsulatus]   
. . Rhodobacteraceae bacterium HTCC2083........... 239  2e-71  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Rhodobacteraceae bac...   
. . Jannaschia sp. CCS1........................... 234  9e-70  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: FAD-binding protein [Jannaschia sp. CCS1]      
. . Pseudorhodobacter ferrugineus................. 137  1e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: 2-hydroxy-acid oxidase [Pseudorhodobacter...   
. . Acetobacter malorum........................... 134  3e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: D-Lactate dehydrogenase, cytochrome c-dependen...   
. . Pelagibaca bermudensis HTCC2601............... 133  3e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: 2-hydroxy-acid oxidase [Pelagibaca bermud...   
. . Maritimibacter alkaliphilus HTCC2654.......... 132  1e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: 2-hydroxy-acid oxidase [Maritimibacter al...   
. . Acetobacter persici........................... 131  1e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: 2-hydroxy-acid oxidase [Acetobacter persici]   
. . Rhodobacter sp. DW2-9......................... 131  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: 2-hydroxy-acid oxidase [Rhodobacter sp. DW2-9]      
. . Actibacterium sp. 22II-S11-z10................ 130  3e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: D-lactate dehydrogenase [Actibacterium sp. 22I...   
. . Gluconacetobacter europaeus................... 130  4e-31  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: 2-hydroxy-acid oxidase [Gluconacetobacter...   
. . Citreicella sp. SE45.......................... 130  5e-31  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: 2-hydroxy-acid oxidase [Citreicella sp. S...   
. . Acetobacter pasteurianus...................... 130  5e-31  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: 2-hydroxy-acid oxidase [Acetobacter paste...   
. . Acetobacter pasteurianus IFO 3283-01.......... 130  6e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: 2-hydroxy-acid oxidase [Acetobacter paste...   
. . Acetobacter pasteurianus 386B................. 129  6e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: D-lactate dehydrogenase (cytochrome) [Ace...   
. . Acetobacter pasteurianus subsp. pasteurianus LM 129  7e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: 2-hydroxy-acid oxidase [Acetobacter paste...   
. . Anaeromyxobacter dehalogenans................. 248  5e-75  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-binding protein [Anaeromyxobacter deh...   
. . Anaeromyxobacter sp. Fw109-5.................. 248  6e-75  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-binding protein [Anaeromyxobacter sp....   
. . Anaeromyxobacter dehalogenans 2CP-1........... 248  1e-74  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-binding protein [Anaeromyxobacter deh...   
. . Anaeromyxobacter sp. K........................ 244  4e-73  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-binding protein [Anaeromyxobacter sp. K]   
. . Anaeromyxobacter dehalogenans 2CP-C........... 143  1e-35  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Anaeromyxobacter deha...   
. . Corallococcus coralloides..................... 159  2e-41  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Corallococcus corallo...   
. . Myxococcus xanthus............................ 150  4e-38  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Myxococcus xanthus]        
. . Myxococcus sp. (contaminant ex DSM 436)....... 150  6e-38  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Fe-S protein [Myxococcus sp. (contaminant...   
. . Myxococcus fulvus............................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Myxococcus fulvus]         
. . Myxococcus stipitatus......................... 147  6e-37  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: putative glycolate oxidase, GlcD subunit ...   
. . Myxococcus stipitatus DSM 14675............... 139  3e-34  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD linked oxidase [Myxococcus stipitatus]     
. . Corallococcus coralloides DSM 2259............ 130  3e-31  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Corallococcus corallo...   
. . Stigmatella aurantiaca........................ 155  4e-40  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Stigmatella aurantiaca]    
. . Cystobacter fuscus............................ 149  1e-37  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Fe-S protein, lactate dehydrogenase [Cyst...   
. . Hyalangium minutum............................ 147  5e-37  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Fe-S protein [Hyalangium minutum]                   
. . Stigmatella aurantiaca DW4/3-1................ 145  1e-36  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Stigmatella aurantiaca]    
. . Cystobacter violaceus Cb vi76................. 142  2e-35  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Cystobacter violaceus Cb v...   
. . Cystobacter fuscus DSM 2262................... 140  1e-34  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Glycolate dehydrogenase , subunit GlcD [C...   
. . Haliangium ochraceum.......................... 142  4e-35  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD linked oxidase [Haliangium ochraceum]      
. . Enhygromyxa salina............................ 138  7e-34  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Glycolate dehydrogenase [Hyalangium minutum]        
. . Sorangium cellulosum.......................... 131  2e-31  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Sorangium cellulosum]      
. . Sorangium cellulosum So0157-2................. 130  6e-31  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: FAD-linked oxidase [Sorangium cellulosum]      
. . Desulfovermiculus halophilus.................. 195  6e-55  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovermiculus ha...   
. . Desulfohalobium retbaense..................... 193  3e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfohalobium retb...   
. . Desulfonauticus sp. A7A....................... 192  8e-54  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfonauticus sp. ...   
. . Desulfovibrio aespoeensis..................... 192  1e-53  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio aespoe...   
. . Desulfovibrio africanus....................... 190  5e-53  5 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio africa...   
. . Desulfovibrio africanus PCS................... 190  6e-53  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD/FMN-dependent dehydrogenase [Desulfov...   
. . Desulfobulbus propionicus..................... 188  3e-52  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobulbus propio...   
. . Desulfovibrio oxyclinae....................... 187  5e-52  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio oxycli...   
. . Desulfonatronum lacustre...................... 187  9e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfonatronum lacu...   
. . Desulfovibrio longus.......................... 186  2e-51  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio longus]     
. . Desulfobulbus elongatus....................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobulbus elonga...   
. . Desulfovibrio piezophilus..................... 185  4e-51  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: Glycolate oxidase subunit glcD [Desulfovi...   
. . Desulfovibrio sp. A2.......................... 184  8e-51  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio sp. A2]     
. . Desulfonatronum thiodismutans................. 184  9e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfonatronum thio...   
. . Desulfovibrio hydrothermalis.................. 184  9e-51  7 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase subunit [Desulfovibrio ...   
. . Desulfatirhabdium butyrativorans.............. 182  3e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfatirhabdium bu...   
. . Desulfovibrio bastinii........................ 182  4e-50  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio bastinii]   
. . Pelobacter propionicus........................ 182  7e-50  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Pelobacter propionicus]   
. . Desulfovibrio vulgaris........................ 181  9e-50  5 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio vulgaris]   
. . Desulfobulbus sp. Tol-SR...................... 181  9e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobulbus sp. Tol-SR]      
. . Desulfobulbus japonicus....................... 181  1e-49  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobulbus japoni...   
. . Desulfomicrobium escambiense.................. 181  2e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfomicrobium esc...   
. . Desulfovibrio alkalitolerans.................. 179  4e-49  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD linked oxidase domain protein [Desulf...   
. . Desulfovibrio aminophilus..................... 179  9e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio aminop...   
. . Desulfovibrio alaskensis...................... 178  1e-48  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio alaske...   
. . Desulfovibrio salexigens...................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio salexi...   
. . Desulfomicrobium baculatum.................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfomicrobium bac...   
. . Desulforegula conservatrix.................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulforegula conser...   
. . Desulfovibrio desulfuricans................... 177  2e-48  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio desulf...   
. . Desulfovibrio inopinatus...................... 177  2e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio inopin...   
. . Desulfovibrio alkalitolerans L21-Syr-AB....... 176  8e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio alkali...   
. . Desulfovibrio................................. 176  1e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: MULTISPECIES: FAD-binding protein [Desulf...   
. . Desulfovibrio frigidus........................ 176  1e-47  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio frigidus]   
. . Desulfovibrio putealis........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio putealis]   
. . Pelobacter seleniigenes....................... 174  4e-47  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Pelobacter seleniige...   
. . Desulfurella acetivorans A63.................. 174  4e-47  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: FAD-binding protein [Desulfurella acetivorans ...   
. . Geobacter sp. M21............................. 173  8e-47  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter sp. M21]        
. . Geobacter sp. M18............................. 173  9e-47  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter sp. M18]        
. . Desulfovibrio sp. FW1012B..................... 173  1e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio sp. FW...   
. . Desulfovibrio sp. U5L......................... 172  2e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio sp. U5L]    
. . uncultured Desulfobacterium sp................ 172  2e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: Glycolate oxidase subunit glcD [uncultured De...   
. . Desulfovibrio cuneatus........................ 172  2e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio cuneatus]   
. . Desulfatibacillum aliphaticivorans............ 172  3e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfatibacillum al...   
. . Desulfotalea psychrophila..................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfotalea psychro...   
. . Desulfococcus multivorans..................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD linked oxidase domain protein [Desulf...   
. . Desulfovibrio magneticus...................... 172  3e-46  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD/FMN-dependent dehydrogenase [Desulfov...   
. . Desulfovibrio magneticus RS-1................. 172  4e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio magnet...   
. . Desulfatibacillum alkenivorans................ 172  4e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfatibacillum al...   
. . Desulfobacter curvatus........................ 171  5e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulfobacter curva...   
. . Geobacter bemidjiensis........................ 171  5e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter bemidjiensis]   
. . Desulfobacterium autotrophicum................ 171  7e-46  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: protein GlcD1 [Desulfobacterium autotroph...   
. . Desulfovibrio zosterae........................ 171  9e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio zosterae]   
. . Desulfobulbus propionicus DSM 2032............ 171  1e-45  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobulbus propio...   
. . Syntrophobacter fumaroxidans.................. 170  1e-45  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: FAD-binding protein [Syntrophobacter fuma...   
. . Geobacter sulfurreducens...................... 170  1e-45  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter sulfurredu...   
. . Desulfatiglans anilini........................ 170  2e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobacterium ani...   
. . Geobacter uraniireducens...................... 169  2e-45  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter uraniiredu...   
. . Desulfuromonas sp. TF......................... 169  5e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Desulfuromonas sp. TF]    
. . Desulfospira joergensenii..................... 169  5e-45  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulfospira joerge...   
. . Geobacter bremensis........................... 168  6e-45  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter bremensis]      
. . Syntrophobacter fumaroxidans MPOB............. 168  1e-44  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: FAD-binding protein [Syntrophobacter fuma...   
. . Desulfovibrio sp. X2.......................... 167  2e-44  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD linked oxidase domain protein [Desulf...   
. . Syntrophorhabdus aromaticivorans.............. 167  2e-44  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: FAD-binding protein [Syntrophorhabdus aro...   
. . Desulfobulbus mediterraneus................... 167  2e-44  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulfobulbus medit...   
. . Bilophila..................................... 167  2e-44  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: MULTISPECIES: FAD-binding protein [Biloph...   
. . Pelobacter carbinolicus....................... 165  1e-43  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Pelobacter carbinoli...   
. . Geobacter bemidjiensis Bem.................... 165  1e-43  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter bemidjiensis]   
. . Geobacter uraniireducens Rf4.................. 165  1e-43  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter uraniiredu...   
. . Desulfovibrio alcoholovorans.................. 165  1e-43  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio alcoho...   
. . Desulfobacterium autotrophicum HRM2........... 164  2e-43  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobacterium aut...   
. . Desulfonatronospira thiodismutans............. 164  2e-43  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfonatronospira ...   
. . Geopsychrobacter electrodiphilus.............. 164  2e-43  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: hypothetical protein [Geopsychrobacter el...   
. . Desulfotignum phosphitoxidans................. 164  3e-43  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glycolate oxidase, FAD-linked subunit Glc...   
. . Desulfotignum balticum........................ 164  4e-43  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulfotignum balti...   
. . Desulfovibrio desulfuricans subsp. desulfurican 163  4e-43  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio desulf...   
. . Hippea sp. KM1................................ 163  6e-43  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: hypothetical protein [Hippea sp. KM1]          
. . Desulfococcus oleovorans...................... 163  7e-43  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfococcus oleovo...   
. . Hippea maritima............................... 162  1e-42  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: D-lactate dehydrogenase [Hippea maritima]      
. . Candidatus Magnetoglobus multicellularis str. A 162  1e-42  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: glycolate oxidase [Candidatus Magnetoglobus mu...   
. . Bilophila wadsworthia......................... 161  3e-42  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Bilophila wadsworthia]    
. . Desulfobacter postgatei....................... 161  3e-42  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobacter postga...   
. . Desulfovibrio africanus str. Walvis Bay....... 161  3e-42  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio africanus]    
. . Bilophila wadsworthia 3_1_6................... 161  4e-42  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Bilophila wadsworthia]    
. . Desulfotignum phosphitoxidans DSM 13687....... 160  4e-42  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: D-lactate dehydrogenase Ldh [Desulfotignu...   
. . Bilophila sp. 4_1_30.......................... 160  5e-42  6 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Bilophila sp. 4_1_30]     
. . Desulfocurvus vexinensis...................... 160  6e-42  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfocurvus vexine...   
. . Desulfovibrio sp. Dsv1........................ 160  7e-42  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio sp. Dsv1]   
. . Geobacter metallireducens..................... 160  8e-42  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter metallired...   
. . Desulfovibrio sp. 3_1_syn3.................... 160  9e-42  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio sp. 3_...   
. . Desulfovibrio sp. 6_1_46AFAA.................. 160  9e-42  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio sp. 6_...   
. . Geobacter sulfurreducens PCA.................. 159  2e-41  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter sulfurredu...   
. . Geobacter lovleyi............................. 158  3e-41  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter lovleyi]        
. . Desulfomonile tiedjei......................... 158  5e-41  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: FAD-binding protein [Desulfomonile tiedjei]    
. . Desulfovibrio hydrothermalis DSM 14728........ 157  8e-41  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: Glycolate oxidase subunit glcD [Desulfovi...   
. . delta proteobacterium NaphS2.................. 157  1e-40  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria: FAD-binding protein [delta proteobacteriu...   
. . Geobacter daltonii............................ 157  1e-40  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Geobacter daltonii]       
. . Desulfovibrio piger........................... 155  3e-40  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio piger]      
. . Desulfatibacillum alkenivorans AK-01.......... 154  1e-39  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD linked oxidase domain-containing prot...   
. . Desulfobacula sp. TS.......................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobacula sp. TS]     
. . Desulfonatronovibrio hydrogenovorans.......... 152  5e-39  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfonatronovibrio h...   
. . Desulfovibrio gigas........................... 152  5e-39  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: putative D-lactate dehydrogenase (cytochr...   
. . Desulfovibrio vulgaris str. Hildenborough..... 152  7e-39  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio vulgaris]   
. . Desulfobacula toluolica....................... 152  7e-39  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfobacula toluol...   
. . Pelobacter propionicus DSM 2379............... 151  2e-38  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: FAD-binding protein [Pelobacter propionicus]   
. . Desulfocapsa sulfexigens...................... 151  2e-38  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD/FMN-dependent dehydrogenase [Desulfoc...   
. . Desulfovibrio acrylicus....................... 151  2e-38  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio acrylicus]    
. . Desulfovibrio alaskensis G20.................. 150  3e-38  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio alaskensis]   
. . Desulfovibrio salexigens DSM 2638............. 150  5e-38  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio salexigens]   
. . Desulfovibrio fructosivorans.................. 149  7e-38  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD-binding protein [Desulfovibrio fructo...   
. . uncultured Desulfofustis sp. PB-SRB1.......... 148  2e-37  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [uncultured Desulfof...   
. . Desulfovibrio vulgaris DP4.................... 147  4e-37  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio vulgaris]     
. . Desulfovibrio vulgaris RCH1................... 146  8e-37  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio vulgaris]     
. . Desulfonatronospira thiodismutans ASO3-1...... 146  9e-37  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfonatronospira th...   
. . Desulfobacca acetoxidans...................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: FAD-binding protein [Desulfobacca acetoxi...   
. . Desulfovibrio vulgaris str. 'Miyazaki F'...... 144  5e-36  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio vulgaris]     
. . Desulfarculus baarsii......................... 144  7e-36  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfarculales: D-lactate dehydrogenase [Desulfarculus ba...   
. . Desulfovibrio aespoeensis Aspo-2.............. 142  2e-35  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glycolate oxidase [Desulfovibrio aespoeen...   
. . Desulfovibrio alkalitolerans DSM 16529........ 139  2e-34  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD linked oxidase domain protein [Desulf...   
. . Desulfovibrio piezophilus C1TLV30............. 138  8e-34  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: FAD linked oxidase domain protein [Desulf...   
. . Desulfotalea psychrophila LSv54............... 138  1e-33  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: FAD-binding protein [Desulfotalea psychro...   
. . delta proteobacterium MLMS-1.................. 131  2e-31  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria: FAD-binding protein [delta proteobacteriu...   
. . Helicobacter winghamensis..................... 176  9e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter wingham...   
. . Helicobacter sp. MIT 11-5569.................. 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sp. MIT 11-5...   
. . Helicobacter pullorum......................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pullorum]    
. . Helicobacter canadensis....................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter canaden...   
. . Helicobacter apodemus......................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter apodemus]         
. . Helicobacter rodentium........................ 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter rodentium]   
. . Helicobacter sp. MIT 03-1616.................. 160  9e-42  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sp. MIT 03-1...   
. . Helicobacter macacae.......................... 159  1e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter canis............................ 156  2e-40  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter sp. MIT 09-6949.................. 156  2e-40  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sp. MIT 09-6...   
. . Helicobacter trogontum........................ 154  2e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter trogontum]        
. . Helicobacter muridarum........................ 154  2e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter muridarum]        
. . Helicobacter sp. MIT 01-6451.................. 152  6e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sp. MIT 01-6...   
. . Helicobacter sanguini......................... 151  1e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sanguini]         
. . Helicobacter pylori........................... 151  1e-38  210 hitsBacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-28................... 150  4e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM264Ai.................. 149  5e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-1.................... 149  6e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter bilis............................ 149  6e-38  5 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter bilis]       
. . Helicobacter pylori SNT49..................... 149  6e-38  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Cuz20..................... 149  7e-38  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter bilis WiWa....................... 149  8e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori SouthAfrica7.............. 149  8e-38  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM239Bi.................. 149  8e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori SouthAfrica20............. 149  9e-38  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-4.................... 149  9e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-1.................... 149  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter acinonychis...................... 149  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter acinony...   
. . Helicobacter pylori CPY1962................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-11................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-13................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Aklavik117................ 148  1e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase subunit [Helicobacter p...   
. . Helicobacter pylori NQ4053.................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori R046Wa.................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter hepaticus........................ 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter hepaticus]   
. . Helicobacter pylori NQ4110.................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-43................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori R030b..................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-16................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-17................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter cinaedi.......................... 148  2e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter cinaedi]     
. . Helicobacter pylori B38....................... 148  2e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori HPAG1..................... 148  2e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter magdeburgensis................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter magdeburgensis]   
. . Helicobacter pylori Hp P-30................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM263BFi................. 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori NQ4076.................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-15................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori NQ4161.................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori PeCan4.................... 148  2e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-2.................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter sp. MIT 03-1614.................. 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sp. MIT 03-1...   
. . Helicobacter pylori Hp H-21................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-18................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori India7.................... 148  2e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM067..................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-74................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-19................... 147  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-9.................... 147  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori FD535..................... 147  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori NQ4228.................... 147  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori CG-IMSS-2012.............. 147  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM201Ai.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Aklavik86................. 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase subunit [Helicobacter p...   
. . Helicobacter pylori Gambia94/24............... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM93Bi................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp P-62................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM084..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-26................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-27................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori FD719..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori R32b...................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM119Bi.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-44................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori CPY1124................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori 908....................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM265BSii................ 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori CPY6081................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori MALT...................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM249T................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-9.................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-25................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori R036d..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori CPY3281................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-23................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-34................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-41................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori 83........................ 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM077..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-14................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori G27....................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori FD568..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM254Ai.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori R055a..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori X47-2AL................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM037..................... 147  3e-37  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM245Ai.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori R038b..................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori HUP-B14................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Puno120................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori 35A....................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM117Ai.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM101Biv................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori CPY1662................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM260ASi................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori NQ4200.................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-45................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori NY40...................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase subunit [Helicobacter pylor...   
. . Helicobacter pylori Puno135................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori F57....................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori 52........................ 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori 51........................ 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-8.................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori F32....................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-30................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori P12....................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM231Ai.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM115Ai.................. 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Shi169.................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori BM012A.................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Helicobacter ...   
. . Helicobacter pylori Hp A-27................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori PeCan18................... 147  3e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori J99....................... 147  4e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori FD506..................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori F30....................... 147  4e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori NQ4099.................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Sat464.................... 147  4e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM105Ai.................. 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori A45....................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase subunit [Helicobacter p...   
. . Helicobacter pylori Hp P-3.................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-5b................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-11................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori v225d..................... 147  4e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori oki102.................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori oki102]    
. . Helicobacter pylori PZ5026.................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAMchJs136i............... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-36................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-29................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-20................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-4.................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori OK310..................... 147  4e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: putative Glycolate oxidase [Helicobacter ...   
. . Helicobacter pylori GAM121Aii................. 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp H-23................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-24................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-10................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM111..................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori FD662..................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM114..................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAMchJs106B............... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori CPY1313................... 147  4e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM023..................... 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM114Ai.................. 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori oki154.................... 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori oki154]    
. . Helicobacter pylori OK113..................... 147  5e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: putative Glycolate oxidase [Helicobacter ...   
. . Helicobacter pylori GAM100Ai.................. 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp A-26................... 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter sp. MIT 05-5293.................. 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter sp. MIT 05-5...   
. . Helicobacter pylori oki128.................... 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori oki128]    
. . Helicobacter pylori CPY6271................... 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM066..................... 147  5e-37  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori XZ274..................... 147  5e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-16................... 147  6e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM299..................... 147  6e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: putative Glycolate oxidase [Helicobacter ...   
. . Helicobacter pylori GC26...................... 147  6e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-6.................... 147  6e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-11................... 147  6e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori ELS37..................... 146  6e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM96Ai................... 146  7e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori 26695..................... 146  7e-37  4 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori SJM180.................... 146  7e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-3.................... 146  8e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM83Bi................... 146  8e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp P-4.................... 146  8e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter cinaedi PAGU611.................. 146  9e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter cinaedi]     
. . Helicobacter pylori GAM112Ai.................. 146  9e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori UM038..................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-16................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori B8........................ 145  1e-36  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp P-28b.................. 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAMchJs124i............... 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori HP116Bi................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM244Ai.................. 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori R018c..................... 145  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp H-42................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-6.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori R037c..................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM80Ai................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM250AFi................. 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM210Bi.................. 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori PZ5080.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Hp A-5.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori NQ4216.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori NQ4044.................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter fennelliae....................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Helicobacter ...   
. . Helicobacter pylori GAM120Ai.................. 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori Hp P-41................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori GAM270ASi................. 145  3e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter pylori GAM260BSi................. 144  3e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter cetorum.......................... 144  5e-36  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter cetorum]     
. . Helicobacter pylori 98-10..................... 144  5e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori Lithuania75............... 144  5e-36  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter pylori UM085..................... 144  5e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter heilmannii ASB1.4................ 144  6e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Helicobacter heil...   
. . Helicobacter pylori GAM118Bi.................. 143  8e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Helicoba...   
. . Helicobacter cetorum MIT 99-5656.............. 142  2e-35  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter cetorum]     
. . Helicobacter bizzozeronii..................... 140  1e-34  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter bizzoze...   
. . Helicobacter bizzozeronii CCUG 35545.......... 140  1e-34  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Helicobacter ...   
. . Helicobacter pametensis....................... 138  7e-34  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pameten...   
. . Helicobacter pylori Shi470.................... 134  1e-32  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter felis............................ 134  1e-32  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter felis]       
. . Helicobacter pylori UM065..................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter pylori]      
. . Helicobacter suis............................. 134  2e-32  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter suis]        
. . Helicobacter suis HS1......................... 134  2e-32  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter suis]        
. . Helicobacter mustelae......................... 132  1e-31  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Helicobacter mustelae]    
. . Thiovulum sp. ES.............................. 169  5e-45  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Thiovulum sp. ES]         
. . Sulfurimonas autotrophica..................... 165  8e-44  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurimonas autotro...   
. . Sulfurimonas sp. AST-10....................... 165  1e-43  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurimonas sp. AST...   
. . Sulfurimonas gotlandica....................... 160  5e-42  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurimonas gotland...   
. . Sulfurimonas denitrificans.................... 150  4e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurimonas denitri...   
. . Sulfuricurvum sp. MLSB........................ 147  5e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfuricurvum sp. MLSB]        
. . Sulfuricurvum kujiense........................ 146  1e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfuricurvum kujiense]   
. . Candidatus Sulfuricurvum sp. RIFRC-1.......... 145  2e-36  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: fad linked oxidase domain-containing prot...   
. . Wolinella succinogenes........................ 144  7e-36  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Wolinella succinogenes]   
. . Campylobacter sp. CIT045...................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter sp. CI...   
. . Campylobacter sp. 1485E....................... 167  3e-44  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: gycolate oxidase, subunit GlcD-related protein...   
. . Campylobacter gracilis........................ 164  2e-43  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter gracilis]   
. . Campylobacter ureolyticus..................... 161  2e-42  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter ureoly...   
. . Campylobacter fetus........................... 161  4e-42  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: gycolate oxidase, subunit GlcD-related pr...   
. . Sulfurospirillum deleyianum................... 161  4e-42  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurospirillum del...   
. . Sulfurospirillum barnesii..................... 160  4e-42  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurospirillum bar...   
. . Campylobacter ureolyticus ACS-301-V-Sch3b..... 160  6e-42  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase, subunit GlcD [Campylob...   
. . Campylobacter showae.......................... 160  8e-42  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Campylobacter...   
. . Campylobacter showae CC57C.................... 159  2e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glycolate oxidase subunit GlcD [Campyloba...   
. . Campylobacter fetus subsp. fetus 82-40........ 159  2e-41  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter fetus]      
. . Campylobacter hominis......................... 158  3e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter hominis]    
. . Campylobacter showae RM3277................... 158  4e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter showae]     
. . Campylobacter upsaliensis..................... 158  4e-41  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter upsali...   
. . Campylobacter upsaliensis RM3195.............. 158  5e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter upsali...   
. . Campylobacter hyointestinalis subsp. hyointesti 157  7e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter hyointestin...   
. . Sulfurospirillum arcachonense................. 157  7e-41  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurospirillum arc...   
. . Campylobacter cuniculorum..................... 156  2e-40  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter cunicu...   
. . Campylobacter rectus.......................... 155  3e-40  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter rectus]     
. . Campylobacter upsaliensis JV21................ 155  3e-40  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter upsali...   
. . Campylobacter jejuni K5....................... 154  2e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni K5]       
. . Sulfurospirillum multivorans DSM 12446........ 154  2e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: putative glycolate oxidase subunit GlcD [Sulfu...   
. . Sulfurospirillum sp. SCADC.................... 153  2e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Sulfurospirillum sp. SCADC]    
. . Campylobacter jejuni subsp. jejuni HPC5....... 153  2e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Campylobacter jeju...   
. . Campylobacter jejuni.......................... 153  2e-39  24 hits Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni RM1221................... 153  3e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni IA3902..... 153  3e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni NCTC 11168. 153  3e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni 2008-979... 153  3e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni D2600...... 153  3e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni 1997-10.... 153  3e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni 1213....... 153  3e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni LMG 9217... 153  3e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni 30318.................... 152  4e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni ATCC 33560. 152  5e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. doylei 269.97..... 152  8e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni LMG 23223.. 151  1e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni 1336....... 151  1e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni K1....................... 151  2e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni 2008-894... 151  2e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni ICDCCJ07001 151  2e-38  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni LMG 23211.. 151  2e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni 81116...... 150  2e-38  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter jejuni subsp. jejuni LMG 23218.. 150  3e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter sp. MIT 97-5078................. 150  5e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter sp. MIT 97-...   
. . Campylobacter jejuni subsp. jejuni LMG 9872... 149  6e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter coli............................ 149  7e-38  11 hits Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli H8......................... 149  8e-38  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter jejuni subsp. jejuni 414........ 149  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter jejuni]     
. . Campylobacter lari............................ 149  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter lari]       
. . Campylobacter coli 76339...................... 149  1e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: (S)-2-hydroxy-acid oxidase [Campylobacter...   
. . Campylobacter coli JV20....................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli RM2228..................... 148  1e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli LMG 9860................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli 2553....................... 148  2e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli Z163....................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli 111-3...................... 147  3e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Arcobacter.................................... 147  4e-37  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: MULTISPECIES: FAD-binding protein [Arcoba...   
. . Campylobacter coli 1417....................... 146  8e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Campylobacter coli 2685....................... 146  9e-37  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Campylobacter coli]       
. . Arcobacter sp. AF1581......................... 145  2e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter sp. AF1581]    
. . Arcobacter nitrofigilis....................... 141  4e-35  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter nitrofigi...   
. . Arcobacter butzleri........................... 140  1e-34  4 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter butzleri]      
. . Arcobacter butzleri JV22...................... 140  2e-34  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter butzleri]      
. . Arcobacter butzleri ED-1...................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter butzleri]      
. . Arcobacter butzleri 7h1h...................... 139  2e-34  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: gycolate oxidase, subunit GlcD-related pr...   
. . Arcobacter cibarius........................... 136  3e-33  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter cibarius]      
. . Arcobacter sp. L.............................. 133  5e-32  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: FAD-binding protein [Arcobacter sp. L]         
. . Nitratiruptor sp. SB155-2..................... 163  6e-43  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: FAD-binding protein [Nitratiruptor sp. SB...   
. . Sulfurovum sp. NBC37-1........................ 158  5e-41  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: FAD-binding protein [Sulfurovum sp. NBC37-1]   
. . Nitratifractor salsuginis..................... 153  2e-39  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria: FAD-binding protein [Nitratifractor salsu...   
. . Sulfurovum sp. AR............................. 152  5e-39  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: FAD-binding protein [Sulfurovum sp. AR]        
. . Lebetimonas sp. JH292......................... 144  3e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: FAD-binding protein [Lebetimonas sp. JH292]    
. . Lebetimonas sp. JS032......................... 144  4e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: FAD-binding protein [Lebetimonas sp. JS032]    
. . Lebetimonas................................... 144  8e-36  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: MULTISPECIES: FAD-binding protein [Lebeti...   
. . Caminibacter mediatlanticus................... 140  1e-34  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: FAD-binding protein [Caminibacter mediatl...   
. . Nautilia profundicola......................... 137  1e-33  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: FAD-binding protein [Nautilia profundicola]    
. .bacterium MFB021............................... 379  2e-125 1 hit   Bacteria::                               glycolate oxidase subunit GlcD [Gammaproteobac...   
. .Virgibacillus halodenitrificans................ 370  5e-122 1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative FAD-linked oxidoreductase [Virgibaci...   
. .Virgibacillus sp. CM-4......................... 240  6e-72  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Virgibacillus sp. CM-4]        
. .Virgibacillus sp. Vm-5......................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Virgibacillus sp. C...   
. .Virgibacillus alimentarius..................... 180  3e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Virgibacillus sp. J18]    
. .Geobacillus sp. G1w1........................... 262  3e-80  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacill...   
. .Geobacillus kaustophilus....................... 261  4e-80  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus kaustoph...   
. .Geobacillus.................................... 261  8e-80  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Geobac...   
. .Geobacillus sp. C56-T3......................... 261  8e-80  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Geobac...   
. .Geobacillus sp. Y412MC61....................... 261  8e-80  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Geobac...   
. .Geobacillus sp. WSUCF1......................... 261  9e-80  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacill...   
. .Geobacillus vulcani............................ 260  2e-79  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacill...   
. .Geobacillus stearothermophilus................. 259  2e-79  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacill...   
. .Geobacillus sp. G11MC16........................ 258  7e-79  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus sp. G11M...   
. .Geobacillus thermodenitrificans................ 258  7e-79  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus thermode...   
. .Geobacillus sp. Y4.1MC1........................ 258  7e-79  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Geobac...   
. .Geobacillus thermoglucosidasius NBRC 107763.... 258  7e-79  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacillus t...   
. .Geobacillus thermoglucosidasius................ 258  8e-79  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus thermogl...   
. .Geobacillus thermocatenulatus.................. 258  8e-79  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacill...   
. .Geobacillus stearothermophilus NUB3621......... 258  1e-78  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD linked oxidase [Geobacillus stearothermoph...   
. .Geobacillus caldoxylosilyticus................. 257  2e-78  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus caldoxyl...   
. .Bacillus aquimaris............................. 256  5e-78  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus sp. RP1137............................ 256  6e-78  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Geobacillus sp. WCH70.......................... 256  7e-78  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus sp. WCH70]    
. .Bacillus aidingensis........................... 256  7e-78  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Geobacillus sp. JF8............................ 255  1e-77  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus sp. JF8]      
. .Bacillus massiliosenegalensis.................. 255  2e-77  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus massiliosen...   
. .Bacillus megaterium............................ 254  4e-77  11 hits Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus megaterium]      
. .Thalassobacillus devorans...................... 254  4e-77  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Thalassob...   
. .Bacillus sp. J33............................... 253  5e-77  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus clausii............................... 253  6e-77  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus clausii]         
. .Bacillus subtilis BEST7613..................... 253  8e-77  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Synechocystis sp. PC...   
. .Bacillus megaterium DSM 319.................... 253  8e-77  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus megaterium]      
. .Bacillus megaterium NBRC 15308................. 253  1e-76  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus megaterium]      
. .Bacillus sp. X1(2014).......................... 253  2e-76  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Geobacillus st...   
. .Bacillus flexus................................ 252  2e-76  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus sp. 171095_106........................ 251  3e-76  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus megaterium WSH-002.................... 251  4e-76  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus megaterium]      
. .Lentibacillus jeotgali......................... 251  5e-76  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Lentibacillus jeotgali]   
. .Bacillus sp. 278922_107........................ 251  6e-76  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus gelatini.............................. 250  1e-75  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus sp. 2_A_57_CT2........................ 249  2e-75  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. 2_A_57_...   
. .Bacillus oceanisediminis....................... 249  2e-75  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus oceanisedim...   
. .Bacillus firmus DS1............................ 249  4e-75  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD linked oxidase [Bacillus firmus DS1]            
. .Bacillus massilioanorexius..................... 248  6e-75  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus massilioano...   
. .Caldalkalibacillus thermarum................... 247  2e-74  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Caldalkalibacillus t...   
. .Bacillus fordii................................ 246  2e-74  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus fordii]          
. .Bacillus sp. URHB0009.......................... 246  3e-74  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus sp. FJAT-14578........................ 246  4e-74  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Halobacillus kuroshimensis..................... 239  1e-71  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Halobacil...   
. .Bacillus indicus LMG 22858..................... 238  6e-71  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus indic...   
. .Bacillus cibi.................................. 238  7e-71  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus cibi]      
. .Bacillus clausii KSM-K16....................... 205  9e-59  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus clausii]         
. .Bacillus sp. L1(2012).......................... 203  7e-58  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. L1(2012)]    
. .Salsuginibacillus kocurii...................... 202  9e-58  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Salsuginibacillus k...   
. .Bacillus azotoformans.......................... 196  2e-55  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus azoto...   
. .Bacillus....................................... 195  7e-55  10 hits Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus azotoformans MEV2011.................. 194  9e-55  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD/FMN-dependent dehydrogenase [Bacillus azot...   
. .Bacillus amyloliquefaciens subsp. plantarum UCM 194  1e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus amyloliquefaciens subsp. plantarum UCM 194  1e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glycolate oxidase subunit [...   
. .Bacillus amyloliquefaciens..................... 194  1e-54  14 hits Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus amylolique...   
. .Bacillus amyloliquefaciens SQR9................ 194  1e-54  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus amylo...   
. .Bacillus subtilis group........................ 193  6e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus amyloliquefaciens subsp. plantarum NAU 192  8e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus isronensis............................ 192  1e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus isronensis]      
. .Bacillus amyloliquefaciens subsp. plantarum M27 192  1e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus amyloliquef...   
. .Bacillus amyloliquefaciens FZB42............... 192  1e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus amyloliquef...   
. .Bacillus methylotrophicus...................... 192  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus methylotrop...   
. .Bacillus amyloliquefaciens IT-45............... 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus amyloliquef...   
. .Bacillus amyloliquefaciens CAU-B946............ 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus amyloliquef...   
. .Bacillus amyloliquefaciens subsp. plantarum UCM 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus amylo...   
. .Bacillus coagulans............................. 191  4e-53  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus coagulans]            
. .Bacillus siamensis............................. 191  4e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus siamensis]       
. .Oceanobacillus kimchii......................... 190  5e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Oceanobacillus kimchii]   
. .Oceanobacillus iheyensis....................... 190  6e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Oceanobacillus iheye...   
. .Bacillus coagulans 36D1........................ 190  6e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus coagulans]       
. .Bacillus gaemokensis........................... 190  7e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus gaemokensis]          
. .Bacillus panaciterrae.......................... 189  1e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus panaciterrae]    
. .Bacillus amyloliquefaciens DSM 7............... 189  2e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus amyloliquef...   
. .Bacillus sp. m3-13............................. 189  2e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. m3-13]       
. .Halalkalibacillus halophilus................... 189  2e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Halalkalibacillus ha...   
. .Bacillus amyloliquefaciens LL3................. 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus amyloliquef...   
. .Bacillus cereus ATCC 14579..................... 187  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus cereus................................ 187  5e-52  60 hits Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus acidiproducens........................ 187  6e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus acidiproduc...   
. .Alkalibacillus haloalkaliphilus................ 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Alkalibacillus halo...   
. .Bacillus cereus BAG2O-3........................ 187  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus ATCC 10876..................... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus VD140.......................... 186  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus HuA2-9......................... 186  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus group.......................... 186  1e-51  10 hits Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus AH1271......................... 186  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus thuringiensis......................... 186  2e-51  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus thuringiensis]   
. .Bacillus lehensis G1........................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus lehen...   
. .Bacillus cereus HuA2-1......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus AH603.......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus thuringiensis serovar pulsiensis BGSC  186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus thuringiensis]   
. .Bacillus thuringiensis serovar andalousiensis B 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus thuringiensis]   
. .Bacillus thuringiensis str. Al Hakam........... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus G9241.......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus HuA3-9......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus thuringiensis serovar konkukian str. 9 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus halodurans............................ 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus halodurans]      
. .Bacillus cereus VDM053......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus ATCC 4342...................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus E33L........................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus AH187.......................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus BAG6X1-2....................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus 95/8201........................ 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus FRI-35......................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus MC67........................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus VDM034......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus mycoides DSM 2048..................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus BAG1X1-3....................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus VD107.......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus AH1272......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus weihenstephanensis KBAB4.............. 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus NVH0597-99..................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus ISP3191........................ 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus VD142.......................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus BAG5X1-1....................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus biovar anthracis str. CI....... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus BDRD-ST196..................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus B5-2........................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus AH621.......................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus bataviensis........................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus batav...   
. .Bacillus cereus MM3............................ 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus ATCC 10987..................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus BAG5X2-1....................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus sp. 1NLA3E............................ 186  3e-51  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. 1NLA3E]      
. .Bacillus atrophaeus............................ 185  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glycolate dehydrogenase subunit GlcD [Bac...   
. .Bacillus cereus VD118.......................... 185  4e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus VD115.......................... 185  4e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus atrophaeus 1942....................... 185  4e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus atrophaeus]      
. .Bacillus coagulans 2-6......................... 185  4e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus coagulans]       
. .Bacillus cereus VD146.......................... 185  5e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus subtilis.............................. 185  5e-51  27 hits Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Bacillus cereus VD133.......................... 185  5e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cytotoxicus........................... 185  5e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cytotoxicus]     
. .Bacillus cereus VD156.......................... 185  6e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus anthracis............................. 184  6e-51  30 hits Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus anthracis]       
. .Bacillus thuringiensis serovar kurstaki str. HD 184  7e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus cereus BAG3X2-1....................... 184  7e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus sp. JCM 19047......................... 184  7e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: FAD/FMN-containing dehyd...   
. .Bacillus aurantiacus........................... 184  8e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus aurantiacus]     
. .Bacillus cereus Rock3-44....................... 184  9e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus HuA4-10........................ 184  9e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus sp. 105MF............................. 184  9e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. 105MF]       
. .Bacillus cereus G9842.......................... 184  9e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus thuringiensis serovar chinensis CT-43. 184  9e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus thuringiensis IBL 200................. 184  9e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus thuringiensis]   
. .Bacillus thuringiensis BMB171.................. 184  9e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus cereus CER074......................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus VD136.......................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus cereus R309803........................ 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus HuB1-1......................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus sp. JS................................ 184  1e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. JS]          
. .Bacillus sp. FJAT-13831........................ 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. FJAT-13...   
. .Bacillus vireti................................ 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Geobacillus caldoxylosilyticus NBRC 107762..... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus caldoxyl...   
. .Bacillus subtilis subsp. subtilis str. 168..... 184  1e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Bacillus thuringiensis serovar huazhongensis BG 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus subtilis subsp. subtilis str. OH 131.1 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Bacillus subtilis E1........................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Bacillus cereus BAG1X1-1....................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus subtilis Miyagi-4..................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus subtilis ...   
. .Bacillus subtilis subsp. natto BEST195......... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus subtilis]       
. .Bacillus pseudomycoides........................ 184  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus pseudomycoi...   
. .Bacillus sp. 95MFCvi2.1........................ 184  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. 95MFCvi...   
. .Bacillus mycoides.............................. 184  2e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase, subunit GlcD [Bacillus myco...   
. .Bacillus cereus BAG2X1-3....................... 183  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus sp. EGD-AK10.......................... 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. EGD-AK10]    
. .Bacillus subtilis BSn5......................... 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Bacillus subtilis subsp. subtilis str. BSP1.... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: hypothetical protein [Bacil...   
. .Bacillus subtilis subsp. subtilis str. SC-8.... 183  4e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein BSSC8_13730 [Bacillus sub...   
. .Bacillus cereus BAG5O-1........................ 182  5e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus Rock3-29....................... 182  5e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus mannanilyticus........................ 182  5e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus mannanilyti...   
. .Bacillus sp. DW5-4............................. 182  5e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. DW5-4]            
. .Bacillus mycoides Rock3-17..................... 182  5e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus mycoides]        
. .Bacillus mycoides Rock1-4...................... 182  6e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus mycoides]        
. .Geobacillus sp. CAMR5420....................... 182  6e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus sp. CAMR...   
. .Geobacillus thermoglucosidasius C56-YS93....... 182  6e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Geobac...   
. .Geobacillus thermoglucosidasius GT20........... 182  7e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus thermogl...   
. .Bacillus cereus BAG2X1-2....................... 182  7e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus toyonensis BCT-7112................... 182  8e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus bataviensis LMG 21833................. 182  9e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus cereus BAG6X1-1....................... 182  1e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus cereus HuB4-4......................... 181  1e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit glcD [Bacillus ...   
. .Bacillus subtilis subsp. subtilis str. BAB-1... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus subti...   
. .Bacillus cereus BDRD-ST24...................... 181  2e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus thuringiensis MC28.................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus thuringiensis]   
. .Bacillus cereus Rock3-28....................... 181  2e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus cereus]          
. .Bacillus subtilis subsp. inaquosorum KCTC 13429 181  2e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus subtilis]       
. .Bacillus subtilis XF-1......................... 181  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus subti...   
. .Ornithinibacillus scapharcae................... 180  4e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Ornithinibacillus sc...   
. .Bacillus selenitireducens...................... 179  5e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [ [Bacillus selenitir...   
. .Bacillus licheniformis......................... 179  6e-49  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus licheniformis]   
. .Bacillus sp. SB49.............................. 179  6e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. SB49]        
. .Bacillus sp. J13............................... 179  6e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. J13]         
. .Bacillus licheniformis S 16.................... 179  6e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus licheniformis S 16]   
. .Bacillus pumilus............................... 179  6e-49  10 hits Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus pumilus]         
. .Bacillus sp. CPSM8............................. 179  6e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. CPSM8]       
. .Bacillus sp. SB47.............................. 179  7e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. SB47]        
. .Bacillus licheniformis ATCC 14580.............. 179  7e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus alcalophilus ATCC 27647............... 179  8e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus alcalophilus ATC...   
. .Bacillus kribbensis............................ 179  9e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus kribbensis]      
. .Bacillus licheniformis CG-B52.................. 178  1e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus licheniformis]   
. .Halobacillus halophilus........................ 178  2e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Halobacillus halophi...   
. .Geobacillus kaustophilus HTA426................ 178  2e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus kaustoph...   
. .Bacillus sp. UNC438CL73TsuS30.................. 177  3e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. UNC438C...   
. .Bacillus licheniformis 9945A................... 177  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Bacillus altitudinis 41KF2b.................... 177  3e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  (S)-2-hydroxy-acid oxidase subunit D [Bacillus...   
. .Bacillus endophyticus.......................... 177  4e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus endophyticus]    
. .Anoxybacillus flavithermus..................... 177  6e-48  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Anoxybacillus flavit...   
. .Bacillus aerophilus KACC 16563................. 176  7e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. M 2-6]       
. .Bacillus subtilis subsp. spizizenii TU-B-10.... 176  7e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Anoxybacillus sp. KU2-6(11).................... 176  1e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Anoxybacillus sp. KU2-6(11)]   
. .Bacillus stratosphericus....................... 175  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Bacillus strat...   
. .Bacillus ginsengihumi.......................... 175  3e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus ginsengihumi]    
. .Anoxybacillus kamchatkensis.................... 174  4e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Anoxybacillus kamcha...   
. .Bacillus sp. BSC154............................ 174  5e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. BSC154]           
. .Bacillus sp. TS-2.............................. 174  5e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus sp. ...   
. .Bacillus subtilis subsp. spizizenii str. W23... 174  5e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus subtilis]        
. .Anoxybacillus flavithermus TNO-09.006.......... 174  5e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase, subunit GlcD [Anoxybac...   
. .Anoxybacillus flavithermus AK1................. 174  6e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Anoxybaci...   
. .Bacillus sp. SJS............................... 174  7e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. SJS]              
. .Bacillaceae.................................... 174  7e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacill...   
. .Bacillus smithii............................... 174  7e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus smithii]         
. .Anoxybacillus sp. DT3-1........................ 174  8e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Anoxybaci...   
. .Bacillus sp. HYC-10............................ 174  8e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. HYC-10]      
. .Anoxybacillus sp. SK3-4........................ 174  9e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Anoxybaci...   
. .Anoxybacillus flavithermus NBRC 109594......... 173  1e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Anoxybaci...   
. .Anoxybacillus flavithermus WK1................. 173  2e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Anoxybacillus flavit...   
. .Bacillus sp. BL4-6............................. 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. BL4-6]            
. .Caldibacillus debilis.......................... 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Caldibacillus debilis]    
. .Bacillus sp. B-jedd............................ 172  5e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus sp. ...   
. .Pontibacillus marinus.......................... 170  2e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Pontibacillus marinus]    
. .Halobacillus sp. BAB-2008...................... 169  2e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Halobacil...   
. .Marinococcus halotolerans...................... 169  3e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Marinococcus halotol...   
. .Bacillus vallismortis.......................... 169  4e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus vallismortis]    
. .Bacillus mojavensis............................ 169  4e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus mojavensis]      
. .Bacillus megaterium QM B1551................... 169  6e-45  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus megaterium]      
. .Bacillus infantis NRRL B-14911................. 168  7e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Bacillus]   
. .Bacillus sonorensis............................ 168  1e-44  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Bacillus ...   
. .Halobacillus trueperi.......................... 168  1e-44  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  putative FAD-linked oxidoreductase [Halobacil...   
. .Geobacillus sp. GHH01.......................... 168  1e-44  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Geobacillus sp...   
. .Bacillus sp. 10403023.......................... 167  2e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. 10403023]    
. .Geobacillus sp. MAS1........................... 167  2e-44  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Geobacillus sp. MAS1]     
. .Lysinibacillus fusiformis...................... 167  2e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase, subunit GlcD [Lysiniba...   
. .Bacillus wakoensis JCM 9140.................... 166  5e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate dehydrogenase [Bacillus wakoensis J...   
. .Geobacillus thermodenitrificans NG80-2......... 166  8e-44  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Geobac...   
. .Bacillus safensis.............................. 165  1e-43  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus pumilus]         
. .Bacillus sp. NSP9.1............................ 164  4e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus sp. NSP9.1]      
. .Tumebacillus flagellatus....................... 163  7e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Tumebacillus sp. NFB]          
. .Paucisalibacillus globulus..................... 163  9e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paucisalibacillus gl...   
. .Bacillus safensis FO-36b....................... 160  8e-42  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  (S)-2-hydroxy-acid oxidase subunit D [Bacillus...   
. .Bacillus chagannorensis........................ 153  3e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus chagannoren...   
. .Bacillus pumilus SAFR-032...................... 146  7e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus pumilus]         
. .Bacillus pumilus ATCC 7061..................... 146  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Bacillus pumilus]         
. .Brevibacillus sp. phR.......................... 266  7e-82  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Brevibacillus sp. phR]    
. .Alicyclobacillus acidocaldarius................ 265  3e-81  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Alicyclobacillus aci...   
. .Alicyclobacillus hesperidum.................... 263  3e-80  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Alicyclobacillus hes...   
. .Alicyclobacillus acidocaldarius LAA1........... 261  1e-79  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Alicyclobacillus aci...   
. .Alicyclobacillus acidocaldarius subsp. acidocal 261  2e-79  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Alicyclobacillus aci...   
. .Brevibacillus thermoruber...................... 260  2e-79  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Brevibaci...   
. .Alicyclobacillus macrosporangiidus............. 260  2e-79  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Alicyclob...   
. .Alicyclobacillus pohliae....................... 254  2e-77  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Alicyclobacillus po...   
. .Alicyclobacillus herbarius..................... 248  3e-75  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Alicyclob...   
. .Paenisporosarcina quisquiliarum TG20........... 246  4e-74  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenisporosarcina sp...   
. .Paenisporosarcina sp. TG-14.................... 246  4e-74  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenisporosarcina sp...   
. .Aneurinibacillus aneurinilyticus............... 246  4e-74  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  putative glycolate oxidase, subunit GlcD ...   
. .Desmospora sp. 8437............................ 242  1e-72  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Desmospora sp. 8437]      
. .Bacillus tusciae............................... 231  3e-68  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Kyrpidia tusciae]         
. .Geomicrobium sp. JCM 19039..................... 218  2e-63  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glycolate dehydrogenase,...   
. .Geomicrobium sp. JCM 19037..................... 217  4e-63  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glycolate dehydrogenase,...   
. .Solibacillus silvestris........................ 193  4e-54  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Solibacillus silvest...   
. .Sporolactobacillus laevolacticus............... 191  4e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporolactobacillus l...   
. .Sporolactobacillus laevolacticus DSM 442....... 191  5e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporolactobacillus laevol...   
. .Sporosarcina sp. EUR3 2.2.2.................... 189  2e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporosarcina sp. EUR...   
. .Planococcus donghaensis........................ 189  2e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Planococcus donghaen...   
. .Thermoactinomyces sp. Gus2-1................... 187  5e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Thermoactinomyces sp. Gus...   
. .Paenibacillus terrigena........................ 187  8e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus terrig...   
. .Brevibacillus panacihumi W25................... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Brevibacillus panacihumi ...   
. .Brevibacillus panacihumi....................... 186  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Brevibacillus panaci...   
. .Sporolactobacillus vineae...................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporolactobacillus v...   
. .Paenibacillus daejeonensis..................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus daejeo...   
. .Paenibacillus.................................. 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: FAD-binding protein [Paenib...   
. .Paenibacillus mucilaginosus.................... 185  6e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus mucila...   
. .Paenibacillus mucilaginosus KNP414............. 185  6e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus mucila...   
. .Paenibacillus sp. OSY-SE....................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. OS...   
. .Brevibacillus borstelensis..................... 183  2e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Brevibacillus ...   
. .Cohnella thermotolerans........................ 181  1e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Cohnella thermotoler...   
. .Paenibacillus harenae.......................... 181  1e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus harenae]    
. .Cohnella panacarvi............................. 181  2e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Cohnella panacarvi]       
. .Bhargavaea cecembensis......................... 181  2e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative FAD-linked oxidoreductase [Bharg...   
. .Exiguobacterium mexicanum...................... 180  3e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Exiguobacterium mexicanum]     
. .Exiguobacterium sp. GIC31...................... 180  3e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Exiguobacterium sp. ...   
. .Exiguobacterium pavilionensis.................. 180  4e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Exiguobacterium pav...   
. .Cohnella laeviribosi........................... 180  4e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Cohnella laeviribosi]     
. .Aneurinibacillus aneurinilyticus ATCC 12856.... 180  5e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  putative glycolate oxidase, subunit GlcD ...   
. .Paenibacillus lactis........................... 179  6e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus lactis]     
. .Aneurinibacillus terranovensis................. 179  8e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Aneurinibacillus ter...   
. .Kurthia sp. JC8E............................... 179  8e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Kurthia sp. JC8E]         
. .Sporosarcina newyorkensis...................... 179  8e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporosarcina newyork...   
. .Paenibacillus dendritiformis................... 179  1e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus dendri...   
. .Paenibacillus sp. MSt1......................... 179  2e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. MSt1]        
. .Paenibacillus sp. URHA0014..................... 178  2e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. UR...   
. .Brevibacillus brevis........................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Brevibacillus brevis]     
. .Exiguobacterium aurantiacum.................... 178  2e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Exiguobacterium aura...   
. .Bacillus tusciae DSM 2912...................... 178  2e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Kyrpidia tusciae]         
. .Paenibacillus alginolyticus.................... 177  3e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus algino...   
. .Paenibacillus sp. P22.......................... 177  5e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glycolate oxidase subunit GlcD [Paenibaci...   
. .Paenibacillus sp. Y412MC10..................... 177  6e-48  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. Y4...   
. .Exiguobacterium sp. AB2........................ 177  6e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Exiguobacterium sp. AB2]       
. .Paenibacillus sp. HGF5......................... 177  7e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. HGF5]   
. .Paenibacillus sp. FSL H8-457................... 177  7e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD linked oxidase domain-containing protein [...   
. .Paenibacillus elgii............................ 177  1e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus elgii]      
. .Paenibacillus sp. UNC451MF..................... 176  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. UN...   
. .Paenibacillus macerans......................... 175  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein DJ90_5490 [Paenibacillus ...   
. .Paenibacillus darwinianus...................... 175  3e-47  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. Br]          
. .Paenibacillus pini JCM 16418................... 174  6e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate dehydrogenase [Paenibacillus pini J...   
. .Paenibacillus ehimensis........................ 174  1e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus ehimen...   
. .Paenibacillus sp. FSL R5-808................... 173  1e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD linked oxidase domain-containing protein [...   
. .Geomicrobium sp. JCM 19038..................... 173  2e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD/FMN-containing dehydrogenase [Geomicrobiu...   
. .Geomicrobium sp. JCM 19055..................... 172  2e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD/FMN-containing dehydrogenase [Geomicrobiu...   
. .Paenibacillus alvei............................ 172  3e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  GlcD [Paenibacillus alvei]                     
. .Paenibacillus barengoltzii..................... 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase, subunit GlcD [Paenibac...   
. .Salinicoccus carnicancri....................... 171  6e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Salinicoccus carnic...   
. .Paenibacillus alvei DSM 29..................... 171  1e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus alvei]      
. .Paenibacillus alvei A6-6i-x.................... 170  2e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: GlcD [Paenibacillus]             
. .Paenibacillus sp. J14.......................... 168  1e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. J14]    
. .Paenibacillus sp. oral taxon 786............... 167  2e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus sp. or...   
. .Salinicoccus albus............................. 166  4e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Salinicoccus albus]      
. .Paenibacillus senegalensis..................... 166  4e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Paenibacillus senega...   
. .Sporolactobacillus terrae...................... 164  2e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporolactobacillus t...   
. .Staphylococcus agnetis......................... 162  9e-43  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit [Staphylococcus agne...   
. .Brevibacillus borstelensis AK1................. 162  1e-42  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD linked oxidase domain-containing prot...   
. .Staphylococcus sciuri.......................... 161  2e-42  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Staphylococcus sciuri]    
. .Sporolactobacillus inulinus.................... 161  3e-42  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Sporolactobacillus i...   
. .Staphylococcus intermedius..................... 160  5e-42  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Staphylococcus inter...   
. .Staphylococcus lentus.......................... 160  6e-42  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus lentus]   
. .Jeotgalicoccus marinus......................... 160  7e-42  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Jeotgalicoccus marinus]   
. .Staphylococcus pseudintermedius................ 158  6e-41  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Staphylococcus pseud...   
. .Staphylococcus pseudintermedius HKU10-03....... 157  7e-41  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Staphylococcus pseud...   
. .Staphylococcus vitulinus....................... 157  1e-40  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus vitu...   
. .Staphylococcus delphini........................ 155  4e-40  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Staphylococcus delph...   
. .Laceyella sacchari............................. 155  5e-40  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  FAD-binding protein [Laceyella sacchari]       
. .Paenibacillus larvae subsp. larvae 08-100...... 154  1e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Paenibacillus ...   
. .Paenibacillus larvae........................... 153  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glycolate oxidase subunit GlcD [Paenibaci...   
. .Jeotgalicoccus sp. 13MG44_air.................. 151  1e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative FAD-linked oxidoreductase [Jeotgalic...   
. .Sulfobacillus thermosulfidooxidans............. 248  4e-75  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Sulfobacillus thermo...   
. .Thermaerobacter subterraneus................... 246  4e-74  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Thermaerobacter subt...   
. .Thermaerobacter marianensis.................... 240  1e-71  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Thermaerobacter mari...   
. .Sulfobacillus acidophilus...................... 234  2e-69  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Sulfobacillus acidop...   
. .Desulfosporosinus orientis..................... 209  6e-58  7 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD/FMN-dependent dehydrogenase [Desulfos...   
. .Sulfobacillus acidophilus DSM 10332............ 208  6e-58  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: lactate dehydrogenase [Sulfobacillus acid...   
. .Sulfobacillus acidophilus TPY.................. 208  7e-58  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: lactate dehydrogenase [Sulfobacillus acid...   
. .Desulfitobacterium metallireducens DSM 15288... 203  8e-58  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfitobacterium metall...   
. .Desulfosporosinus sp. OT....................... 201  3e-57  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus sp...   
. .Desulfosporosinus orientis DSM 765............. 200  1e-56  14 hits Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus or...   
. .Moorella thermoacetica......................... 199  1e-56  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: hypothetical protein [Moorella thermoacet...   
. .Moorella thermoacetica ATCC 39073.............. 199  2e-56  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Moorella thermoacetica]   
. .Desulfotomaculum kuznetsovii................... 197  1e-55  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum kuz...   
. .Desulfosporosinus sp. HMP52.................... 196  2e-55  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus sp. HMP52]   
. .Desulfosporosinus youngiae..................... 196  3e-55  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus yo...   
. .Desulfosporosinus acidiphilus.................. 194  1e-54  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus ac...   
. .Desulfosporosinus meridiei..................... 194  1e-54  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus me...   
. .Desulfosporosinus youngiae DSM 17734........... 194  2e-54  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus yo...   
. .Desulfosporosinus meridiei DSM 13257........... 192  5e-54  8 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfosporosinus me...   
. .Desulfotomaculum ruminis....................... 192  1e-53  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum rum...   
. .Desulfitobacterium dehalogenans................ 192  1e-53  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfitobacterium d...   
. .Desulfitobacterium sp. PCE1.................... 191  2e-53  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfitobacterium s...   
. .Desulfitobacterium dichloroeliminans........... 191  2e-53  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD/FMN-dependent dehydrogenase [Desulfit...   
. .Desulfitobacterium dichloroeliminans LMG P-2143 191  3e-53  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfitobacterium d...   
. .Syntrophobotulus glycolicus.................... 191  4e-53  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: D-lactate dehydrogenase [Syntrophobotulus...   
. .Desulfitobacterium hafniense................... 190  6e-53  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfitobacterium h...   
. .Thermacetogenium phaeum........................ 190  6e-53  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Thermacetogenium pha...   
. .Carboxydothermus hydrogenoformans.............. 189  7e-53  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glycolate oxidase subunit GlcD [Carboxydo...   
. .Desulfitobacterium hafniense Y51............... 189  8e-53  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative glycolate oxidase, subunit GlcD ...   
. .Zymophilus raffinosivorans..................... 189  8e-53  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Zymophilus raffinosi...   
. .Carboxydothermus ferrireducens................. 189  8e-53  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Carboxydothermus fer...   
. .Carboxydothermus hydrogenoformans Z-2901....... 189  9e-53  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Carboxydothermus hyd...   
. .Desulfotomaculum kuznetsovii DSM 6115.......... 189  1e-52  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum kuz...   
. .Thermodesulfobium narugense.................... 189  2e-52  3 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Thermodesulfobium na...   
. .Desulfurispora thermophila..................... 187  4e-52  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfurispora therm...   
. .Desulfitobacterium............................. 187  4e-52  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: FAD/FMN-dependent dehydroge...   
. .Pelotomaculum thermopropionicum................ 187  8e-52  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Pelotomaculum thermo...   
. .Desulfotomaculum hydrothermale................. 186  1e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Glycolate oxidase subunit glcD [Desulfoto...   
. .Desulfovirgula thermocuniculi.................. 186  1e-51  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Desulfovirgula therm...   
. .Desulfotomaculum............................... 186  2e-51  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: FAD-binding protein [Desulf...   
. .Desulfotomaculum thermocisternum............... 185  4e-51  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum the...   
. .Thermodesulfobium narugense DSM 14796.......... 185  5e-51  6 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Thermodesulfobium na...   
. .Acetonema longum............................... 184  7e-51  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glycolate oxidase subunit [Acetonema longum]   
. .Desulfosporosinus acidiphilus SJ4.............. 184  7e-51  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD/FMN-dependent dehydrogenase [Desulfos...   
. .Heliobacterium modesticaldum................... 184  9e-51  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Heliobacterium modes...   
. .Desulfotomaculum alkaliphilum.................. 184  1e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum alk...   
. .Anaerovibrio sp. RM50.......................... 183  3e-50  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Anaerovibrio sp. RM50]    
. .Thermosinus carboxydivorans.................... 181  8e-50  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Thermosinus carboxyd...   
. .Desulfitibacter alkalitolerans................. 180  3e-49  5 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Desulfitibacter alk...   
. .Anaerovibrio lipolyticus....................... 180  4e-49  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Anaerovibrio lipolyt...   
. .Desulfotomaculum nigrificans................... 180  4e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum nig...   
. .Acetohalobium arabaticum....................... 177  3e-48  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: FAD-binding protein [Acetohalobium arabat...   
. .Sporomusa ovata................................ 177  3e-48  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glycolate oxidase subunit GlcD [Sporomusa...   
. .Selenomonas sputigena.......................... 176  6e-48  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Selenomonas sputigena]    
. .Sporomusa ovata DSM 2662....................... 176  7e-48  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glycolate oxidase subunit GlcD [Sporomusa...   
. .Ammonifex degensii............................. 176  1e-47  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Ammonifex degensii]       
. .Selenomonas sp. CM52........................... 176  1e-47  4 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Selenomonas sp. CM52]     
. .Anaeroarcus burkinensis........................ 176  1e-47  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Anaeroarcus burkinen...   
. .Desulfotomaculum ruminis DSM 2154.............. 175  2e-47  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum rum...   
. .Selenomonas bovis.............................. 174  5e-47  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Selenomonas bovis]        
. .Symbiobacterium thermophilum................... 172  5e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Symbiobacterium ther...   
. .Desulfotomaculum gibsoniae..................... 169  3e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum gib...   
. .Desulfitobacterium hafniense DCB-2............. 168  7e-45  7 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD linked oxidase [Desulfitobacterium ha...   
. .Clostridium sp. CAG:967........................ 167  2e-44  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: fAD/FMN-dependent dehydrogenase [Clostrid...   
. .Veillonellaceae................................ 167  2e-44  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: FAD-binding protein [Veillo...   
. .Lactobacillus composti DSM 18527............... 165  2e-43  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glycolate dehydrogenase, subunit GlcD [Lactob...   
. .Syntrophothermus lipocalidus................... 162  1e-42  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: lactate dehydrogenase [Syntrophothermus l...   
. .Clostridium sp. CAG:813........................ 161  3e-42  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glycolate oxidase subunit glcD [Clostridi...   
. .Clostridium sp. CAG:768........................ 160  7e-42  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glycolate oxidase subunit GlcD [Clostridi...   
. .Pelosinus sp. UFO1............................. 160  8e-42  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: D-lactate dehydrogenase (cytochrome) [Pelosinu...   
. .Pelosinus fermentans........................... 160  1e-41  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Pelosinus fermentans]     
. .Pelosinus...................................... 159  1e-41  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: FAD-binding protein [Pelosi...   
. .Pelotomaculum thermopropionicum SI............. 158  6e-41  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: lactate dehydrogenase [Pelotomaculum ther...   
. .Clostridium sp. CAG:715........................ 154  2e-39  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: fAD/FMN-dependent dehydrogenase [Clostrid...   
. .Desulfotomaculum acetoxidans................... 154  2e-39  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: lactate dehydrogenase [Desulfotomaculum a...   
. .Acetonema longum DSM 6540...................... 151  2e-38  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Acetonema longum]         
. .Pelosinus fermentans JBW45..................... 149  8e-38  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Pelosinus fermentans]     
. .Desulfotomaculum reducens...................... 149  8e-38  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Desulfotomaculum red...   
. .Desulfotomaculum carboxydivorans CO-1-SRB...... 149  1e-37  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: FAD-binding protein [Desulf...   
. .Thermosinus carboxydivorans Nor1............... 146  9e-37  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: FAD-binding protein [Thermosinus carboxyd...   
. .Pelosinus fermentans B4........................ 146  9e-37  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: FAD-binding protein [Pelosi...   
. .Heliobacterium modesticaldum Ice1.............. 143  1e-35  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: FAD-binding protein [Heliobacterium modes...   
. .Desulfitobacterium dehalogenans ATCC 51507..... 140  9e-35  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: lactate dehydrogenase [Desu...   
. .Halanaerobium saccharolyticum.................. 140  1e-34  2 hits  Bacteria:Firmicutes:Clostridia:Halanaerobiales: Glycolate dehydrogenase, subunit GlcD [Ha...   
. .Pelosinus fermentans A11....................... 140  1e-34  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: FAD-binding protein [Pelosi...   
. .Clostridiales.................................. 138  6e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: 2-hydroxy-acid oxidase [Clo...   
. .Halanaerobium hydrogeniformans................. 138  6e-34  3 hits  Bacteria:Firmicutes:Clostridia:Halanaerobiales: FAD-binding protein [Halanaerobium hydrog...   
. .Lachnospiraceae bacterium 5_1_63FAA............ 138  6e-34  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Lachnospiraceae b...   
. .Firmicutes bacterium CAG:270................... 137  1e-33  2 hits  Bacteria:Firmicutes:                     glycolate oxidase [Firmicutes bacterium C...   
. .Lachnospiraceae bacterium CAG:25............... 137  2e-33  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: fAD/FMN-containing dehydrogenases [Lachno...   
. .Eubacterium hadrum............................. 136  4e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative glycolate oxidase, subunit GlcD ...   
. .Lactobacillus helveticus....................... 134  7e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Glycolate oxidase [Lactobacillus helveticus]   
. .Selenomonas sputigena ATCC 35185............... 134  2e-32  6 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: 2-hydroxy-acid oxidase [Selenomonas sputi...   
. .Tepidanaerobacter sp. Re1...................... 134  2e-32  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: FAD-binding protein [Tepidanaerobacter ac...   
. .Clostridium drakei............................. 134  2e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium drakei]    
. .Lactobacillus gigeriorum....................... 133  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: dehydrogenase [Lactobacillus gigeriorum]       
. .Anaerostipes caccae............................ 132  8e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Anaerostipes caccae]   
. .Halanaerobium saccharolyticum subsp. saccharoly 132  8e-32  2 hits  Bacteria:Firmicutes:Clostridia:Halanaerobiales: Glycolate dehydrogenase, subunit GlcD [Ha...   
. .Anaerostipes sp. CAG:276....................... 132  8e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative glycolate oxidase subunit GlcD [...   
. .Clostridium tyrobutyricum...................... 132  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium tyrob...   
. .Clostridium carboxidivorans.................... 132  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium carbo...   
. .Clostridium sp. CAG:1013....................... 132  1e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Clostridium perfringens........................ 132  1e-31  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium perfr...   
. .Lactobacillus helveticus R0052................. 132  1e-31  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: dehydrogenase [Lactobacillus helveticus]       
. .Clostridium colicanis.......................... 131  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glycolate oxidase, subunit GlcD [Clostrid...   
. .Clostridium botulinum.......................... 131  2e-31  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium botul...   
. .Lactobacillus brevis........................... 131  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: FAD-binding protein [Lactobacillus brevis]     
. .Lactobacillus sp. wkB8......................... 131  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: FAD/FMN-containing dehydrogenase [Lactobacillu...   
. .Clostridium botulinum E3 str. Alaska E43....... 131  2e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium botul...   
. .Clostridium cadaveris.......................... 130  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium cadav...   
. .Clostridium botulinum E1 str. 'BoNT E Beluga'.. 130  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium botul...   
. .Lactobacillus sp. wkB10........................ 130  4e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: FAD/FMN-containing dehydrogenase [Lactobacillu...   
. .Clostridiales bacterium VE202-09............... 130  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridiales bac...   
. .Acidaminococcus sp. BV3L6...................... 130  4e-31  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative glycolate oxidase, subunit GlcD ...   
. .Acidaminococcus................................ 130  4e-31  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: FAD-binding protein [Acidam...   
. .Acidaminococcus sp. HPA0509.................... 130  4e-31  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: glycolate oxidase, subunit ...   
. .Lactobacillus versmoldensis.................... 130  5e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: FAD-binding protein [Lactobacillus versmo...   
. .Clostridium perfringens F262................... 130  5e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium perfr...   
. .Clostridium perfringens NCTC 8239.............. 130  5e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium perfr...   
. .Clostridium perfringens CPE str. F4969......... 130  6e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: 2-hydroxy-acid oxidase [Clostridium perfr...   
. .Lactobacillus.................................. 130  6e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: FAD-binding protein [Lactob...   
. .Verrucomicrobia bacterium LP2A................. 365  1e-120 2 hits  Bacteria:Verrucomicrobia:                glycolate oxidase subunit GlcD [Verrucomi...   
. .Methylacidiphilum fumariolicum................. 362  9e-119 3 hits  Bacteria:Verrucomicrobia:Methylacidiphilales: FAD-binding protein [Methylacidiphilum fu...   
. .Methylacidiphilum infernorum................... 353  2e-115 2 hits  Bacteria:Verrucomicrobia:Methylacidiphilales: FAD-binding protein [Methylacidiphilum in...   
. .Verrucomicrobia bacterium SCGC AAA164-E04...... 243  6e-73  2 hits  Bacteria:Verrucomicrobia:                hypothetical protein [Verrucomicrobia bac...   
. .Methylacidiphilum fumariolicum SolV............ 193  3e-54  3 hits  Bacteria:Verrucomicrobia:Methylacidiphilales: FAD-binding protein [Methylacidiphilum fu...   
. .Methylacidiphilum infernorum V4................ 182  7e-50  4 hits  Bacteria:Verrucomicrobia:Methylacidiphilales: FAD-binding protein [Methylacidiphilum in...   
. .Verrucomicrobia bacterium SCGC AAA164-N20...... 178  2e-48  1 hit   Bacteria:Verrucomicrobia:                FAD-binding protein [Verrucomicrobia bact...   
. .Verrucomicrobium sp. 3C........................ 349  1e-113 2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: hypothetical protein [Verrucomicrobium sp...   
. .Chthoniobacter flavus.......................... 246  3e-74  2 hits  Bacteria:Verrucomicrobia:Spartobacteria: FAD-binding protein [Chthoniobacter flavus]    
. .Opitutaceae bacterium TAV1..................... 197  2e-55  2 hits  Bacteria:Verrucomicrobia:Opitutae:       FAD-binding protein [Opitutaceae bacteriu...   
. .Opitutaceae bacterium TAV5..................... 196  3e-55  1 hit   Bacteria:Verrucomicrobia:Opitutae:       FAD-binding protein [Opitutaceae bacterium TAV5]    
. .Chthoniobacter flavus Ellin428................. 182  7e-50  2 hits  Bacteria:Verrucomicrobia:Spartobacteria: FAD-binding protein [Chthoniobacter flavus]    
. .Verrucomicrobium spinosum...................... 173  2e-46  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: FAD-binding protein [Verrucomicrobium spi...   
. .Pedosphaera parvula............................ 171  4e-46  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: FAD-binding protein [Pedosphaera parvula]      
. .Coraliomargarita sp. CAG:312................... 162  1e-42  2 hits  Bacteria:Verrucomicrobia:Opitutae:Puniceicoccales: putative glycolate oxidase subunit GlcD [...   
. .Coraliomargarita akajimensis................... 140  2e-34  1 hit   Bacteria:Verrucomicrobia:Opitutae:Puniceicoccales: FAD-linked oxidase [Coraliomargarita akaj...   
. .Verrucomicrobiae bacterium DG1235.............. 132  7e-32  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: FAD-linked oxidase [Verrucomicrobiae bact...   
. .uncultured marine bacterium.................... 332  4e-110 576 hitsBacteria::                               GlcD [uncultured marine bacterium]                  
. .uncultured bacterium HF4000_009C18............. 323  9e-104 1 hit   Bacteria::                               fad/fmn-containing dehydrogenases [uncultured ...   
. .uncultured bacterium........................... 270  9e-86  441 hitsBacteria::                               glycolate oxidase D-subunit [uncultured bacter...   
. .uncultured Acidobacteriales bacterium HF0200_23 233  2e-69  1 hit   Bacteria:Acidobacteria:Acidobacteriales: fad/fmn-containing dehydrogenases [uncultured ...   
. .NC10 bacterium 'Dutch sediment'................ 222  8e-65  3 hits  Bacteria::                               FAD-binding protein [Candidatus Methylomi...   
. .uncultured Nitrospirae bacterium MY3-11A....... 171  4e-46  1 hit   Bacteria:Nitrospirae:                    FAD linked oxidase domain protein [uncultured ...   
. .uncultured marine bacterium HF4000_APKG2098.... 166  6e-45  2 hits  Bacteria::                               putative FAD binding domain protein [unculture...   
. .Fusobacterium sp. CAG:439...................... 164  1e-43  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glycolate oxidase subunit glcD [Fusobacte...   
. .Fusobacterium sp. CAG:815...................... 161  3e-42  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glycolate oxidase subunit GlcD [Fusobacte...   
. .Brachyspira sp. CAG:484........................ 160  5e-42  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glycolate oxidase subunit GlcD [Brachyspi...   
. .uncultured Chloroflexi bacterium............... 133  3e-32  1 hit   Bacteria:Chloroflexi:                    glycolate oxidase [uncultured Chloroflexi bac...   
. .uncultured Bacteroidetes bacterium............. 133  4e-32  1 hit   Bacteria:Bacteroidetes:                  FAD dependent oxidoreductase [uncultured Bact...   
. .Chryseobacterium taeanense..................... 318  7e-102 1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: FAD-binding protein [Chryseobacterium tae...   
. .Flavobacterium sp. CF313....................... 309  3e-98  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: FAD-binding protein [Variovorax sp. CF313]     
. .Flavobacterium sp. MS220-5C.................... 139  4e-34  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: hypothetical protein [Flavobacterium sp. ...   
. .Flavobacterium psychrophilum FPG3.............. 136  4e-33  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium psychrophilum FPG3]   
. .Flavobacterium psychrophilum................... 135  7e-33  9 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium psychrophilum]   
. .Flavobacterium limnosediminis.................. 135  1e-32  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: (S)-2-hydroxy-acid oxidase [Flavobacteriu...   
. .Flavobacterium columnare....................... 132  7e-32  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium columnare]       
. .Flavobacterium aquatile LMG 4008............... 131  1e-31  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium aquatile LMG 4008]    
. .Flavobacterium saliperosum..................... 131  1e-31  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: (S)-2-hydroxy-acid oxidase [Flavobacteriu...   
. .Flavobacterium cauense......................... 130  5e-31  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: (S)-2-hydroxy-acid oxidase [Flavobacteriu...   
. .Flavobacterium cauense R2A-7................... 130  5e-31  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium cauense R2A-7]        
. .Flavobacterium filum........................... 130  5e-31  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium filum]           
. .Flavobacterium antarcticum..................... 130  5e-31  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Flavobacterium antarcticum]     
. .Owenweeksia hongkongensis...................... 133  4e-32  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: dehydrogenase [Owenweeksia hongkongensis]      
. .Sphingobacterium sp. H1ai...................... 145  2e-36  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Sphingobacterium sp. H1ai]      
. .Pedobacter borealis............................ 140  1e-34  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Pedobacter borealis]            
. .Pedobacter sp. R20-19.......................... 139  4e-34  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Pedobacter sp. R20-19]          
. .Hymenobacter norwichensis...................... 138  6e-34  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: dehydrogenase [Hymenobacter norwichensis]      
. .Sphingobacterium sp. 21........................ 138  7e-34  3 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Sphingobacterium sp. 21]        
. .Pedobacter sp. V48............................. 137  1e-33  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Pedobacter sp. V48]                  
. .Solitalea canadensis........................... 137  2e-33  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Solitalea canadensis]           
. .Hymenobacter sp. APR13......................... 136  3e-33  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein N008_04065 [Hymenobacter ...   
. .Hymenobacter sp. DY53.......................... 136  3e-33  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein containing FAD-bind domai...   
. .Bacteroidetes bacterium SCGC AAA027-N21........ 135  7e-33  1 hit   Bacteria:Bacteroidetes:                  dehydrogenase [Bacteroidetes bacterium SC...   
. .Pedobacter oryzae.............................. 134  1e-32  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Pedobacter oryzae]              
. .Pontibacter actiniarum......................... 132  1e-31  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: dehydrogenase [Pontibacter actiniarum]         
. .Olivibacter sitiensis.......................... 131  1e-31  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Olivibacter sitiensis]          
. .Pedobacter sp. BAL39........................... 131  2e-31  2 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Pedobacter sp. BAL39]           
. .Mucilaginibacter paludis....................... 131  2e-31  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Mucilaginibacter paludis]       
. .Sphingobacterium antarcticus 4BY............... 130  5e-31  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: dehydrogenase [Sphingobacterium antarcticus 4BY]    
. .Effluviibacter roseus.......................... 129  6e-31  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Pontibacter roseus]      
. .endosymbiont of unidentified scaly snail isolat 315  8e-101 2 hits  Bacteria::                               glycolate oxidase [endosymbiont of unidentifi...   
. .Thermobaculum terrenum......................... 278  3e-86  2 hits  Bacteria::                               FAD-binding protein [Thermobaculum terrenum]   
. .Thermobaculum terrenum ATCC BAA-798............ 183  3e-50  4 hits  Bacteria::                               FAD-binding protein [Thermobaculum terrenum]   
. .Saccharomonospora viridis...................... 272  4e-84  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora vi...   
. .Saccharomonospora glauca....................... 259  4e-79  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora gl...   
. .Saccharomonospora cyanea....................... 258  2e-78  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora cy...   
. .Saccharomonospora azurea....................... 256  6e-78  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora az...   
. .Saccharomonospora azurea SZMC 14600............ 256  8e-78  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora az...   
. .Saccharomonospora halophila.................... 253  1e-76  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Saccharom...   
. .Saccharomonospora xinjiangensis................ 253  1e-76  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora xi...   
. .Saccharomonospora paurometabolica.............. 253  1e-76  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora pa...   
. .Saccharomonospora marina....................... 248  6e-75  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora ma...   
. .Saccharomonospora sp. CNQ490................... 247  2e-74  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Saccharom...   
. .Saccharomonospora saliphila.................... 244  2e-73  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharomonospora sa...   
. .Saccharomonospora xinjiangensis XJ-54.......... 150  5e-38  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharomonospora xin...   
. .Saccharomonospora glauca K62................... 149  8e-38  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharomonospora gla...   
. .Saccharomonospora viridis DSM 43017............ 149  1e-37  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharomonospora vir...   
. .Saccharomonospora marina XMU15................. 144  4e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharomonospora mar...   
. .Saccharomonospora azurea NA-128................ 138  8e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharomonospora azu...   
. .Saccharomonospora cyanea NA-134................ 130  4e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharomonospora cya...   
. .Saccharopolyspora rectivirgula................. 262  3e-80  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Saccharopolysp...   
. .Saccharopolyspora spinosa...................... 260  2e-79  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharopolyspora sp...   
. .Pseudonocardia asaccharolytica................. 259  3e-79  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Pseudonoc...   
. .Pseudonocardia spinosispora.................... 258  1e-78  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Pseudonoc...   
. .Saccharopolyspora erythraea.................... 257  3e-78  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharopolyspora er...   
. .Pseudonocardia dioxanivorans................... 253  6e-77  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Pseudonocardia dioxa...   
. .Pseudonocardia acaciae......................... 253  1e-76  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Pseudonoc...   
. .Amycolatopsis taiwanensis...................... 251  6e-76  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Amycolato...   
. .Pseudonocardia sp. P1.......................... 249  2e-75  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Pseudonocardia sp. P1]    
. .Amycolatopsis thermoflava...................... 249  4e-75  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Amycolato...   
. .Prauserella rugosa............................. 248  7e-75  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Prauserel...   
. .Pseudonocardia dioxanivorans CB1190............ 247  2e-74  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Pseudonocardia dioxa...   
. .Amycolatopsis methanolica 239.................. 246  3e-74  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: D-lactate dehydrogenase (cytochrome) [Amycolat...   
. .Amycolatopsis methanolica...................... 246  4e-74  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Amycolato...   
. .Thermobispora bispora.......................... 239  2e-71  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Thermobispora bispora]    
. .Jiangella gansuensis........................... 233  5e-69  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Jiangella...   
. .Saccharopolyspora erythraea NRRL 2338.......... 167  1e-44  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Saccharopolyspora er...   
. .Sciscionella sp. SE31.......................... 162  7e-43  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Sciscionella sp. SE31]     
. .Thermocrispum municipale....................... 160  1e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Thermocrispum municip...   
. .Amycolatopsis rifamycinica..................... 160  1e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis rifamycinica]     
. .Amycolatopsis nigrescens....................... 159  2e-41  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis nigresc...   
. .Amycolatopsis vancoresmycina................... 157  6e-41  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase [Amycolatopsis vancores...   
. .Sciscionella marina............................ 157  8e-41  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Sciscionella marina]       
. .Amycolatopsis mediterranei..................... 156  3e-40  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis mediter...   
. .Amycolatopsis mediterranei U32................. 156  3e-40  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis mediter...   
. .Thermocrispum agreste.......................... 155  6e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Thermocrispum agreste]     
. .Amycolatopsis sp. ATCC 39116................... 154  1e-39  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Amycolatopsis sp. AT...   
. .Amycolatopsis balhimycina...................... 146  7e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis balhimy...   
. .Amycolatopsis benzoatilytica................... 146  7e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis benzoat...   
. .Amycolatopsis azurea........................... 144  3e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Glycolate dehydrogenase , subunit GlcD [A...   
. .Amycolatopsis alba............................. 144  3e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis alba]        
. .Amycolatopsis orientalis....................... 144  7e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase [Amycolatopsis orientalis]   
. .Amycolatopsis lurida NRRL 2430................. 143  1e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis lurida NRRL ...   
. .Amycolatopsis sp. MJM2582...................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolatopsis sp. MJM2582]      
. .Amycolatopsis decaplanina...................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase [Amycolatopsis decaplan...   
. .Saccharopolyspora erythraea D.................. 141  4e-35  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Saccharopolyspora ery...   
. .Allokutzneria albata........................... 141  7e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Allokutzneria albata]      
. .Amycolatopsis japonica......................... 141  6e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase [Amycolatopsis japonica]          
. .Kutzneria albida DSM 43870..................... 140  9e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein KALB_8625 [Kutzneria albi...   
. .Kutzneria sp. 744.............................. 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase [Kutzneria sp. 744]               
. .Actinomycetospora chiangmaiensis............... 138  9e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomycetospora c...   
. .Actinoalloteichus spitiensis................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Actinoalloteichus spi...   
. .Actinoalloteichus cyanogriseus................. 137  2e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Actinoalloteichus cya...   
. .Thermobispora bispora DSM 43833................ 132  7e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase [Thermobispora bispora]         
. .Lechevalieria aerocolonigenes.................. 149  7e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Lechevalieria aerocol...   
. .Actinosynnema mirum............................ 148  2e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Actinosynnema mirum]       
. .Saccharothrix espanaensis...................... 147  4e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Glycolate oxidase [Saccharothrix espanaen...   
. .Lentzea albidocapillata........................ 146  8e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Lentzea albidocapillata]   
. .Actinosynnema mirum DSM 43827.................. 134  2e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Actinosynnema mirum]       
. .Actinokineospora inagensis..................... 130  5e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Actinokineospora inag...   
. .Cryptosporangium arvum DSM 44712............... 265  1e-81  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD/FMN-dependent dehydrogenase [Cryptosporang...   
. .Streptomyces sp. TAA486........................ 263  7e-81  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Streptomy...   
. .Streptomyces sp. NRRL F-5126................... 263  8e-81  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Streptomy...   
. .Streptomyces sp. TAA204........................ 263  2e-80  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Streptomy...   
. .Actinoplanes missouriensis..................... 262  2e-80  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Actinoplanes missour...   
. .Actinopolyspora erythraea...................... 260  2e-79  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Actinopolyspor...   
. .Actinopolyspora halophila...................... 255  2e-77  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Actinopolyspora halo...   
. .Actinoplanes sp. SE50/110...................... 254  5e-77  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Actinoplanes sp. SE5...   
. .Nocardiopsis sp. 20028......................... 253  6e-77  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Nocardiopsis ganjiahuensis..................... 252  1e-76  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Actinopolyspora mortivallis.................... 251  4e-76  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Actinopolyspora mort...   
. .Actinopolyspora iraqiensis..................... 251  5e-76  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Actinopol...   
. .Actinopolymorpha sp. YIM 48868................. 250  1e-75  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolymorpha alba]   
. .Spirillospora albida........................... 249  2e-75  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Spirillos...   
. .Actinomadura oligospora........................ 248  4e-75  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Actinomad...   
. .Intrasporangium chromatireducens Q5-1.......... 247  2e-74  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Intrasporangiu...   
. .Nocardiopsis sp. CNS639........................ 247  2e-74  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis sp. CNS...   
. .Geodermatophilus obscurus...................... 246  3e-74  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Geodermatophilus obs...   
. .Actinomadura rifamycini........................ 246  6e-74  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Actinomad...   
. .Nocardiopsis lucentensis....................... 246  6e-74  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis lucente...   
. .Intrasporangium calvum......................... 244  2e-73  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Intrasporangium calvum]   
. .Nocardiopsis halotolerans...................... 244  2e-73  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis halotol...   
. .Thermomonospora curvata........................ 243  4e-73  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Thermomonospora curv...   
. .Nocardiopsis synnemataformans.................. 243  7e-73  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis synnema...   
. .Nocardiopsis dassonvillei...................... 243  7e-73  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis dassonv...   
. .Actinoplanes friuliensis....................... 242  1e-72  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD linked oxidase [Actinoplanes...   
. .Kineosphaera limosa............................ 242  2e-72  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Kineosphaera limosa]      
. .Nocardiopsis alba.............................. 240  8e-72  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis alba]        
. .Nocardiopsis gilva............................. 240  9e-72  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis gilva]       
. .Microbispora rosea............................. 239  1e-71  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Microbisp...   
. .Actinomadura atramentaria...................... 239  2e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Actinomadura atramen...   
. .Demetria terragena............................. 239  2e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Demetria ...   
. .Microbispora sp. ATCC PTA-5024................. 239  2e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Microbispora sp. ATCC PTA...   
. .Nonomuraea coxensis............................ 239  2e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nonomuraea coxensis]      
. .Brevibacterium linens.......................... 238  4e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Brevibacterium linens]    
. .Geodermatophilaceae bacterium URHB0062......... 238  5e-71  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Geodermat...   
. .Marmoricola sp. URHB0036....................... 237  9e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Marmorico...   
. .Actinomadura flavalba.......................... 237  9e-71  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Actinomadura flavalba]    
. .Nocardiopsis prasina........................... 235  6e-70  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis prasina]     
. .Actinocatenispora sera......................... 234  1e-69  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Actinocat...   
. .Streptosporangium roseum....................... 234  2e-69  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Streptosp...   
. .Nocardioidaceae bacterium Broad-1.............. 234  2e-69  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardioidaceae bact...   
. .Actinomadura madurae........................... 233  3e-69  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Actinomad...   
. .Nocardiopsis sp. CNT312........................ 233  5e-69  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Catenulispora acidiphila....................... 233  8e-69  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Catenulispora acidip...   
. .Marmoricola aequoreus.......................... 231  3e-68  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Marmorico...   
. .Nocardiopsis xinjiangensis..................... 231  3e-68  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Streptosporangium roseum DSM 43021............. 230  5e-68  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Streptosporangium ro...   
. .Nocardiopsis kunsanensis....................... 230  7e-68  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Geodermatophilaceae bacterium URHA0031......... 229  1e-67  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Geodermat...   
. .Actinoplanes sp. N902-109...................... 229  2e-67  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: D-lactate dehydrogenase (cytochrome) [Act...   
. .Nocardiopsis salina............................ 229  2e-67  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Catellatospora koreensis....................... 228  3e-67  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Catelliglobosispora ...   
. .Streptosporangium amethystogenes............... 228  3e-67  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Streptosp...   
. .Nocardioides sp. URHA0032...................... 228  4e-67  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardioi...   
. .Modestobacter sp. 42H12-1...................... 228  6e-67  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Modestobacter marinus]    
. .Nocardiopsis chromatogenes..................... 227  9e-67  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Ornithinimicrobium pekingense.................. 224  8e-66  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Ornithinimicrobium p...   
. .Modestobacter sp. KNN45-2b..................... 222  6e-65  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Modestobacter ...   
. .Nocardiopsis baichengensis..................... 222  7e-65  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis baichen...   
. .Nocardiopsis halophila......................... 222  8e-65  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Nocardiopsis halophila]   
. .Nocardiopsis potens............................ 216  2e-62  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Nocardiop...   
. .Stackebrandtia nassauensis..................... 214  6e-62  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Stackebrandtia nassa...   
. .Mycobacterium phlei............................ 185  3e-50  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium phlei]      
. .Mycobacterium vaccae........................... 177  2e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium vaccae]     
. .Mycobacterium smegmatis........................ 177  3e-47  15 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium smegma...   
. .Mycobacterium smegmatis str. MC2 155........... 177  4e-47  15 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium smegma...   
. .Mycobacterium sp. UM_RHS....................... 176  7e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium sp. UM...   
. .Mycobacterium smegmatis MKD8................... 175  1e-46  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit [Mycobacterium ...   
. .Mycobacterium rhodesiae........................ 174  5e-46  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium rhodes...   
. .Mycobacterium cosmeticum....................... 172  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD/FMN-dependent dehydrogenase [Mycobacteriu...   
. .Streptomyces sp. LaPpAH-202.................... 171  6e-46  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. LaPp...   
. .Streptomyces griseus........................... 171  6e-46  9 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces griseus]      
. .Rhodococcus sp. DK17........................... 171  7e-46  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. DK17]      
. .Streptomyces................................... 171  7e-46  29 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Strepto...   
. .Streptomyces sp. PVA 94-07..................... 171  1e-45  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain-containing prot...   
. .Streptomyces sp. MP94-10....................... 171  1e-45  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain-containing prot...   
. .Mycobacterium neoaurum......................... 169  2e-44  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Mycobacterium neoaurum]   
. .Gordonia polyisoprenivorans.................... 167  2e-44  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia polyisopreni...   
. .Rhodococcus sp. 29MFTsu3.1..................... 167  2e-44  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. 29MFT...   
. .Rhodococcus fascians........................... 167  2e-44  32 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus fascians]      
. .Rhodococcus sp. 114MFTsu3.1.................... 167  2e-44  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. 114MF...   
. .Gordonia polyisoprenivorans NBRC 16320......... 167  3e-44  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia polyisopreni...   
. .Streptomyces sp. ATexAB-D23.................... 165  8e-44  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. ATex...   
. .Rhodococcus opacus............................. 165  2e-43  10 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus opacus]        
. .Rhodococcus sp. JG-3........................... 164  2e-43  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. JG-3]      
. .Rhodococcus sp. JVH1........................... 164  2e-43  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. JVH1]      
. .Rhodococcus jostii............................. 164  3e-43  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus jostii]        
. .Streptomyces ochraceiscleroticus............... 164  3e-43  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces ochracei...   
. .Streptomyces sp. NRRL B-24051.................. 162  1e-42  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Rhodococcus qingshengii........................ 162  1e-42  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus qingshengii]   
. .Streptomyces violens........................... 162  1e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces violens]      
. .Streptomyces sp. SM8........................... 162  2e-42  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. SM8]      
. .Rhodococcus imtechensis........................ 161  3e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus imtechensis]   
. .Rhodococcus opacus PD630....................... 161  3e-42  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus opacus]        
. .Rhodococcus wratislaviensis.................... 161  3e-42  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding oxidoreductase [Rhodococcus w...   
. .Geodermatophilus obscurus DSM 43160............ 161  3e-42  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Geodermatophilus obs...   
. .Rhodococcus wratislaviensis NBRC 100605........ 160  4e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Rhodococcus wrat...   
. .Catenulispora acidiphila DSM 44928............. 160  4e-42  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Catenulispora acidip...   
. .Streptomyces sp. AW19M42....................... 160  6e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. AW19...   
. .Streptomyces himastatinicus.................... 160  6e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces himastat...   
. .Streptomyces flavogriseus...................... 160  7e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces flavogri...   
. .Streptomyces sp. PAMC26508..................... 160  7e-42  5 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glycolate dehydrogenase [St...   
. .Streptomyces sp. NRRL B-24720.................. 160  8e-42  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Rhodococcus erythropolis....................... 159  1e-41  17 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus erythropo...   
. .Rhodococcus.................................... 159  1e-41  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Rhodoco...   
. .Rhodococcus erythropolis CCM2595............... 159  2e-41  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus erythropo...   
. .Rhodococcus erythropolis SK121................. 159  2e-41  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus erythropo...   
. .Arsenicicoccus bolidensis...................... 159  2e-41  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Arsenicicoccus bolide...   
. .Rhodococcus sp. P27............................ 159  2e-41  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. P27]       
. .Streptomyces sp. NRRL S-1448................... 158  3e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Rhodococcus sp. UNC23MFCrub1.1................. 158  4e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. UNC23...   
. .Rhodococcus opacus M213........................ 158  4e-41  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus opacus]        
. .Micromonospora sp. ATCC 39149.................. 158  4e-41  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora sp. AT...   
. .Rhodococcus erythropolis PR4................... 158  4e-41  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Rhodococcus ...   
. .Actinomycetales................................ 158  5e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Microbispora sp. NRRL...   
. .Streptomyces sp. NRRL S-337.................... 157  6e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Nocardioides sp. Iso805N....................... 157  6e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardioides sp. Iso8...   
. .Streptomyces sp. NRRL WC-3549.................. 157  6e-41  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces albulus........................... 157  7e-41  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative oxidoreductase [Streptomyces alb...   
. .Intrasporangium calvum DSM 43043............... 157  1e-40  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Intrasporangium calvum]   
. .Streptomyces sp. MspMP-M5...................... 157  1e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. MspM...   
. .Williamsia sp. D3.............................. 157  1e-40  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Williamsia sp. D3]         
. .Streptomyces violaceusniger.................... 156  2e-40  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces violaceu...   
. .Streptomyces sclerotialus...................... 156  2e-40  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces scleroti...   
. .Streptomyces hygroscopicus..................... 156  2e-40  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces hygrosco...   
. .Streptomyces sp. NTK 937....................... 155  4e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NTK 937]       
. .Streptomyces sp. NRRL S-920.................... 155  4e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL S-384.................... 155  4e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. SirexAA-E..................... 155  6e-40  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Strepto...   
. .Streptomyces rapamycinicus..................... 155  7e-40  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces rapamyci...   
. .Streptomyces sp. PRh5.......................... 154  1e-39  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. PRh5]          
. .Streptomyces iranensis......................... 154  1e-39  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain protein [Streptomyc...   
. .Streptomyces flavotricini...................... 153  2e-39  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces flavotri...   
. .Streptomyces sp. 142MFCol3.1................... 153  4e-39  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. 142M...   
. .Streptomyces albus............................. 152  5e-39  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Streptomyces albus]       
. .Streptomyces fradiae........................... 152  6e-39  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Streptomyces fradiae]          
. .Streptomyces sviceus........................... 152  6e-39  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sviceus]      
. .Streptomyces violaceoruber..................... 152  8e-39  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces violaceo...   
. .Streptomyces globisporus....................... 151  9e-39  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase [Streptomyces globisporus]      
. .Rhodococcus wratislaviensis IFP 2016........... 150  2e-38  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus wratislav...   
. .Rhodococcus sp. UNC363MFTsu5.1................. 150  2e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. UNC36...   
. .Streptomyces cellulosae........................ 150  3e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces cellulosae]   
. .Streptomyces rimosus........................... 150  3e-38  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces rimosus]      
. .Streptomyces ghanaensis ATCC 14672............. 150  4e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Strepto...   
. .Streptomyces toyocaensis....................... 150  4e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces toyocaensis]       
. .Streptomyces canus............................. 150  5e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces canus]        
. .Streptomyces sp. NRRL WC-3719.................. 149  5e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium abscessus........................ 149  5e-38  11 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium abscessus]   
. .Streptomyces purpureus......................... 149  5e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces purpureus]    
. .Kitasatospora setae............................ 149  5e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Kitasatospora setae]       
. .Streptomyces sp. JS01.......................... 149  6e-38  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. JS01]     
. .Streptomyces sp. NRRL WC-3773.................. 149  6e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. CNS654........................ 149  7e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNS654]   
. .Mycobacterium abscessus subsp. bolletii BD..... 149  7e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium abscessus]   
. .Streptomyces roseosporus NRRL 15998............ 149  9e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Strepto...   
. .Streptomyces scabrisporus...................... 149  9e-38  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces scabri...   
. .Streptomyces sp. NRRL F-5065................... 149  1e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL F-5135................... 148  2e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium sp. URHB0044..................... 148  2e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. URH...   
. .Nocardiopsis alkaliphila....................... 148  2e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardiopsis alkaliph...   
. .Streptomyces laceyi............................ 148  2e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces niveus]       
. .Streptomyces griseoaurantiacus................. 148  2e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces griseoau...   
. .Mycobacterium abscessus subsp. bolletii str. GO 147  2e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium abscessus]   
. .Rhodococcus triatomae.......................... 147  2e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-dependent oxidoreductase [Rhodococcus...   
. .Streptomyces rimosus subsp. rimosus ATCC 10970. 147  3e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: putative oxidoreductase [St...   
. .Streptomyces sp. NRRL S-378.................... 147  3e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium abscessus subsp. bolletii CCUG 48 147  3e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium abscessus]   
. .Streptomyces sp. CNH189........................ 147  4e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNH189]   
. .Micromonospora aurantiaca...................... 147  4e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora aurant...   
. .Micromonospora globosa......................... 147  4e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora globosa]    
. .Streptomyces flavogriseus ATCC 33331........... 147  5e-37  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces flavogri...   
. .Streptomyces auratus........................... 147  6e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces auratus]      
. .Streptomyces fulvoviolaceus.................... 147  6e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces fulvovio...   
. .Streptomyces aurantiacus....................... 147  7e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Glycolate oxidase subunit GlcD [...   
. .Streptomyces sp. BoleA5........................ 146  7e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. BoleA5]   
. .Streptomyces megasporus........................ 146  7e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces megasporus]   
. .Actinoplanes friuliensis DSM 7358.............. 146  7e-37  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain-containing prot...   
. .Kitasatospora cheerisanensis KCTC 2395......... 146  8e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Kitasatospora cheerisanens...   
. .Streptomyces sp. NRRL S-241.................... 146  9e-37  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. HGB0020....................... 146  1e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase, subunit GlcD [Streptom...   
. .Streptomyces sp. CNB091........................ 146  1e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNB091]   
. .Streptomyces sp. NRRL S-31..................... 146  1e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Blastococcus saxobsidens....................... 146  1e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Blastococcus saxobsid...   
. .Streptomyces durhamensis....................... 145  1e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces durhamen...   
. .Streptomyces mutabilis......................... 145  1e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces mutabilis]         
. .Streptomyces avermitilis....................... 145  2e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces avermiti...   
. .Streptomyces sp. NRRL F-2580................... 145  2e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium abscessus M93.................... 145  2e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium abscessus]   
. .Streptomyces sp. CNH287........................ 145  2e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNH287]   
. .Streptomyces cyaneofuscatus.................... 145  2e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces cyaneofu...   
. .Streptomyces violaceorubidus................... 145  2e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces violaceo...   
. .Streptomyces vitaminophilus.................... 145  2e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces vitamino...   
. .Rhodococcus equi............................... 145  2e-36  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus equi]          
. .Streptomyces bingchenggensis................... 145  3e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces bingchen...   
. .Microbacterium................................. 145  3e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Microba...   
. .Micromonospora sp. L5.......................... 145  3e-36  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora sp. L5]     
. .Streptomyces sp. GXT6.......................... 145  3e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. GXT6]     
. .Streptomyces sp. PCS3-D2....................... 145  3e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. PCS3-D2]       
. .Streptomyces monomycini........................ 144  4e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces monomycini]   
. .Streptomyces thermolilacinus................... 144  4e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces thermoli...   
. .Geodermatophilaceae bacterium URHB0048......... 144  5e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Geodermatophilaceae b...   
. .Streptomyces anulatus.......................... 144  5e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces anulatus]     
. .Microbispora sp. NRRL B-24597.................. 144  5e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Microbispora sp. NRRL...   
. .Streptomyces sp. NRRL F-5727................... 144  5e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces xanthophaeus...................... 144  5e-36  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces xanthoph...   
. .Blastococcus sp. URHD0036...................... 144  5e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Blastococcus sp. URHD...   
. .Streptomyces lavendulae........................ 144  6e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces lavendulae]   
. .Mycobacterium sp. URHD0025..................... 144  6e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. URH...   
. .Streptomyces griseoflavus...................... 144  6e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces griseofl...   
. .Streptomyces sp. CNT372........................ 144  6e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNT372]   
. .Streptomyces sp. NRRL F-2664................... 144  6e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces rapamycinicus NRRL 5491........... 144  6e-36  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces rapamyci...   
. .Streptomyces cattleya.......................... 144  7e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces cattleya]     
. .Streptomyces flavovariabilis................... 144  7e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces flavovar...   
. .Gordonia neofelifaecis......................... 144  8e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia neofelifaecis]    
. .Streptomyces sp. FxanaC1....................... 143  8e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. Fxan...   
. .Streptomyces cattleya NRRL 8057................ 143  8e-36  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces cattleya]     
. .Streptomyces sp. CcalMP-8W..................... 143  9e-36  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. Ccal...   
. .Streptomyces clavuligerus...................... 143  9e-36  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces clavulig...   
. .Mycobacterium.................................. 143  9e-36  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Mycobac...   
. .Mycobacterium chelonae group................... 143  1e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Mycobac...   
. .Mycobacterium abscessus 94..................... 143  1e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium abscessus]   
. .Streptomyces erythrochromogenes................ 143  1e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces erythroc...   
. .Streptomyces clavuligerus ATCC 27064........... 143  1e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces clavulig...   
. .Glycomyces sp. NRRL B-16210.................... 143  1e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Glycomyces sp. NRRL B...   
. .Rhodococcus jostii RHA1........................ 142  1e-35  6 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Rhodoco...   
. .Streptomyces sp. C34(2013)..................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. C34(...   
. .Kribbella catacumbae........................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Kribbella catacumbae]      
. .Nakamurella multipartita....................... 142  2e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nakamurella multipart...   
. .Streptomyces sp. 303MFCol5.2................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. 303M...   
. .Streptomyces sp. R1-NS-10...................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. R1-N...   
. .Streptomyces sp. W007.......................... 142  2e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. W007]     
. .Streptomyces chartreusis....................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces chartreu...   
. .Streptomyces niveus NCIMB 11891................ 142  2e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces niveus NCIMB ...   
. .Streptomyces sp. AA4........................... 142  2e-35  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. AA4]      
. .Streptomyces aureocirculatus................... 142  2e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces aureocir...   
. .Microtetraspora glauca......................... 142  3e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Microtetraspora glauca]    
. .Streptomycetaceae bacterium MP113-05........... 142  3e-35  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-binding protein [Streptomycetaceae ba...   
. .Intrasporangium oryzae NRRL B-24470............ 142  3e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Intrasporangium oryzae NRR...   
. .Gordonia amarae................................ 142  3e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia amarae]           
. .Streptomyces sp. NRRL F-5555................... 142  4e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL S-1813................... 141  4e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL F-4474................... 141  4e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Gordonia effusa................................ 141  4e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia effusa]           
. .Streptomyces viridochromogenes................. 141  4e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces viridoch...   
. .Streptomyces varsoviensis...................... 141  4e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces varsovie...   
. .Rhodococcus equi ATCC 33707.................... 141  4e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus equi]          
. .Streptomyces violaceusniger Tu 4113............ 141  5e-35  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces violaceu...   
. .Streptomyces sp. NRRL S-1824................... 141  5e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces afghaniensis...................... 141  5e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative Glycolate oxidase subunit GlcD [...   
. .Nakamurella multipartita DSM 44233............. 141  5e-35  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nakamurella multipart...   
. .Dietzia cinnamea............................... 141  5e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Dietzia cinnamea]          
. .Streptomyces sp. HPH0547....................... 141  6e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glycolate oxidase, subunit ...   
. .Streptomyces zinciresistens.................... 141  6e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces zincires...   
. .Streptomyces coelicoflavus ZG0656.............. 141  6e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase subunit [Streptomyces coelicofl...   
. .Nocardia seriolae N-2927....................... 141  7e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding protein [Nocardia...   
. .Nocardia seriolae.............................. 141  7e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardia seriolae]         
. .Gordonia terrae................................ 141  7e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia terrae]           
. .Streptomyces sp. NRRL S-37..................... 141  7e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL WC-3774.................. 140  7e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces himastatinicus ATCC 53653......... 140  8e-35  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces himastat...   
. .Streptomyces catenulae......................... 140  8e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces catenulae]    
. .Gordonia terrae C-6............................ 140  9e-35  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD/FMN-dependent dehydrogenase [Gordonia...   
. .Streptomyces sp. NRRL F-2202................... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL F-5639................... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. So1WspMP-so12th............... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. SolW...   
. .Streptomyces sp. NRRL S-87..................... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Nocardia brasiliensis.......................... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardia brasiliensis]     
. .Streptomyces sp. NRRL S-813.................... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces scabiei........................... 140  1e-34  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces scabiei]           
. .Streptomyces sp. HmicA12....................... 140  1e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. Hmic...   
. .Streptomyces puniceus.......................... 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces puniceus]     
. .Streptomyces seoulensis........................ 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces seoulensis]   
. .Mycobacterium mageritense DSM 44476............ 140  1e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding [Mycobacterium ma...   
. .Streptomyces hygroscopicus subsp. jinggangensis 140  1e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces hygrosco...   
. .Streptomyces sp. NRRL S-475.................... 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Arthrobacter chlorophenolicus.................. 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Arthrobacter chloroph...   
. .Streptomyces sp. NRRL WC-3641.................. 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces collinus.......................... 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: (S)-2-hydroxy-acid oxidase [Streptomyces ...   
. .Rhodococcus opacus B4.......................... 140  2e-34  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus opacus]        
. .Streptomyces sp. NRRL B-3229................... 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL S-146.................... 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces olivaceus......................... 140  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces olivaceus]    
. .Streptomyces acidiscabies...................... 139  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces acidisca...   
. .Streptomyces turgidiscabies.................... 139  2e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative glycolate oxidase, subunit GlcD ...   
. .Streptomyces sp. NRRL S-1022................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces albus J1074....................... 139  3e-34  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: Oxidoreductase subunit [Str...   
. .Streptomyces sp. NRRL S-646.................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL B-1347................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL S-15..................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Micromonospora sp. CNB394...................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora sp. CN...   
. .Gordonia alkanivorans.......................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia alkanivorans]     
. .Rhodococcus pyridinivorans..................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus pyridiniv...   
. .Streptomyces sp. NRRL F-2799................... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces roseochromogenus.................. 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces roseochr...   
. .Gordonia alkanivorans CGMCC 6845............... 139  3e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia alkanivorans CGMC...   
. .Streptomyces roseochromogenes subsp. oscitans D 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces roseochromoge...   
. .Mycobacterium gilvum........................... 139  4e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium gilvum]      
. .Streptomyces baarnensis........................ 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces baarnensis]   
. .Streptomyces somaliensis....................... 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces somalien...   
. .Mycobacterium farcinogenes..................... 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding [Mycobacterium fa...   
. .Gordonia rubripertincta........................ 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia rubripertincta]   
. .Gordonia soli.................................. 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Gordonia soli]    
. .Micromonospora purpureochromogenes............. 139  4e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora purpur...   
. .Streptomyces prunicolor........................ 139  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces prunicolor]   
. .Streptomyces resistomycificus.................. 139  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces resistom...   
. .Streptomyces glaucescens....................... 138  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding [Streptomyces glau...   
. .Rhodococcus defluvii........................... 138  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. Ca11]      
. .Streptomyces sp. CNS606........................ 138  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNS606]   
. .Rhodococcus sp. R1101.......................... 138  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. R1101]     
. .Streptomyces sp. 351MFTsu5.1................... 138  5e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. 351M...   
. .Streptomyces sp. S4............................ 138  6e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. S4]       
. .Streptomyces sp. NRRL F-5008................... 138  6e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Gordonia amicalis.............................. 138  6e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia amicalis]         
. .Rhodococcus sp. AW25M09........................ 138  6e-34  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain protein [Rhodoc...   
. .Propionibacterium acidipropionici.............. 138  6e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain-containing prot...   
. .Mycobacterium gilvum PYR-GCK................... 138  6e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium gilvum]      
. .Streptomyces sp. ScaeMP-e10.................... 138  6e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. Scae...   
. .Gordonia amicalis NBRC 100051.................. 138  6e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Gordonia ami...   
. .Streptomyces sp. NRRL F-5123................... 138  7e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces lavenduligriseus.................. 138  7e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces lavendul...   
. .Streptomyces griseus XylebKG-1................. 138  8e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces griseus]      
. .Streptomyces sp. NRRL F-2305................... 138  8e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces griseorubens...................... 138  9e-34  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces griseorubens]      
. .Streptomyces sp. CNY228........................ 138  9e-34  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNY228]   
. .Streptomyces wadayamensis...................... 138  1e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces wadayamensis]      
. .Streptomyces sp. NRRL F-2890................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium sp. UNC410CL29Cvi84.............. 137  1e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. UNC...   
. .Streptomyces bicolor........................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces bicolor]      
. .Gordonia namibiensis........................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia namibiensis]      
. .Streptomyces fulvissimus....................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Oxidoreductase subunit [Streptomyces fulv...   
. .Streptomyces sp. NRRL S-1314................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium sp. 360MFTsu5.1.................. 137  1e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. 360...   
. .Streptomyces sp. NRRL F-5527................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL B-3253................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces gancidicus........................ 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: (S)-2-hydroxy-acid oxidase [Streptomyces ...   
. .Streptomyces roseoverticillatus................ 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces roseover...   
. .Gordonia otitidis.............................. 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia otitidis]         
. .Rhodococcus equi NBRC 101255................... 137  1e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-dependent oxidoreductase [Rhodococcus...   
. .Streptomyces griseus subsp. griseus NBRC 13350. 137  1e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces griseus]      
. .Streptomyces sp. NRRL WC-3626.................. 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Tetrasphaera australiensis Ben110.............. 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain protein [Tetrasphae...   
. .Mycobacterium sp. UM_WWY....................... 137  2e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. UM_...   
. .Streptomyces sp. URHA0041...................... 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. URHA...   
. .Mycobacterium smegmatis JS623.................. 137  2e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD/FMN-dependent dehydrogenase [Mycobact...   
. .Propionibacterium.............................. 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: hypothetical protein [Propi...   
. .Streptomyces sp. PsTaAH-124.................... 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. PsTa...   
. .Streptomyces venezuelae........................ 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces venezuelae]   
. .Streptomyces peruviensis....................... 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces peruvien...   
. .Streptomyces sp. Tu 6176....................... 137  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. Tu 6176]       
. .Granulicoccus phenolivorans.................... 136  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Granulicoccus phenoli...   
. .Mycobacterium sp. 141.......................... 136  2e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. 141]     
. .Streptomyces scopuliridis...................... 136  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces scopulir...   
. .Mycobacterium vulneris......................... 136  2e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding [Mycobacterium vu...   
. .Streptomyces sp. LaPpAH-108.................... 136  3e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. LaPp...   
. .Mycobacterium fortuitum........................ 136  3e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium fortuitum]   
. .Mycobacterium xenopi........................... 136  3e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium xenopi]      
. .Streptomyces bottropensis...................... 136  3e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase [Streptomyces bottropensis]     
. .Rhodococcus ruber.............................. 136  3e-33  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus ruber]         
. .Streptomyces ipomoeae.......................... 136  3e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative glycolate oxidase, subunit GlcD ...   
. .Streptomyces purpeofuscus...................... 136  3e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces purpeofu...   
. .Amycolicicoccus subflavus...................... 136  4e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Amycolicicoccus subfl...   
. .Pilimelia anulata.............................. 135  4e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Pilimelia anulata]         
. .Leucobacter chromiiresistens................... 135  4e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Leucobacter chromiire...   
. .Nocardia asteroides............................ 135  4e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardia asteroides]       
. .Gordonia bronchialis........................... 135  5e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia bronchialis]      
. .Gordonia sp. KTR9.............................. 135  5e-33  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia sp. KTR9]         
. .Streptomyces sp. NRRL S-350.................... 135  6e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces lividans.......................... 135  6e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces lividans]     
. .Streptomyces sp. NRRL B-24484.................. 135  6e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces lividans 1326..................... 135  7e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Fe-S protein, lactate dehydrogenase [Stre...   
. .Streptomyces sp. NRRL F-5140................... 135  7e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Terracoccus sp. 273MFTsu3.1.................... 135  8e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Terracoccus sp. 273...   
. .Streptomyces achromogenes...................... 135  8e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces achromog...   
. .Mycobacterium sp. 155.......................... 135  8e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. 155]     
. .Gordonia malaquae.............................. 135  8e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Gordonia mal...   
. .Mycobacterium chubuense........................ 135  9e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium chubuense]   
. .Streptomyces katrae............................ 135  9e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces katrae]       
. .Mycobacterium Tuberculosis TKK-01-0059......... 135  9e-33  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit GlcD [Mycobacterium ...   
. .Mycobacterium intracellulare MOTT-64........... 135  9e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Mycobac...   
. .Streptomyces sp. C............................. 135  1e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. C]        
. .Nocardia sp. 348MFTsu5.1....................... 134  1e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardia sp. 348MFTsu...   
. .Rhodococcus sp. EsD8........................... 134  1e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase, subunit GlcD (glcD) [R...   
. .Streptomyces sp. NRRL WC-3742.................. 134  1e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Rhodococcus sp. BCP1........................... 134  1e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. BCP1]      
. .Streptomyces sp. NRRL F-5650................... 134  2e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. e14........................... 134  2e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. e14]      
. .Nocardia sp. BMG111209......................... 134  2e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardia sp. BMG111209]    
. .Mycobacterium rhodesiae NBB3................... 134  2e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium rhodesiae]   
. .Streptomyces sp. Ame12xE9...................... 134  2e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. Amel...   
. .Streptomyces scabiei 87.22..................... 134  2e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces scabiei]      
. .Micromonospora chokoriensis.................... 134  2e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora chokor...   
. .Rhodococcus rhodnii............................ 134  2e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase FAD-linked subunit [Rho...   
. .Streptomyces coelicolor........................ 134  3e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces coelicolor]   
. .Nocardiopsis alba ATCC BAA-2165................ 134  3e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardiopsis alba]         
. .Mycobacterium avium 2285 (S)................... 133  3e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD binding domain protein [Mycobacterium aviu...   
. .Mycobacterium sp. M05.......................... 133  3e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium iranicum]    
. .Mycobacterium indicus pranii................... 133  3e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium indicus...   
. .Mycobacterium intracellulare................... 133  3e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium intrace...   
. .Mycobacterium phlei RIVM601174................. 133  3e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium phlei]       
. .Streptomyces davawensis........................ 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding protein [Stre...   
. .Dietzia sp. UCD-THP............................ 133  4e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Dietzia sp. UCD-THP]       
. .Arthrobacter globiformis....................... 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Arthrobacter globifor...   
. .Rhodococcus sp. P14............................ 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus sp. P14]       
. .Micromonospora sp. M42......................... 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase, FAD-binding [Micromonospora sp...   
. .Streptomyces sp. CNT360........................ 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNT360]   
. .Verrucosispora maris........................... 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Verrucosispora maris]      
. .Tetrasphaera japonica T1-X7.................... 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase domain protein [Tetrasphae...   
. .Streptacidiphilus jeojiense.................... 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptacidiphilus jeo...   
. .Streptomyces sp. SS............................ 133  4e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. SS]       
. .Streptomyces sp. NRRL S-118.................... 132  5e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Streptomyces sp. NRRL F-2747................... 132  6e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium kansasii 732..................... 132  6e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD binding domain protein [Mycobacterium kans...   
. .Gordonia kroppenstedtii........................ 132  6e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Gordonia kroppenste...   
. .Mycobacterium sp. MCS.......................... 132  6e-32  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: FAD-linked oxidase [Mycobac...   
. .Intrasporangiaceae bacterium URHB0013.......... 132  6e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Intrasporangiaceae ba...   
. .Streptomyces sp. NRRL F-6131................... 132  7e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Mycobacterium colombiense...................... 132  7e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium colombi...   
. .Mycobacterium parascrofulaceum................. 132  7e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium parascr...   
. .Nocardia otitidiscaviarum...................... 132  8e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Nocardia otitidiscavi...   
. .Streptomyces sulphureus........................ 132  8e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sulphureus]   
. .Sporichthya polymorpha......................... 132  8e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Sporichthya polymor...   
. .Gordonia araii................................. 132  8e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia araii]            
. .Stackebrandtia nassauensis DSM 44728........... 132  9e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Stackebrandtia nassau...   
. .Mycobacterium avium............................ 132  9e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium avium]       
. .Gordonia rhizosphera........................... 132  1e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia rhizosphera]      
. .Streptomyces sp. NRRL S-244.................... 132  1e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. NRRL...   
. .Kribbella flavida.............................. 132  1e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Kribbella flavida]         
. .Streptomyces viridochromogenes Tue57........... 132  1e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative (S)-2-hydroxy-acid oxidase [Stre...   
. .Tetrasphaera elongata.......................... 132  1e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Glycolate oxidase subunit glcD [Tetraspha...   
. .Mycobacterium rufum............................ 131  1e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium rufum]            
. .Mycobacterium sp. UM_WGJ....................... 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium sp. UM_...   
. .Brevibacterium album........................... 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Brevibacterium album]      
. .Streptomyces sp. CNH099........................ 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sp. CNH099]   
. .Gordonia paraffinivorans....................... 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Gordonia par...   
. .Gordonia shandongensis......................... 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia shandongensis]    
. .Streptomyces tsukubaensis...................... 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces tsukubae...   
. .Corynebacterium casei LMG S-19264.............. 130  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit [Corynebacterium cas...   
. .Rhodococcus rhodnii LMG 5362................... 130  3e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative D-lactate dehydrogenase [Rhodoco...   
. .Rhodococcus triatomae BKS 15-14................ 130  3e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glycolate oxidase subunit [Rhodococcus tr...   
. .Micromonospora lupini.......................... 130  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Micromonospora lupini]     
. .Nocardia nova SH22a............................ 130  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD/FMN-dependent dehydrogenase [Noca...   
. .Mycobacterium avium MAV_120709_2344............ 130  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD binding domain protein [Mycobacterium aviu...   
. .Rhodococcus imtechensis RKJ300................. 130  3e-31  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus imtechensis]   
. .Mycobacterium avium subsp. paratuberculosis K-1 130  3e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium avium]       
. .Corynebacterium casei.......................... 130  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Corynebacterium casei]     
. .Gordonia neofelifaecis NRRL B-59395............ 130  3e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Gordonia neofelifaecis]    
. .Mycobacterium avium subsp. hominissuis 10-4249. 130  3e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium avium]       
. .Rhodococcus qingshengii BKS 20-40.............. 130  3e-31  3 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Rhodococcus qingshengii]   
. .Mycobacterium kansasii 824..................... 130  3e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD linked oxidase, C-terminal domain protein ...   
. .Mycobacterium hassiacum........................ 130  4e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium hassiacum]   
. .Nocardioides sp. J54........................... 130  4e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Nocardioides sp. J54]    
. .Gordonia sihwensis............................. 130  4e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative FAD-linked oxidase [Gordonia sih...   
. .Mycobacterium avium subsp. paratuberculosis 11- 130  5e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium avium]       
. .Mycobacterium gastri 'Wayne'................... 130  5e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium gastri 'Wayne']   
. .Brevibacterium senegalense..................... 130  5e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Brevibacterium sp. ...   
. .Segniliparus rotundus.......................... 130  5e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Segniliparus rotundus]     
. .Rhodococcus erythropolis DN1................... 130  5e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: oxidoreductase [Rhodococcus erythropolis]      
. .Mycobacterium kansasii 662..................... 130  6e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium kansasii 662]     
. .Mycobacterium vanbaalenii...................... 130  6e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium vanbaal...   
. .Mycobacterium kansasii......................... 129  6e-31  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Mycobacterium kansasii]    
. .Brevibacterium sp. VCM10....................... 129  6e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Brevibacterium sp. VC...   
. .Streptomyces sp. DUT180........................ 129  7e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: FAD-linked oxidase [Streptomyces sulphureus]   
. .Solirubrobacter soli........................... 263  2e-80  1 hit   Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: glycolate oxidase subunit GlcD [Solirubro...   
. .Rubrobacter xylanophilus....................... 262  2e-80  1 hit   Bacteria:Actinobacteria:Actinobacteria:Rubrobacterales: FAD-binding protein [Rubrobacter xylanoph...   
. .Rubrobacter radiotolerans...................... 251  4e-76  1 hit   Bacteria:Actinobacteria:Actinobacteria:Rubrobacterales: FAD/FMN-containing dehydrogenase [Rubrobacter ...   
. .Solirubrobacter sp. URHD0082................... 250  8e-76  1 hit   Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: glycolate oxidase subunit GlcD [Solirubro...   
. .actinobacterium acAcidi........................ 231  1e-68  1 hit   Bacteria:Actinobacteria:Actinobacteria:  putative oxidase [actinobacterium acAcidi]          
. .Acidimicrobidae bacterium YM16-304............. 214  8e-62  1 hit   Bacteria:Actinobacteria:Actinobacteria:  putative oxidase [Ilumatobacter coccineus]     
. .Acidimicrobium ferrooxidans.................... 206  8e-59  1 hit   Bacteria:Actinobacteria:Actinobacteria:Acidimicrobiales: FAD-binding protein [Acidimicrobium ferro...   
. .actinobacterium SCGC AAA044-D11................ 152  6e-39  1 hit   Bacteria:Actinobacteria:Actinobacteria:  FAD-binding protein [actinobacterium SCGC...   
. .Patulibacter minatonensis...................... 132  8e-32  1 hit   Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: FAD-linked oxidase [Patulibacter minatone...   
. .Conexibacter woesei............................ 131  2e-31  1 hit   Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: FAD-linked oxidase [Conexibacter woesei]       
. .Thermus igniterrae............................. 270  2e-83  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus igniterrae]       
. .Thermus oshimai................................ 266  3e-82  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD/FMN-dependent dehydrogenase [Thermus ...   
. .Thermus sp. RLM................................ 265  2e-81  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus sp. RL]           
. .Thermus thermophilus........................... 264  3e-81  7 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus thermophilus]     
. .Thermus sp. CCB_US3_UF1........................ 263  5e-81  6 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus sp. CCB_US3_...   
. .Thermus thermophilus JL-18..................... 260  1e-79  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus thermophilus]     
. .Thermus thermophilus HB27...................... 259  1e-79  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus thermophilus]     
. .Thermus thermophilus HB8....................... 258  4e-79  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus thermophilus]     
. .Thermus antranikianii.......................... 258  7e-79  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glycolate oxidase subunit GlcD [Thermus a...   
. .Thermus scotoductus............................ 257  1e-78  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus scotoductus]      
. .Thermus aquaticus.............................. 255  6e-78  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus aquaticus]        
. .Thermus islandicus............................. 244  8e-74  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Thermus islandicus]       
. .Thermus scotoductus SA-01...................... 167  2e-44  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Thermus scotoductus]   
. .Thermus aquaticus Y51MC23...................... 152  5e-39  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Thermus aquaticus]     
. .Thermus sp. NMX2.A1............................ 151  8e-39  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Thermus sp. NMX2.A1]        
. .Thermus thermophilus SG0.5JP17-16.............. 149  5e-38  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Thermus thermophi...   
. .Thermus oshimai JL-2........................... 145  1e-36  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD/FMN-dependent dehydrogenase [Thermus ...   
. .Meiothermus taiwanensis........................ 267  3e-82  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glycolate oxidase subunit GlcD [Meiotherm...   
. .Meiothermus ruber.............................. 263  1e-80  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Meiothermus ruber]        
. .Meiothermus cerbereus.......................... 261  8e-80  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glycolate oxidase subunit GlcD [Meiotherm...   
. .Meiothermus silvanus........................... 260  2e-79  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: FAD-binding protein [Meiothermus silvanus]     
. .Meiothermus chliarophilus...................... 252  2e-76  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glycolate oxidase subunit GlcD [Meiotherm...   
. .Meiothermus rufus.............................. 250  1e-75  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glycolate oxidase subunit GlcD [Meiotherm...   
. .Meiothermus ruber DSM 1279..................... 169  6e-45  8 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Meiothermus ruber]     
. .Meiothermus silvanus DSM 9946.................. 166  7e-44  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Meiothermus silva...   
. .Oceanithermus profundus........................ 160  7e-42  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Oceanithermus pro...   
. .Marinithermus hydrothermalis................... 154  8e-40  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Marinithermus hyd...   
. .Meiothermus timidus............................ 145  2e-36  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: 2-hydroxy-acid oxidase [Meiothermus timidus]   
. .Truepera radiovictrix.......................... 265  2e-81  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: FAD-binding protein [Truepera radiovictrix]    
. .Deinococcus radiodurans........................ 161  3e-42  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus radio...   
. .Deinococcus aquatilis.......................... 159  1e-41  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus aquat...   
. .Deinococcus sp. RL............................. 159  4e-41  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus sp. RL]         
. .Deinococcus murrayi............................ 158  4e-41  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus murrayi]   
. .Deinococcus phoenicis.......................... 153  4e-39  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: FAD linked oxidase-like protein [Deinococcus p...   
. .Deinococcus geothermalis....................... 150  3e-38  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus geoth...   
. .Deinococcus apachensis......................... 149  1e-37  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus apach...   
. .Deinococcus frigens............................ 147  6e-37  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus frigens]   
. .Deinococcus deserti............................ 144  5e-36  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus deserti]   
. .Deinococcus marmoris........................... 143  1e-35  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus marmo...   
. .Deinococcus sp. 2009........................... 142  3e-35  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus sp. 2...   
. .Deinococcus ficus.............................. 142  3e-35  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus ficus]     
. .Deinococcus xibeiensis......................... 140  8e-35  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: hypothetical protein [Deinococcus xibeien...   
. .Deinococcus proteolyticus...................... 134  2e-32  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: 2-hydroxy-acid oxidase [Deinococcus prote...   
. .Ktedonobacter racemifer........................ 266  5e-82  2 hits  Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: FAD-binding protein [Ktedonobacter racemi...   
. .Ktedonobacter racemifer DSM 44963.............. 220  4e-62  2 hits  Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: D-lactate dehydrogenase (cytochrome) [Kte...   
. .Thermomicrobium roseum......................... 251  4e-76  1 hit   Bacteria:Chloroflexi:Thermomicrobia:Thermomicrobiales: FAD-binding protein [Thermomicrobium roseum]   
. .Sphaerobacter thermophilus..................... 251  5e-76  1 hit   Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: FAD-binding protein [Sphaerobacter thermo...   
. .Caldilinea aerophila........................... 250  7e-76  2 hits  Bacteria:Chloroflexi:Caldilineae:Caldilineales: FAD-binding protein [Caldilinea aerophila]     
. .Oscillochloris trichoides...................... 236  3e-70  3 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: FAD-binding protein [Oscillochloris trich...   
. .Roseiflexus sp. RS-1........................... 216  1e-62  6 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: FAD-binding protein [Roseiflexus sp. RS-1]     
. .Chloroflexus aggregans......................... 215  3e-62  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: FAD-binding protein [Chloroflexus aggregans]   
. .Chloroflexus sp. Y-396-1....................... 214  5e-62  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glycolate oxidase subunit GlcD [Chlorofle...   
. .Roseiflexus castenholzii....................... 214  7e-62  2 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: FAD-binding protein [Roseiflexus castenho...   
. .Caldilinea aerophila DSM 14535................. 209  5e-58  4 hits  Bacteria:Chloroflexi:Caldilineae:Caldilineales: glycolate oxidase subunit GlcD [Caldiline...   
. .Roseiflexus castenholzii DSM 13941............. 206  8e-57  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: lactate dehydrogenase [Roseiflexus casten...   
. .Chloroflexus aurantiacus....................... 204  2e-58  1 hit   Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: FAD-binding protein [Chloroflexus auranti...   
. .Chloroflexus................................... 204  3e-58  3 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: MULTISPECIES: FAD-binding protein [Chloro...   
. .Chloroflexus sp. MS-G.......................... 204  5e-58  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glycolate oxidase subunit GlcD [Chlorofle...   
. .Chloroflexus aggregans DSM 9485................ 201  4e-57  8 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: FAD-binding protein [Chloroflexus aggregans]   
. .Chloroflexus aurantiacus J-10-fl............... 183  9e-49  8 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: MULTISPECIES: lactate dehydrogenase [Chlo...   
. .Chloroflexus sp. Y-400-fl...................... 179  1e-47  9 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: MULTISPECIES: lactate dehydrogenase [Chlo...   
. .Oscillochloris trichoides DG-6................. 175  3e-46  3 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: lactate dehydrogenase [Oscillochloris tri...   
. .Leptolyngbya sp. PCC 6406...................... 263  1e-80  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD/FMN-dependent dehydrogenase [Leptolyn...   
. .Leptolyngbya boryana........................... 261  7e-80  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Leptolyng...   
. .Leptolyngbya sp. PCC 7375...................... 259  6e-79  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase, subunit GlcD [Leptolyn...   
. .Leptolyngbya nodulosa.......................... 257  2e-78  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Nodosilinea nodulosa]     
. .Leptolyngbya sp. Heron Island J................ 254  3e-77  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Leptolyngbya sp. He...   
. .Leptolyngbya sp. PCC 7376...................... 254  3e-77  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Leptolyng...   
. .Geitlerinema sp. PCC 7407...................... 262  4e-80  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Geitlerin...   
. .Oscillatoriales cyanobacterium JSC-12.......... 258  1e-78  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase, subunit GlcD [Oscillat...   
. .Coleofasciculus chthonoplastes................. 256  4e-78  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Coleofasciculus chth...   
. .Pseudanabaena biceps........................... 253  1e-76  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase, subunit GlcD [Pseudana...   
. .Planktothrix prolifica......................... 249  2e-75  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Planktoth...   
. .Planktothrix rubescens......................... 249  2e-75  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Planktoth...   
. .Planktothrix agardhii.......................... 249  3e-75  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Planktoth...   
. .Planktothrix agardhii NIVA-CYA 126/8........... 249  3e-75  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  GlcD [Planktothrix agardhii NIVA-CYA 126/8]         
. .Planktothrix................................... 249  4e-75  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: glycolate oxidase subunit G...   
. .Oscillatoria acuminata......................... 249  4e-75  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Oscillato...   
. .Crinalium epipsammum........................... 248  9e-75  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Crinalium...   
. .Oscillatoria nigroviridis...................... 246  5e-74  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase, subunit GlcD [Oscillat...   
. .Microcoleus vaginatus.......................... 244  2e-73  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Microcoleus vaginatus]    
. .Pseudanabaena sp. PCC 7367..................... 244  3e-73  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Pseudanab...   
. .Trichodesmium erythraeum....................... 244  3e-73  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Trichodesmium erythr...   
. .Moorea producta................................ 243  4e-73  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Moorea producens]         
. .Oscillatoria sp. PCC 10802..................... 243  5e-73  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Oscillatoria sp. PCC...   
. .Microcoleus sp. PCC 7113....................... 243  9e-73  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Microcole...   
. .Spirulina subsalsa............................. 242  2e-72  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Spirulina subsalsa]       
. .Kamptonema..................................... 239  3e-71  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: FAD-binding protein [Kampto...   
. .Geitlerinema sp. PCC 7105...................... 236  5e-70  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Geitlerinema sp. PCC...   
. .Lyngbya sp. PCC 8106........................... 235  5e-70  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [Lyngbya sp. PCC 8106]     
. .filamentous cyanobacterium ESFC-1.............. 233  5e-69  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  FAD-binding protein [filamentous cyanobac...   
. .Pseudanabaena sp. PCC 6802..................... 230  8e-68  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase subunit GlcD [Pseudanab...   
. .Arthrospira.................................... 226  1e-66  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: FAD-binding protein [Arthro...   
. .Arthrospira platensis.......................... 225  4e-66  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase GlcD [Arthrospira plate...   
. .Lyngbya aestuarii.............................. 218  2e-63  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glycolate oxidase, subunit GlcD [Lyngbya ...   
. .Cyanobacterium stanieri........................ 261  9e-80  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Cyanobact...   
. .Synechococcus sp. JA-3-3Ab..................... 261  1e-79  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. JA...   
. .Synechococcus sp. PCC 7336..................... 261  1e-79  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. PC...   
. .Synechococcus sp. JA-2-3B'a(2-13).............. 261  2e-79  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. JA...   
. .Halothece sp. PCC 7418......................... 258  8e-79  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Halothece...   
. .Synechococcus elongatus........................ 258  8e-79  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus elonga...   
. .Synechococcus elongatus PCC 7942............... 258  9e-79  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus elonga...   
. .Crocosphaera watsonii.......................... 258  9e-79  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Crocosphaera watsonii]    
. .Cyanothece sp. CCY0110......................... 258  2e-78  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanothece sp. CCY0110]   
. .Crocosphaera watsonii WH 8502.................. 256  5e-78  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Glycolate dehydrogenase, subunit GlcD [Cr...   
. .Synechococcus sp. PCC 6312..................... 256  8e-78  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD/FMN-dependent dehydrogenase [Synechoc...   
. .Cyanothece..................................... 256  8e-78  1 hit   Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: FAD-binding protein [Cyanot...   
. .Raphidiopsis brookii........................... 256  1e-77  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Raphidiopsis brookii]     
. .Chamaesiphon minutus........................... 255  1e-77  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Chamaesi...   
. .Mastigocladopsis repens........................ 255  1e-77  1 hit   Bacteria:Cyanobacteria:Stigonematales:   FAD-binding protein [Mastigocladopsis rep...   
. .Gloeocapsa sp. PCC 7428........................ 255  1e-77  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Gloeocap...   
. .Gloeocapsa sp. PCC 73106....................... 254  3e-77  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Gloeocap...   
. .Cyanothece sp. PCC 7425........................ 254  3e-77  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanothece sp. PCC 7...   
. .Gloeobacter kilaueensis........................ 254  4e-77  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: glycolate oxidase subunit GlcD [Gloeobact...   
. .Cylindrospermopsis raciborskii................. 254  4e-77  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Cylindrospermopsis r...   
. .Calothrix sp. PCC 7507......................... 254  5e-77  3 hits  Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Calothrix...   
. .Microchaete sp. PCC 7126....................... 253  9e-77  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Microchae...   
. .Cyanothece sp. PCC 7822........................ 253  1e-76  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanothece sp. PCC 7...   
. .Synechococcus sp. WH 5701...................... 253  2e-76  4 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. WH...   
. .Scytonema hofmanni............................. 252  3e-76  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Scytonema hofmanni]       
. .Synechococcus sp. CAUP A 1101.................. 251  5e-76  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Synechococcus ...   
. .Synechococcus sp. PCC 7502..................... 251  7e-76  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Synechoco...   
. .Dolichospermum circinale....................... 251  8e-76  2 hits  Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Dolichosp...   
. .Thermosynechococcus sp. NK55................... 250  9e-76  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase FAD-binding subunit Glc...   
. .Nostoc sp. PCC 7524............................ 250  1e-75  3 hits  Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Nostoc sp...   
. .Aphanizomenon flos-aquae....................... 250  1e-75  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Aphanizom...   
. .Cyanobacterium aponinum........................ 250  1e-75  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Cyanobact...   
. .Tolypothrix bouteillei Iicb1................... 250  2e-75  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Tolypothrix bo...   
. .Acaryochloris marina........................... 249  2e-75  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Acaryochloris marina]     
. .Cyanothece sp. PCC 8802........................ 249  2e-75  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanothece sp. PCC 8...   
. .Cyanothece sp. PCC 8801........................ 249  2e-75  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanothece sp. PCC 8...   
. .Acaryochloris sp. CCMEE 5410................... 249  3e-75  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Acaryochloris sp. CC...   
. .Nostoc punctiforme............................. 249  3e-75  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Nostoc punctiforme]       
. .Synechocystis sp. PCC 7509..................... 249  4e-75  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Synechoc...   
. .Calothrix parietina............................ 248  6e-75  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Calothrix...   
. .Trichormus azollae............................. 248  7e-75  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Trichormus azollae]       
. .Cylindrospermum stagnale....................... 248  8e-75  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase, subunit GlcD [Cylindro...   
. .Geminocystis herdmanii......................... 248  1e-74  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Geminocystis herdmanii]   
. .Anabaena cylindrica............................ 248  1e-74  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase, subunit GlcD [Anabaena...   
. .Prochlorothrix hollandica...................... 248  1e-74  1 hit   Bacteria:Cyanobacteria:Prochlorales:     FAD-binding protein [Prochlorothrix holla...   
. .Synechocystis sp. PCC 6714..................... 248  2e-74  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Glycolate dehydrogenase, subunit GlcD [Synecho...   
. .Pleurocapsa minor.............................. 247  2e-74  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   glycolate oxidase subunit GlcD [Pleurocap...   
. .Xenococcus sp. PCC 7305........................ 247  2e-74  2 hits  Bacteria:Cyanobacteria:Pleurocapsales:   glycolate oxidase, subunit GlcD [Xenococc...   
. .Anabaena sp. 90................................ 246  4e-74  3 hits  Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Anabaena ...   
. .Calothrix sp. 336/3............................ 246  4e-74  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Calothrix sp. ...   
. .Nodularia spumigena............................ 246  6e-74  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Nodularia spumigena]      
. .Thermosynechococcus elongatus.................. 245  8e-74  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Thermosynechococcus ...   
. .Chlorogloeopsis sp. PCC 7702................... 245  1e-73  1 hit   Bacteria:Cyanobacteria:Stigonematales:   FAD-binding protein [cyanobacterium PCC 7...   
. .Synechococcus sp. NKBG15041c................... 245  1e-73  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Synechoco...   
. .Pleurocapsa sp. PCC 7319....................... 245  1e-73  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   FAD-binding protein [Pleurocapsa sp. PCC ...   
. .Anabaena sp. PCC 7108.......................... 244  2e-73  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Anabaena sp. PCC 7108]    
. .Microcystis aeruginosa......................... 244  3e-73  13 hits Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Rivularia sp. PCC 7116......................... 244  3e-73  3 hits  Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Rivularia...   
. .Stanieria cyanosphaera......................... 244  3e-73  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   glycolate oxidase, subunit GlcD [Stanieri...   
. .Cyanobium gracile.............................. 243  6e-73  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD/FMN-dependent dehydrogenase [Cyanobiu...   
. .Synechococcus sp. PCC 7002..................... 243  7e-73  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. PC...   
. .Microcystis aeruginosa SPC 777................. 243  8e-73  1 hit   Bacteria:Cyanobacteria:Chroococcales:    putative FAD-linked oxidoreductase [Micro...   
. .Microcystis aeruginosa PCC 9432................ 243  8e-73  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Fischerella sp. PCC 9605....................... 242  1e-72  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glycolate oxidase subunit GlcD [Fischerel...   
. .Fischerella.................................... 242  1e-72  1 hit   Bacteria:Cyanobacteria:Stigonematales:   MULTISPECIES: FAD-binding protein [Fische...   
. .Microcystis aeruginosa PCC 9806................ 242  2e-72  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Microcys...   
. .Microcystis aeruginosa PCC 9443................ 242  2e-72  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Microcystis aeruginosa PCC 9807................ 242  2e-72  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Microcystis aeruginosa TAIHU98................. 241  2e-72  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Microcys...   
. .Gloeobacter violaceus.......................... 241  2e-72  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: FAD-binding protein [Gloeobacter violaceus]    
. .Nostoc sp. PCC 7107............................ 241  2e-72  3 hits  Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [Nostoc sp...   
. .Microcystis aeruginosa NIES-843................ 241  2e-72  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Microcystis aeruginosa PCC 9701................ 241  3e-72  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Anabaena variabilis............................ 241  3e-72  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Anabaena variabilis]      
. .Cyanothece sp. PCC 7424........................ 241  3e-72  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanothece sp. PCC 7...   
. .Richelia intracellularis....................... 241  4e-72  1 hit   Bacteria:Cyanobacteria:Nostocales:       Glycolate dehydrogenase , subunit GlcD [Riche...   
. .[Scytonema hofmanni] UTEX 2349................. 241  4e-72  1 hit   Bacteria:Cyanobacteria:Nostocales:       glycolate oxidase subunit GlcD [ [[Scyton...   
. .Mastigocoleus testarum......................... 241  5e-72  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glycolate oxidase subunit GlcD [Mastigoco...   
. .Fischerella muscicola.......................... 241  6e-72  2 hits  Bacteria:Cyanobacteria:Stigonematales:   FAD-binding protein [Fischerella muscicola]    
. .Microcystis sp. T1-4........................... 240  8e-72  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis sp. T1-4]     
. .Chlorogloeopsis fritschii...................... 240  9e-72  1 hit   Bacteria:Cyanobacteria:Stigonematales:   FAD-binding protein [Chlorogloeopsis frit...   
. .Microcystis aeruginosa PCC 9717................ 239  1e-71  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Cyanobium sp. CACIA14.......................... 239  3e-71  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Cyanobium sp. ...   
. .Microcystis aeruginosa PCC 9808................ 238  4e-71  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Microcystis aeruginosa]   
. .Microcystis aeruginosa DIANCHI905.............. 238  4e-71  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Microcys...   
. .Microcystis aeruginosa PCC 7806................ 238  5e-71  1 hit   Bacteria:Cyanobacteria:Chroococcales:    unnamed protein product [Microcystis aerugino...   
. .Calothrix sp. PCC 7103......................... 238  6e-71  1 hit   Bacteria:Cyanobacteria:Nostocales:       FAD-binding protein [Calothrix sp. PCC 7103]   
. .Synechococcus sp. WH 7805...................... 234  2e-69  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. WH...   
. .Synechococcus sp. PCC 7335..................... 233  4e-69  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. PC...   
. .Synechococcus sp. WH 8016...................... 233  7e-69  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. WH...   
. .Cyanobium sp. PCC 7001......................... 232  8e-69  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Cyanobium sp. PCC 7001]   
. .Synechococcus sp. WH 7803...................... 231  4e-68  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. WH...   
. .Synechococcus sp. CC9311....................... 228  6e-67  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. CC...   
. .Rubidibacter lacunae........................... 227  1e-66  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase, subunit GlcD [Rubidiba...   
. .Synechococcus sp. RS9916....................... 226  2e-66  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. RS...   
. .Prochlorococcus sp. MIT 0701................... 225  3e-66  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Glycolate dehydrogenase [Prochlorococcus sp. M...   
. .Prochlorococcus sp. MIT 0702................... 225  4e-66  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Glycolate dehydrogenase [Prochlorococcus sp. M...   
. .Dactylococcopsis salina........................ 225  4e-66  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Dactyloco...   
. .Prochlorococcus marinus........................ 225  4e-66  2 hits  Bacteria:Cyanobacteria:Prochlorales:     FAD-binding protein [Prochlorococcus mari...   
. .Prochlorococcus marinus str. MIT 9313.......... 224  9e-66  2 hits  Bacteria:Cyanobacteria:Prochlorales:     FAD-binding protein [Prochlorococcus mari...   
. .Synechococcus sp. RCC307....................... 224  1e-65  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. RC...   
. .Synechococcus sp. WH 8102...................... 223  4e-65  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. WH...   
. .Synechococcus sp. CB0205....................... 221  1e-64  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Synechoco...   
. .Synechococcus sp. CB0101....................... 220  4e-64  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Synechoco...   
. .Fischerella sp. PCC 9431....................... 220  4e-64  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glycolate oxidase subunit GlcD [Fischerel...   
. .Synechococcus sp. KORDI-100.................... 219  7e-64  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. KORDI-100]   
. .Synechococcus sp. CC9616....................... 219  1e-63  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glycolate oxidase subunit GlcD [Synechoco...   
. .Fischerella sp. PCC 9339....................... 219  1e-63  1 hit   Bacteria:Cyanobacteria:Stigonematales:   FAD-binding protein [Fischerella sp. PCC ...   
. .Synechococcus sp. CC9902....................... 217  4e-63  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. CC...   
. .Synechococcus sp. RS9917....................... 217  4e-63  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. RS...   
. .Synechococcus sp. KORDI-49..................... 217  5e-63  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. KORDI-49]    
. .Synechococcus sp. WH 8109...................... 216  1e-62  1 hit   Bacteria:Cyanobacteria:Chroococcales:    putative glycolate oxidase subunit GlcD [Synec...   
. .Synechococcus sp. CC9605....................... 215  3e-62  3 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. CC...   
. .Synechococcus sp. BL107........................ 213  1e-61  2 hits  Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. BL...   
. .Synechococcus sp. KORDI-52..................... 209  3e-60  1 hit   Bacteria:Cyanobacteria:Chroococcales:    FAD-binding protein [Synechococcus sp. KORDI-52]    
. .Acidobacteria bacterium KBS 146................ 259  3e-79  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glycolate oxidase subunit GlcD [Acidobact...   
. .Acidobacteriaceae bacterium TAA166............. 259  3e-79  1 hit   Bacteria:Acidobacteria:Acidobacteriales: FAD-binding protein [Acidobacteriaceae ba...   
. .Acidobacteriaceae bacterium KBS 96............. 248  4e-75  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Acidobacteriaceae bacterium KBS 83............. 246  5e-74  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Acidobacteriaceae bacterium KBS 89............. 235  8e-70  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glycolate oxidase subunit GlcD [Acidobact...   
. .Candidatus Solibacter usitatus................. 243  4e-73  1 hit   Bacteria:Acidobacteria:Solibacteres:Solibacterales: FAD-binding protein [Candidatus Solibacte...   
. .Bryobacter aggregatus.......................... 241  4e-72  1 hit   Bacteria:Acidobacteria:                  glycolate oxidase subunit GlcD [Bryobacte...   
. .Holophaga foetida.............................. 167  2e-44  1 hit   Bacteria:Acidobacteria:Holophagae:Holophagales: FAD-binding protein [Holophaga foetida]        
. .Thermoactinomyces daqus........................ 253  4e-77  2 hits  Bacteria::                               glycolate oxidase subunit GlcD [bacterium...   
. .Chthonomonas calidirosea....................... 247  2e-74  1 hit   Bacteria:Armatimonadetes:Chthonomonadetes:Chthonomonadales: FAD/FMN-containing dehydrogenases [Chthon...   
. .Fimbriimonas ginsengisoli Gsoil 348............ 196  5e-55  1 hit   Bacteria:Armatimonadetes:                glycolate oxidase subunit [Fimbriimonas ginsen...   
. .bacterium JKG1................................. 240  6e-72  1 hit   Bacteria::                               glycolate oxidase subunit GlcD [bacterium...   
. .Rhodopirellula baltica......................... 229  1e-67  4 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glycolate oxidase subunit GlcD [Rhodopire...   
. .Rhodopirellula baltica SH28.................... 228  5e-67  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Rhodopirellula baltica]   
. .Rhodopirellula baltica WH47.................... 228  5e-67  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Rhodopirellula baltica]   
. .Rhodopirellula baltica SH 1.................... 227  6e-67  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Rhodopirellula baltica]   
. .Rhodopirellula europaea........................ 226  1e-66  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glycolate oxidase subunit GlcD [Rhodopire...   
. .Planctomyces maris............................. 224  2e-65  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Planctomyces maris]       
. .Pirellula staleyi.............................. 223  2e-65  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Pirellula staleyi]        
. .Planctomyces limnophilus....................... 223  3e-65  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Planctomyces limnoph...   
. .Schlesneria paludicola......................... 222  5e-65  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Schlesneria paludicola]   
. .Zavarzinella formosa........................... 211  6e-61  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: hypothetical protein [Zavarzinella formosa]    
. .Isosphaera pallida............................. 206  1e-58  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Isosphaera pallida]       
. .Singulisphaera acidiphila...................... 200  1e-56  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Singulisphaera acidi...   
. .Planctomyces brasiliensis...................... 186  3e-51  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: FAD-binding protein [Planctomyces brasili...   
. .planctomycete KSU-1............................ 153  3e-39  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: oxidase [planctomycete KSU-1]                  
. .Candidatus Kuenenia stuttgartiensis............ 147  6e-37  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: similar to glycolate oxidase subunit GlcD [Ca...   
. .Gemmatimonas aurantiaca........................ 226  2e-66  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes:Gemmatimonadales: FAD-binding protein [Gemmatimonas auranti...   
. .Gemmatimonadetes bacterium KBS708.............. 212  3e-61  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes: FAD linked oxidase domain protein [Gemmatimona...   
. .Gemmatimonadetes bacterium JGI 0000112-M07..... 179  2e-50  2 hits  Bacteria:Gemmatimonadetes:Gemmatimonadetes: FAD-binding protein [Gemmatimonadetes bac...   
. .Elusimicrobium minutum......................... 210  4e-59  1 hit   Bacteria:Elusimicrobia:Elusimicrobia:Elusimicrobiales: putative glycolate oxidase [Elusimicrobiu...   
. .Candidate division OctSpa1-106................. 206  9e-59  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [Fervi...   
. .Persephonella sp. IF05-L8...................... 200  8e-57  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Persephonella sp. IF...   
. .Persephonella sp. KM09-Lau-8................... 199  1e-56  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Persephonella sp. KM...   
. .Persephonella marina........................... 192  7e-54  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Persephonella marina]     
. .Sulfurihydrogenibium subterraneum.............. 191  3e-53  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Sulfurihydrogenibium...   
. .Sulfurihydrogenibium azorense.................. 189  1e-52  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Sulfurihydrogenibium...   
. .Sulfurihydrogenibium yellowstonense............ 185  5e-51  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Sulfurihydrogenibium...   
. .Sulfurihydrogenibium sp. YO3AOP1............... 183  2e-50  3 hits  Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Sulfurihydrogenibium...   
. .Hydrogenobaculum sp. HO........................ 175  2e-47  3 hits  Bacteria:Aquificae:Aquificae:Aquificales: FAD linked oxidase domain protein [Hydrog...   
. .Hydrogenobacter thermophilus................... 175  2e-47  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Hydrogenobacter ther...   
. .Hydrogenobaculum sp. SN........................ 175  2e-47  3 hits  Bacteria:Aquificae:Aquificae:Aquificales: FAD/FMN-dependent dehydrogenase [Hydrogen...   
. .Hydrogenivirga sp. 128-5-R1-1.................. 174  5e-47  2 hits  Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Hydrogenivirga sp. 1...   
. .Thermocrinis albus............................. 174  6e-47  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Thermocrinis albus]       
. .Hydrogenobaculum sp. Y04AAS1................... 174  7e-47  3 hits  Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Hydrogenobaculum sp....   
. .Thermocrinis sp. GBS........................... 172  3e-46  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Thermocrinis sp. GBS]     
. .Aquifex aeolicus............................... 169  5e-45  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Aquifex aeolicus]         
. .Thermocrinis ruber............................. 167  2e-44  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Thermocrinis ruber]            
. .Desulfurobacterium sp. TC5-1................... 160  6e-42  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Desulfurobacterium s...   
. .Thermovibrio ammonificans...................... 157  7e-41  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Thermovibrio ammonif...   
. .Desulfurobacterium thermolithotrophum.......... 155  4e-40  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: FAD-binding protein [Desulfurobacterium t...   
. .Thermodesulfobacterium commune DSM 2178........ 187  6e-52  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: FAD-binding protein [Thermodesulfobacterium co...   
. .Thermodesulfobacterium thermophilum............ 184  1e-50  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: FAD-binding protein [Thermodesulfobacteri...   
. .Thermodesulfobacterium hveragerdense........... 183  2e-50  2 hits  Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: FAD-binding protein [Thermodesulfobacteri...   
. .Thermodesulfatator indicus..................... 174  7e-47  2 hits  Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: FAD-binding protein [Thermodesulfatator i...   
. .Thermodesulfatator atlanticus.................. 147  2e-37  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: hypothetical protein [Thermodesulfatator ...   
. .Thermodesulfatator indicus DSM 15286........... 133  4e-32  4 hits  Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: FAD linked oxidase domain-containing prot...   
. .Thermodesulfovibrio thiophilus................. 182  5e-50  2 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: FAD-binding protein [Thermodesulfovibrio ...   
. .Thermodesulfovibrio yellowstonii............... 179  7e-49  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: FAD-binding protein [Thermodesulfovibrio ...   
. .Thermodesulfovibrio islandicus................. 179  8e-49  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: FAD-binding protein [Thermodesulfovibrio ...   
. .Thermodesulfovibrio............................ 139  3e-34  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: MULTISPECIES: D-lactate dehydrogenase [Th...   
. .Geovibrio sp. L21-Ace-BES...................... 176  8e-48  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: FAD-binding protein [Geovibrio thiophilus...   
. .Deferribacter desulfuricans.................... 175  2e-47  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: FAD-binding protein [Deferribacter desulf...   
. .Flexistipes sinusarabici....................... 169  3e-45  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: FAD-binding protein [Flexistipes sinusara...   
. .Calditerrivibrio nitroreducens................. 169  3e-45  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: FAD-binding protein [Calditerrivibrio nit...   
. .Ignavibacterium album.......................... 164  4e-43  1 hit   Bacteria:Chlorobi:Ignavibacteria:Ignavibacteriales: FAD-binding protein [Ignavibacterium album]    
. .Lentisphaera araneosa.......................... 154  1e-39  1 hit   Bacteria:Lentisphaerae:Lentisphaerales:  (S)-2-hydroxy-acid oxidase chain D [Lenti...   
. .Acholeplasma laidlawii......................... 139  2e-34  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: FAD-containing dehydrogenase [Acholeplasm...   
. .Acholeplasma equifetale........................ 136  3e-33  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: hypothetical protein [Acholeplasma equife...   
. .Thermotoga thermarum........................... 139  2e-34  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: FAD-binding protein [Thermotoga thermarum]     
. .Thermotoga..................................... 134  3e-32  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: MULTISPECIES: FAD-binding protein [Thermo...   
. .Kosmotoga olearia.............................. 134  1e-32  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: FAD-binding protein [Kosmotoga olearia]        
. .BRC1 bacterium SCGC AAA257-C11................. 139  2e-34  1 hit   Bacteria::                               hypothetical protein [candidate division ...   
. .Sphaerochaeta globus........................... 139  5e-34  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: FAD-binding protein [Sphaerochaeta globosa]    
. .Sphaerochaeta pleomorpha....................... 131  2e-31  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: FAD-binding protein [Sphaerochaeta pleomo...   
. .Synergistes jonesii............................ 138  9e-34  1 hit   Bacteria:Synergistetes:Synergistia:Synergistales: FAD-binding protein [Synergistes jonesii]           
. .Thermovirga lienii............................. 131  1e-31  1 hit   Bacteria:Synergistetes:Synergistia:Synergistales: FAD-binding protein [Thermovirga lienii]       
. .candidate division ZIXI........................ 135  7e-33  1 hit   Bacteria::                               FAD/FMN-dependent dehydrogenase [candidat...   
. .Ilyobacter polytropus.......................... 130  3e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   2-hydroxy-acid oxidase [Ilyobacter polytr...   
. Pantholops hodgsonii............................ 316  9e-94  1 hit   Eukaryota:Chordata:Mammalia:             PREDICTED: uncharacterized protein LOC102...   
. Metaseiulus occidentalis........................ 132  6e-32  1 hit   Eukaryota:Arthropoda:Arachnida:Mesostigmata: PREDICTED: probable D-lactate dehydrogena...   
. Trichoplax adhaerens............................ 130  5e-31  2 hits  Eukaryota:Placozoa:                      hypothetical protein TRIADDRAFT_51388 [Tr...   
. Batrachochytrium dendrobatidis JAM81............ 241  3e-72  2 hits  Eukaryota:Chytridiomycota:Chytridiomycetes:Chytridiales: hypothetical protein BATDEDRAFT_93076 [Ba...   
. Ajellomyces capsulatus H143..................... 147  4e-38  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Ajellomyces capsulatu...   
. Ajellomyces capsulatus NAm1..................... 147  1e-36  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: conserved hypothetical protein [Ajellomyc...   
. Ajellomyces capsulatus G186AR................... 147  1e-36  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Ajellomyces capsulatu...   
. Pseudogymnoascus pannorum VKM F-4520 (FW-2644).. 147  1e-35  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V502_07274 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4518 (FW-2643).. 147  2e-35  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V500_05970 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4516 (FW-969)... 145  4e-35  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V497_06500 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4514 (FW-929)... 145  4e-35  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V495_06857 [Pseudogymnoas...   
. Fusarium pseudograminearum CS3096............... 144  2e-35  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FPSE_00318 [Fusarium...   
. Geomyces destructans 20631-21................... 144  2e-35  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein GMDG_08594 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4515 (FW-2607).. 144  1e-34  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V496_07847 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4517 (FW-2822).. 144  1e-34  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V498_04815 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4519 (FW-2642).. 144  2e-34  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V501_10525 [Pseudogymnoas...   
. Geomyces pannorum var. pannorum F-3808.......... 144  2e-34  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein O988_01462 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-103............. 143  3e-34  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V499_04017 [Pseudogymnoas...   
. Setosphaeria turcica Et28A...................... 140  2e-34  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein SETTUDRAFT_40472 [Se...   
. Colletotrichum orbiculare MAFF 240422........... 140  2e-34  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: d-lactate dehydrogenase [Colletotrichum orbicu...   
. Colletotrichum gloeosporioides Cg-14............ 140  4e-34  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: glycolate oxidase [Colletotrichum gloeosporioi...   
. Ajellomyces dermatitidis SLH14081............... 139  4e-34  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Ajellomyces derm...   
. Penicillium italicum............................ 139  5e-34  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: FAD-binding, type 2 [Penicillium italicum]          
. Nectria haematococca mpVI 77-13-4............... 139  5e-34  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: predicted protein [Nectria haematococca m...   
. Ajellomyces dermatitidis ER-3................... 139  5e-34  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: oxidoreductase [Ajellomyces dermatitidis ER-3]      
. Ajellomyces dermatitidis ATCC 26199............. 139  6e-34  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase (cytochrome) [Ajellomy...   
. Pyrenophora teres f. teres 0-1.................. 139  7e-34  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein PTT_19650 [Pyrenopho...   
. Leptosphaeria maculans JN3...................... 139  8e-34  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: similar to d-lactate dehydrogenase [Lepto...   
. Ajellomyces dermatitidis ATCC 18188............. 139  8e-34  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: oxidoreductase [Ajellomyces dermatitidis ATCC ...   
. Aspergillus clavatus NRRL 1..................... 138  9e-34  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: oxidoreductase, FAD-binding [Aspergillus ...   
. Fusarium fujikuroi IMI 58289.................... 138  1e-33  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: probable D-lactate dehydrogenase (cytochrome)...   
. Paracoccidioides brasiliensis Pb18.............. 138  1e-33  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: glycolate oxidase, subunit GlcD [Paracoccidioi...   
. Aspergillus terreus NIH2624..................... 138  1e-33  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: conserved hypothetical protein [Aspergill...   
. Fusarium oxysporum FOSC 3-a..................... 138  2e-33  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: D-lactate dehydrogenase (cytochrome) [Fusarium...   
. Pyrenophora tritici-repentis Pt-1C-BFP.......... 138  2e-33  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: D-lactate dehydrogenase, mitochondrial pr...   
. Paracoccidioides brasiliensis Pb01.............. 138  2e-33  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Paracoccidioides...   
. Fusarium oxysporum f. sp. vasinfectum 25433..... 138  2e-33  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: D-lactate dehydrogenase (cytochrome) [Fusarium...   
. Fusarium oxysporum Fo5176....................... 138  2e-33  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOXB_13530 [Fusarium oxys...   
. Colletotrichum graminicola M1.001............... 137  2e-33  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: glycolate oxidase [Colletotrichum graminicola ...   
. Bipolaris sorokiniana ND90Pr.................... 137  2e-33  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein COCSADRAFT_127252 [B...   
. Aspergillus niger ATCC 1015..................... 137  2e-33  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: hypothetical protein ASPNIDRAFT_209012 [Asperg...   
. Bipolaris oryzae ATCC 44560..................... 137  3e-33  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein COCMIDRAFT_89134 [Bi...   
. Taphrina deformans PYCC 5710.................... 137  3e-33  1 hit   Eukaryota:Ascomycota:Taphrinomycetes:Taphrinales: D-lactate dehydrogenase,mitochondrial [Taphri...   
. Bipolaris maydis C5............................. 137  3e-33  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein COCHEDRAFT_1206971 [Bipol...   
. Aspergillus kawachii IFO 4308................... 137  3e-33  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: oxidoreductase, FAD-binding [Aspergillus kawa...   
. Aspergillus oryzae 3.042........................ 137  3e-33  3 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: proteins containing the FAD binding domain pro...   
. Aspergillus niger CBS 513.88.................... 137  3e-33  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: D-lactate dehydrogenase (cytochrome) [Asp...   
. Talaromyces stipitatus ATCC 10500............... 137  3e-33  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: oxidoreductase, FAD-binding [Talaromyces ...   
. Aspergillus flavus NRRL3357..................... 137  4e-33  6 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: D-lactate dehydrogenase (cytochrome), put...   
. Aspergillus oryzae RIB40........................ 136  4e-33  6 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: unnamed protein product [Aspergillus oryzae R...   
. Aspergillus fumigatus Af293..................... 136  4e-33  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: D-lactate dehydrogenase (cytochrome) [Asperg...   
. Penicillium expansum............................ 136  5e-33  6 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: FAD-linked oxidase, C-terminal [Penicillium ex...   
. Bipolaris victoriae FI3......................... 136  5e-33  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein COCVIDRAFT_102313 [Bipola...   
. Acremonium chrysogenum ATCC 11550............... 136  6e-33  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: D-lactate dehydrogenase [cytochrome]-like prot...   
. Glarea lozoyensis ATCC 20868.................... 136  7e-33  2 hits  Eukaryota:Ascomycota:                    FAD-binding protein [Glarea lozoyensis AT...   
. Penicillium marneffei ATCC 18224................ 136  7e-33  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: oxidoreductase, FAD-binding [Talaromyces ...   
. Gibberella moniliformis 7600.................... 136  9e-33  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: D-lactate dehydrogenase (cytochrome) [Fusarium...   
. Penicillium marneffei PM1....................... 136  1e-32  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: D-lactate dehydrogenase [cytochrome], mitochon...   
. Pseudogymnoascus pannorum VKM F-4513 (FW-928)... 136  6e-32  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V494_04208 [Pseudogymnoas...   
. Pseudogymnoascus pannorum VKM F-4246............ 136  6e-32  1 hit   Eukaryota:Ascomycota:Leotiomycetes:      hypothetical protein V492_01670 [Pseudogymnoas...   
. Neosartorya fischeri NRRL 181................... 135  2e-32  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: oxidoreductase, FAD-binding [Neosartorya ...   
. Capronia coronata CBS 617.96.................... 135  2e-32  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Chaetothyriales: D-lactate dehydrogenase (cytochrome) [Cap...   
. Trichoderma virens Gv29-8....................... 135  2e-32  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein TRIVIDRAFT_54702 [Trichod...   
. Aspergillus oryzae 100-8........................ 134  2e-32  3 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: D-lactate dehydrogenase (cytochrome) [Asp...   
. Penicillium digitatum PHI26..................... 134  2e-32  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: Oxidoreductase, FAD-binding, putative [Penicil...   
. Galdieria sulphuraria........................... 134  3e-32  2 hits  Eukaryota::Bangiophyceae:Cyanidiales:    D-lactate dehydrogenase (cytochrome) [Gal...   
. Penicillium chrysogenum Wisconsin 54-1255....... 134  3e-32  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Eurotiales: Pc20g02930 [Penicillium chrysogenum Wisco...   
. Fusarium oxysporum Fo47......................... 134  3e-32  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: D-lactate dehydrogenase (cytochrome) [Fusarium...   
. Fusarium oxysporum f. sp. cubense race 1........ 134  3e-32  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Dothideales: D-lactate dehydrogenase [cytochrome], mitochon...   
. Fusarium oxysporum f. sp. pisi HDV247........... 134  3e-32  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOXB_08948 [Fusarium oxys...   
. Fusarium oxysporum f. sp. cubense tropical race. 134  3e-32  3 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: D-lactate dehydrogenase (cytochrome) [Fusarium...   
. Arthroderma otae CBS 113480..................... 134  4e-32  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Arthroderma otae...   
. Mycosphaerella graminicola IPO323............... 134  4e-32  2 hits  Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: hypothetical protein MYCGRDRAFT_65235 [Zy...   
. Stachybotrys chartarum IBT 7711................. 134  4e-32  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein S7711_09332 [Stachybotrys...   
. Stachybotrys chlorohalonata IBT 40285........... 134  5e-32  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein S40285_04869 [Stachybotry...   
. Claviceps purpurea 20.1......................... 133  7e-32  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: probable D-lactate dehydrogenase (cytochrome)...   
. Aureobasidium melanogenum CBS 110374............ 133  7e-32  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Dothideales: FAD-binding domain-containing protein [Aureoba...   
. Trichophyton tonsurans CBS 112818............... 133  8e-32  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Trichophyton tonsuran...   
. Dothistroma septosporum NZE10................... 133  9e-32  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Capnodiales: hypothetical protein DOTSEDRAFT_43057 [Dothist...   
. Trichophyton rubrum H6.......................... 133  1e-31  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: glycolate oxidase, subunit GlcD [Trichophyton ...   
. Trichophyton equinum CBS 127.97................. 132  1e-31  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Trichophyton equinum ...   
. Botryotinia fuckeliana isolate T4............... 132  1e-31  1 hit   Eukaryota:Ascomycota:Leotiomycetes:Helotiales: similar to d-lactate dehydrogenase [Botryotin...   
. Coccidioides posadasii C735 delta SOWgp......... 132  2e-31  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase, putative [Coccid...   
. Phialophora europaea CBS 101466................. 132  2e-31  2 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: glycolate oxidase, subunit GlcD [Cyphello...   
. Sclerotinia borealis F-4157..................... 132  3e-31  1 hit   Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein SBOR_2630 [Sclerotinia bo...   
. Capronia epimyces CBS 606.96.................... 131  3e-31  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Chaetothyriales: hypothetical protein A1O3_08889 [Capronia...   
. Aureobasidium namibiae CBS 147.97............... 131  3e-31  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Dothideales: D-lactate dehydrogenase [Aureobasidium pullula...   
. Pseudallescheria apiosperma..................... 131  4e-31  1 hit   Eukaryota:Ascomycota:Sordariomycetes:Microascales: hypothetical protein SAPIO_CDS7474 [Pseudalles...   
. Aureobasidium pullulans var. subglaciale EXF-24. 130  5e-31  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Dothideales: hypothetical protein AUEXF2481DRAFT_47469 [Aur...   
. Cladophialophora yegresii CBS 114405............ 130  6e-31  2 hits  Eukaryota:Ascomycota:Eurotiomycetes:Chaetothyriales: D-lactate dehydrogenase (cytochrome) [Cla...   
. Aureobasidium pullulans EXF-150................. 130  6e-31  1 hit   Eukaryota:Ascomycota:Dothideomycetes:Dothideales: FAD-binding domain-containing protein [Aureoba...   
. Trichophyton rubrum CBS 118892.................. 130  6e-31  3 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: D-lactate dehydrogenase [Trichophyton rub...   
. Trichophyton rubrum MR850....................... 130  7e-31  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: oxidoreductase [Trichophyton rubrum CBS 1...   
. Trichophyton megninii CBS 735.88................ 130  7e-31  1 hit   Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: glycolate oxidase, subunit GlcD [Trichophyton ...   
. uncultured organism............................. 239  2e-71  2 hits  ::                                       FAD linked oxidase, C-terminal domain [uncultu...   
. Methanoculleus sp. CAG:1088..................... 155  8e-40  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: MULTISPECIES: (S)-2-hydroxy-acid dehydrog...   
. Methanocella arvoryzae MRE50.................... 140  1e-34  4 hits  Archaea:Euryarchaeota:                   FAD-binding protein [Methanocella arvoryzae]   
. Vulcanisaeta distributa......................... 224  5e-66  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Vulcanisaeta distributa]    
. Vulcanisaeta moutnovskia........................ 223  2e-65  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Vulcanisaeta moutnovskia]   
. Pyrobaculum oguniense........................... 212  3e-61  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Pyrobaculum oguniense]      
. Pyrobaculum calidifontis........................ 210  1e-60  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Pyrobaculum calidifontis]   
. Pyrobaculum aerophilum.......................... 210  2e-60  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Pyrobaculum aerophilum]     
. Pyrobaculum arsenaticum......................... 208  1e-59  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Pyrobaculum arsenaticum]    
. Pyrobaculum sp. 1860............................ 199  3e-56  3 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glycolate oxidase [Pyrobaculum sp. 1860]       
. Caldivirga maquilingensis....................... 151  2e-38  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: D-lactate dehydrogenase [Caldivirga maqui...   
. Acidianus sp. ALE_1............................. 198  4e-56  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Candidatus Acidianus copah...   
. Metallosphaera yellowstonensis.................. 196  3e-55  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Metallosphaera yellow...   
. Sulfolobus tokodaii............................. 196  3e-55  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus tokodaii]       
. Metallosphaera cuprina.......................... 195  5e-55  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Metallosphaera cuprina]    
. Sulfolobus islandicus........................... 194  1e-54  6 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus islandicus]     
. Sulfolobus islandicus M.14.25................... 194  1e-54  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus islandicus]     
. Sulfolobus islandicus L.D.8.5................... 193  3e-54  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus islandicus]     
. Sulfolobus solfataricus......................... 193  3e-54  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus solfataricus]   
. Sulfolobus islandicus Y.G.57.14................. 193  3e-54  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus islandicus]     
. Sulfolobus islandicus HVE10/4................... 193  4e-54  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus islandicus]     
. Metallosphaera sedula........................... 192  1e-53  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Metallosphaera sedula]     
. Sulfolobus islandicus L.S.2.15.................. 192  1e-53  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus islandicus]     
. Sulfolobus acidocaldarius....................... 191  2e-53  3 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus acidocalda...   
. Sulfolobus acidocaldarius DSM 639............... 190  5e-53  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD-linked oxidase [Sulfolobus acidocalda...   
. Sulfolobus acidocaldarius N8.................... 190  5e-53  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glycolate oxidase subunit [Sulfolobus aci...   
. Sulfolobales archaeon Acd1...................... 190  7e-53  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: hypothetical protein [Sulfolobales archae...   
. Sulfolobales archaeon AZ1....................... 180  3e-49  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: FAD linked oxidase domain-containing protein [...   
. Candidatus Caldiarchaeum subterraneum........... 164  2e-43  5 hits  Archaea:Thaumarchaeota:                  glycolate oxidase [Candidatus Caldiarchae...   
. Methanococcoides methylutens.................... 155  7e-40  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD linked oxidase-like protein [Methanococcoi...   
. Methanocella conradii........................... 149  1e-37  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: FAD-binding protein [Methanocella conradii]    
. Methanocella paludicola......................... 148  1e-37  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: FAD-binding protein [Methanocella paludic...   
. Methanococcoides burtonii....................... 147  3e-37  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD linked oxidase-like protein [Methanoc...   
. Methanohalobium evestigatum..................... 143  1e-35  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD-binding protein [Methanohalobium eves...   
. Candidatus Methanomassiliicoccus intestinalis... 142  2e-35  1 hit   Archaea:Euryarchaeota:Methanomicrobia:   (S)-2-hydroxy-acid dehydrogenase [Candida...   
. Methanolobus tindarius.......................... 141  5e-35  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD/FMN-dependent dehydrogenase [Methanol...   
. Methanosarcina mazei............................ 138  7e-34  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD/FMN-containing dehydrogenase [Methano...   
. Methanosarcina mazei Go1........................ 138  7e-34  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD-binding protein [Methanosarcina mazei]     
. Methanosarcina acetivorans...................... 137  1e-33  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD-binding protein [Methanosarcina aceti...   
. Thermoplasmatales archaeon BRNA1................ 137  2e-33  3 hits  Archaea:Euryarchaeota:Thermoplasmata:Thermoplasmatales: FAD/FMN-containing dehydrogenase [Thermop...   
. Methanomassiliicoccus luminyensis............... 136  4e-33  1 hit   Archaea:Euryarchaeota:Methanomicrobia:   hypothetical protein [Methanomassiliicocc...   
. Candidatus Korarchaeum cryptofilum.............. 135  7e-33  1 hit   Archaea:Korarchaeota:                    FAD linked oxidase domain-containing prot...   
. Methanosarcina barkeri.......................... 134  2e-32  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD-binding protein [Methanosarcina barkeri]   
. Methanocella arvoryzae.......................... 133  4e-32  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: FAD-binding protein [Methanocella arvoryzae]   
. Methanomethylovorans hollandica................. 132  5e-32  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD/FMN-dependent dehydrogenase [Methanom...   
. Methanococcoides burtonii DSM 6242.............. 130  5e-31  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: FAD-binding protein [Methanococcoides bur... 

BLAST

PROTOCOLE:


a) NCBI blastp de la séquence protéique correspondant à l'ORF b) contre NR - max target sequences : 5000 - autres paramètres par défaut

b) NCBI blastp de la séquence protéique correspondant à l'ORF b) contre SwissProt - max target sequences : 5000 - autres paramètres par défaut


ANALYSE DES RÉSULTATS:


Ci-dessous un tableau comparatif des résultats du blastp dans les cas NR et SwissProt :


      |  nombre de  | e-value | e-value | e-value |

      |  résultats  |   min   |   max   |  seuil  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  NR  |    5000     |  1e-168 | 1e-31   |  aucun  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  SP  |     46      |  2e-127 |    8,4  |  5e-9   |

______|_____________|_________|_________|_________|



a) NR


Lorsque le blastp génère 5000 hits, le dernier présente une e value très basse (7e-31), un pourcentage de recouvrement très élevé (90%) et un pourcentage d'identité acceptable (33%). On le considère donc comme homologue à la séquence protéique issue de notre ORF, ainsi que tous les résultats le précédant (donc 5000 homologues). Les e values de ces 5000 résultats s'étendent de 1e-168 (excellente e value) à 7e-31 (très bonne e value). On n'observe pas de rupture au niveau de la fonction ou au niveau des valeurs de e-value qui nous permette de fixer un seuil de e-value.


Si on analyse les dix premiers alignements dans le détail (alignement deux par deux avec la séquence requête), on constate que les séquences recouvrent entièrement notre séquence requête (recouvrement des 286 aa de la séquence requête, soit 100% de recouvrement). Les HSP sont disitribués sur toute la séquence requête, mais il est à noter que les zones les mieux conservées sont les positions en 5', correspondant aux neuf premiers acides aminés de la séquence requête (GSEGLLGVI). Lors de l'alignement multiple, on remarque que sur les 9 premiers aa de l'ORF, les positions des 4 premiers sont parfaitement conservées chez ses homologues et les acides aminés en 5eme, 6eme et 8eme position ont subi des substitutions conservatives chez certaines des séquences homologues. Donc l'alignement multiple confirme l'observation des dix premiers alignements.

Les pourcentages d'identités sont très élevés (plus de 60% pour les dix premiers alignements, plus de 80% pour les 4 premiers), pratiquement aucune indel n'est présent (de 0 à 2, donc pourcentage de gaps _ 0%), les e values sont extrêmement basses (de 4e-137 à 1e-168). Ces alignements sont donc d'une très bonne qualité.



Ci-dessous, résumées sous forme de tableau, les différentes fonctions associées aux séquences protéiques générées par blastp :


_____________________________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value | nombre de hits|

  |_______________________________________________________________________|_____________|_____________|_______________|

  |FAD-binding protein                                                    |    1e-168   |     6e-31   |     1880      |

  |FAD-linked oxydase                                                     |   6e-127    |     7e-31   |      693      |

  |Glycolate oxidase subunit GlcD                                         |    5e-141   |     5e-31   |     982       |

  |D-lactate deshydrogenase                                               |    5e-119   |     7e-31   |      114      |

  |Dimethylmenaquinone methyltransferase                                  |    4e-32    |     2e-31   |      103      |

__|_______________________________________________________________________|_____________|_____________|_______________|



On remarque que les fonctions principales des séquences protéiques générées par le blastp sont identiques ou fortement apparentées à la fonction proposée par Interpro pour notre ORF (oxydase liée au cofacteur FAD).


On retrouve donc:

- l'oxydase liée au cofacteur FAD, mais aussi les protéines liées à FAD. Ces deux termes sont des dénominations différentes pour désigner la même fonction (annotations par des auteurs différents). On retrouve également la sous unité de l'oxydase liée à FAD (Vanillyl-alcool oxidase, sous unité 2).

- la D-lactate deshydrogenase (cytochrome), intervenant dans la fermentation lactique (transformant le pyruvate en acide lactique).

- la dimethylmenaquinone methyltransferase issue de la vitamine K2 (menaquinone), réalisant un transfert de méthyl d'une molécule à une autre.

- la glycolate oxydase sous unité glcD, une oxydoréductase intervenant au niveau des peroxysomes lors de la photorespiration, elle détoxifient la cellule. Cette sous-unité lie le FAD.


Les résultats d'Interpro et de blastp dans NR sont donc cohérents. Interpro associait notre ORF traduit à une fonction d'oxydase dépendant de FAD, et la majorité des résultats de blastp (3555 sur 5000) suggère une association à une fonction glycolate oxydase, donc une oxydase, elle aussi dépendante de FAD.  


De plus, parmi les glycolates oxydases, 845 correspondent uniquement à une des sous-unités de la protéine (sous unité glcD) et non à la protéine entière. Il est donc possible que notre ORF code pour une sous unité de la protéine uniquement.


Lorsque l'on regarde les alignements 2 à 2, on remarque que dans le cas de l'alignement de la séquence requête avec la protéine entière ou avec sa sous unité uniquement, la longueur des protéines issues de la base de données est toujours la même (environ 478 aa). Cela signifie que les deux appellations désignent en fait le même structure : la sous unité de la protéine.

L'ORF, mesurant 288aa, ne code pas pour une sous unité entière car elle devrait être constituée d'environ 350aa (d'après la bibliographie de la glycolate oxydase liée à FAD). Puisqu'il est tronqué en 5', cela conforte le fait qu'il ne code que pour une partie de la sous unité.



b)SP


Le blastp avec Swiss Prot génère 46 hits. Ces hits présentent des e values s'étendant de 2e-127 (excellente valeur) à 8.4 (valeur médiocre). Le dernier hit, en plus de présenter une e valeur très élevée (8,4), présente un pourcentage d'identité acceptable (32%) mais ne recouvre que 27% de la séquence requête, ce qui est très peu. Cette séquence protéique n'est donc clairement pas homologue à la séquence protéique correspondant à notre ORF.


Si l'on observe les valeurs de e value des hits, on remarque qu'elles chutent rapidement (on passe du premier hit présentant une e value de 2e-127 à au deuxième à 1e-52, et à un troisième 1e-29), puis se stabilisent (on passe du troisième hit présentant une e value de 1e-29 au 8ème hit à 2e-21) jusqu'à rechuter une seconde fois (on passe du 8ème hit d'une e value de 2e-21 au 9ème à 1e-16), puis une troisième fois (19ème hit avec e value de 5e-9 au 20ème hit avec e value de 1e-5). On observe donc trois ruptures de e value, pouvant peut être correspondre à notre seuil.



Nous allons nous intéresser aux fonctions des séquences protéiques proposées par swiss prot. Jusqu'ici, ces fonctions étaient les mêmes que celles présentées par le blastp dans NR : des sous unités de glycolate oxydase, et une D-lactate déshydrogénase probable, ces deux protéines intervenant dans le métabolisme.

Dans le cas de la troisième chute, celle-ci est associée à une nouvelle fonction, celle d'une Alkyldihydroxyacetonephosphate synthase. Elle permet la catalyse, dans les peroxysomes, de la formation d'une liaison ether pour former des phospholipides.

Cette fois, cette fonction n'intervient pas dans le métabolisme, et la protéine n'est pas liée à FAD.

Ces observations, associées à la chute de e value (5e-9 à 1e-5), et à des valeurs d'alignement de la séquence protéique associée à la fonction Alkyldihydroxyacetonephosphate synthase avec la séquence requête, qui sont plutôt mauvaises (e value de 1e-5 non suffisante pour assurer franchement l'homologie, un pourcentage d'identité plutôt faible (21%) sur un recouvrement pourtant important (91%)), nous permettent de fixer la valeur seuil de e value à cet endroit, pour cette séquence protéique. La valeur seuil est donc de 5e-9.


Sur cette base, on peut donc dire que SW a généré 19 homologues à notre séquence requête, présentant des valeurs de e value de 2e-127 à 5e-9.


Si l'on compare les alignements deux à deux, on remarque que l'alignement n'est pas réalisé sur l'ensemble de la séquence requête (288 pour le premier homologue (meilleur hit) à 269 pour le dernier homologue). Les HSP ne s'étendent donc pas tout à fait sur la séquence requête entière. Tout comme pour NR, on remarque que les régions les mieux conservées sont situées à l'extrémité 5' de la séquence requête, correspondant aux dix premières positions de la séquence requête (GSEGLLGVIT).


Ci-dessous un tableau présentant les différentes fonctions des homologues générés par le blastp avec SP :



  |    descriptions :                                                     | min e-value | max e-value | nombre de hits

  |_______________________________________________________________________|_____________|_____________|_______________

  |Glycolate oxydase (sous unité GlcD)                                    |    2e-127   |     1e-52   |      2

  |D-lactate deshydrogenase                                               |    1e-29    |     3e-10   |      8

  |D-2-hydroxyglutarate deshydrogenase                                    |    2e-16    |      5e-9   |      8

  |FAD-linked oxidoreductase (non caractérisée)                           |    2e-21    |     2e-21   |      1

  |_______________________________________________________________________|_____________|_____________|__________________


Les homologues avec les e values les plus élevées (2e-127 et 1e-52) sont associés à la fonction glycolate oxydase.


On a plus de hits associés à la fonction D-lactate déshydrogénase que de hits associés à la glycolate oxydase (8 contre 1 sur 19 hits) mais ils présentent des valeurs de e value beaucoup plus basses (1e-29 à 3e-10 contre 2e-127 à 1e-52). On a donc tendance à associer notre séquence protéique à la fonction de glycolate oxydase. De plus, cela concorde avec les résultats de NR, puisque l'on arrivait aux mêmes conclusions, et donc avec les résultats d'Interpro (qui concordaient avec ceux de NR).


  a) NR

BLASTP 2.2.30+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro
A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and
David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs", Nucleic
Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen
F. Altschul, John C. Wootton, E. Michael Gertz, Richa
Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and
Yi-Kuo Yu (2005) "Protein database searches using
compositionally adjusted substitution matrices", FEBS J.
272:5101-5109.


RID: 5982NGY5013


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           51,826,119 sequences; 18,610,688,330 total letters
Query= 
Length=286


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|WP_020027004.1|  FAD-binding protein [gamma proteobacteriu...    488   1e-168
ref|WP_020024991.1|  FAD-binding protein [gamma proteobacteriu...    477   2e-164
ref|WP_020026386.1|  FAD-binding protein [gamma proteobacteriu...    474   2e-163
ref|WP_020028766.1|  FAD-binding protein [gamma proteobacteriu...    473   1e-162
ref|WP_011737716.1|  FAD-binding protein [Candidatus Ruthia ma...    446   3e-152
ref|WP_011929693.1|  FAD-binding protein [Calyptogena okutanii...    437   1e-148
ref|WP_028486796.1|  glycolate oxidase subunit GlcD [Thiomicro...    417   5e-141
ref|WP_029408715.1|  glycolate oxidase subunit GlcD [Thiomicro...    417   1e-140
ref|WP_024851960.1|  glycolate oxidase subunit GlcD [Thiomicro...    414   2e-139
ref|WP_029912218.1|  glycolate oxidase subunit GlcD [Hydrogeno...    407   4e-137
ref|WP_019557776.1|  hypothetical protein [Thiomicrospira arct...    403   4e-135
ref|WP_002710532.1|  FAD-binding protein [Thiothrix nivea]           397   8e-133
ref|WP_028488218.1|  glycolate oxidase subunit GlcD [Thiothrix...    395   8e-132
ref|WP_016780807.1|  FAD-binding protein [Pseudomonas fragi]         392   1e-130
ref|WP_016711113.1|  FAD-binding protein [Pseudomonas monteilii]     391   2e-130
ref|WP_027608888.1|  glycolate oxidase subunit GlcD [Pseudomon...    391   4e-130
ref|WP_026289935.1|  glycolate oxidase subunit GlcD [Thioalkal...    390   4e-130
ref|WP_016348476.1|  glycolate oxidase subunit GlcD [Burkholde...    390   5e-130
ref|WP_023968713.1|  FAD-binding protein [Pseudomonas chlorora...    390   6e-130
gb|EGQ62039.1|  glycolate oxidase, subunit GlcD [Acidithiobaci...    386   7e-130
gb|KAK45703.1|  glycolate oxidase subunit GlcD [Burkholderia s...    390   8e-130
ref|WP_009456131.1|  MULTISPECIES: glycolate oxidase subunit G...    389   1e-129
gb|EGH09901.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    384   1e-129
ref|WP_028699839.1|  glycolate oxidase subunit GlcD [Pseudomon...    389   1e-129
ref|WP_019098607.1|  MULTISPECIES: FAD-binding protein [Pseudo...    389   1e-129
gb|KEZ66815.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    382   1e-129
ref|WP_003804753.1|  FAD-binding protein [Alcaligenes faecalis]      389   1e-129
ref|WP_025804072.1|  glycolate oxidase subunit GlcD [Pseudomon...    389   2e-129
ref|WP_026484614.1|  glycolate oxidase subunit GlcD [Alcaligen...    389   2e-129
ref|WP_012271809.1|  FAD-binding protein [Pseudomonas putida]        389   2e-129
ref|WP_017524572.1|  FAD-binding protein [Pusillimonas noertem...    388   3e-129
gb|KEZ79365.1|  FAD linked oxidase domain-containing protein [...    389   4e-129
ref|WP_009043127.1|  FAD-binding protein [Pseudomonas chlorora...    388   4e-129
ref|WP_009048205.1|  FAD-binding protein [Pseudomonas chlorora...    388   4e-129
ref|WP_007988472.1|  FAD-binding protein [Pseudomonas sp. GM48]      388   4e-129
ref|WP_015270792.1|  glycolate oxidase subunit GlcD [Pseudomon...    388   5e-129
ref|WP_027980458.1|  glycolate oxidase subunit GlcD [gamma pro...    387   7e-129
ref|WP_030141726.1|  glycolate oxidase subunit GlcD [Pseudomon...    387   7e-129
gb|EGH29769.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    380   7e-129
ref|WP_032630975.1|  glycolate oxidase subunit GlcD [Pseudomon...    387   7e-129
ref|WP_017339320.1|  FAD-binding protein [Pseudomonas fluoresc...    387   7e-129
ref|WP_007986447.1|  FAD-binding protein [Pseudomonas sp. GM48]      387   8e-129
ref|WP_025130687.1|  glycolate oxidase subunit GlcD [Pseudomon...    387   8e-129
ref|WP_029208575.1|  glycolate oxidase subunit GlcD [gamma pro...    387   9e-129
ref|WP_014590532.1|  FAD-binding protein [Pseudomonas putida]        387   9e-129
ref|WP_012314091.1|  FAD-binding protein [Pseudomonas putida]        387   1e-128
ref|WP_016980886.1|  FAD-binding protein [Pseudomonas amygdali]      387   1e-128
ref|WP_027159258.1|  glycolate oxidase subunit GlcD [Methyloba...    387   1e-128
ref|WP_019438348.1|  FAD-binding protein [Pseudomonas putida]        387   1e-128
ref|WP_005780595.1|  FAD-binding protein [Pseudomonas amygdali]      387   1e-128
ref|WP_011169026.1|  FAD-binding protein [Pseudomonas savastanoi]    387   1e-128
ref|WP_004665774.1|  FAD-binding protein [Pseudomonas savastanoi]    387   1e-128
ref|WP_020364888.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   2e-128
ref|WP_033056515.1|  glycolate oxidase subunit GlcD [Pseudomon...    387   2e-128
ref|WP_012638596.1|  FAD-binding protein [Thioalkalivibrio sul...    387   2e-128
ref|WP_020192877.1|  FAD-binding protein [Pseudomonas putida]        386   2e-128
gb|EPN32232.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    382   2e-128
ref|WP_012607163.1|  FAD-binding protein [Acidithiobacillus fe...    386   2e-128
ref|WP_005754547.1|  FAD-binding protein [Pseudomonas amygdali]      386   2e-128
ref|WP_003179894.1|  FAD-binding protein [Pseudomonas fluoresc...    386   2e-128
ref|WP_020396548.1|  FAD-binding protein [Thiothrix disciformis]     386   2e-128
ref|WP_008931678.1|  FAD-binding protein [Ectothiorhodospira s...    386   2e-128
gb|AHD14155.1|  FAD-binding protein [Pseudomonas sp. FGI182]         386   2e-128
gb|AHL34625.1|  glycolate oxidase subunit GlcD [Pseudomonas br...    386   3e-128
ref|WP_028613197.1|  glycolate oxidase subunit GlcD [Pseudomon...    386   3e-128
ref|WP_019716772.1|  FAD-binding protein [Pseudomonas syringae]      383   3e-128
gb|EPN26341.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    383   3e-128
ref|WP_023663459.1|  FAD-binding protein [Pseudomonas taiwanen...    386   3e-128
ref|WP_032645983.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   3e-128
ref|WP_014900732.1|  FAD-binding protein [Burkholderia cepacia]      386   3e-128
ref|WP_019751065.1|  FAD-binding protein [Pseudomonas putida]        385   3e-128
ref|WP_028989085.1|  glycolate oxidase subunit GlcD [Thermithi...    385   4e-128
ref|WP_021782079.1|  MULTISPECIES: FAD-binding protein [Pseudo...    385   4e-128
gb|KGI95200.1|  glycolate oxidase subunit GlcD [Pseudomonas sp...    385   4e-128
gb|KEY89161.1|  glycolate oxidase subunit GlcD [Pseudomonas sp...    385   4e-128
ref|WP_012051959.1|  FAD-binding protein [Pseudomonas putida]        385   4e-128
ref|WP_020341294.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   4e-128
ref|WP_000652835.1|  hypothetical protein [Escherichia sp. 3_2...    379   4e-128
gb|AHZ77991.1|  glycolate oxidase subunit GlcD [Pseudomonas pu...    385   4e-128
ref|WP_008082474.1|  FAD-binding protein [Pseudomonas sp. GM80]      385   4e-128
ref|WP_017703109.1|  FAD-binding protein [Pseudomonas syringae]      382   4e-128
ref|WP_007930737.1|  FAD-binding protein [Pseudomonas sp. GM17]      385   4e-128
ref|WP_007975244.1|  FAD-binding protein [Pseudomonas sp. GM33]      385   4e-128
gb|EZP26522.1|  glycolate oxidase subunit D [Pseudomonas sp. R...    385   5e-128
ref|WP_032688464.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   5e-128
ref|WP_013973098.1|  FAD-binding protein [Pseudomonas putida]        385   5e-128
ref|WP_017148258.1|  FAD-binding protein [Pseudomonas putida]        385   5e-128
ref|WP_030130630.1|  glycolate oxidase subunit GlcD [Pseudomon...    385   6e-128
ref|WP_014756221.1|  FAD-binding protein [Pseudomonas putida]        385   6e-128
ref|WP_003256158.1|  FAD-binding protein [Pseudomonas putida]        385   6e-128
ref|WP_009407958.1|  glycolate oxidase subunit GlcD [Pseudomon...    385   6e-128
ref|WP_016499135.1|  glycolate oxidase subunit GlcD [Pseudomon...    385   6e-128
ref|WP_007999994.1|  FAD-binding protein [Pseudomonas sp. GM49]      385   7e-128
ref|WP_007939222.1|  FAD-binding protein [Pseudomonas sp. GM18]      385   7e-128
ref|WP_029919842.1|  glycolate oxidase subunit GlcD [Nevskia s...    384   8e-128
ref|WP_015095592.1|  glycolate oxidase subunit GlcD [Pseudomon...    385   8e-128
ref|WP_027900740.1|  glycolate oxidase subunit GlcD [Pseudomon...    385   9e-128
ref|WP_006483541.1|  FAD-binding protein [Burkholderia cenocep...    385   9e-128
ref|WP_008095886.1|  FAD-binding protein [Pseudomonas sp. GM84]      385   9e-128
ref|WP_009686494.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   9e-128
ref|WP_008019679.1|  FAD-binding protein [Pseudomonas sp. GM55]      384   1e-127
ref|WP_027611630.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   1e-127
gb|KFL52789.1|  glycolate oxidase subunit GlcD [Burkholderia p...    384   1e-127
ref|WP_008073263.1|  FAD-binding protein [Pseudomonas sp. GM79]      384   1e-127
ref|WP_006494282.1|  FAD-binding protein [Burkholderia cenocep...    384   1e-127
ref|WP_012702822.1|  FAD-binding protein [Azotobacter vinelandii]    384   1e-127
gb|EXF43680.1|  glycolate oxidase subunit GlcD [Pseudomonas sp...    384   1e-127
gb|ETY80273.1|  FAD-binding protein [Burkholderia caribensis M...    384   1e-127
ref|WP_005744497.1|  FAD-binding protein [Pseudomonas amygdali]      384   1e-127
gb|KEA59276.1|  glycolate oxidase subunit GlcD [Burkholderia c...    384   1e-127
ref|WP_027918551.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   1e-127
ref|WP_024776330.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   1e-127
ref|WP_007960093.1|  FAD-binding protein [Pseudomonas sp. GM25]      384   1e-127
ref|WP_012536680.1|  FAD-binding protein [Acidithiobacillus fe...    384   1e-127
ref|WP_024087333.1|  FAD-binding protein [Pseudomonas monteilii]     384   1e-127
ref|WP_025111245.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   1e-127
gb|AIS19741.1|  glycolate oxidase subunit GlcD [Pseudomonas rh...    384   2e-127
ref|WP_028944278.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   2e-127
ref|WP_010954578.1|  FAD-binding protein [Pseudomonas putida]        384   2e-127
ref|WP_008013805.1|  FAD-binding protein [Pseudomonas sp. GM50]      384   2e-127
ref|WP_020294518.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   2e-127
ref|WP_008157090.1|  FAD-binding protein [Pseudomonas sp. GM41...    384   2e-127
gb|EZP30551.1|  glycolate oxidase subunit GlcD [Pseudomonas sp...    384   2e-127
ref|WP_000829564.1|  MULTISPECIES: glycolate oxidase [Enteroba...    378   2e-127
ref|WP_013973248.1|  FAD-binding protein [Pseudomonas putida]        384   2e-127
ref|WP_012404877.1|  FAD-binding protein [Burkholderia phymatum]     384   2e-127
ref|WP_018076678.1|  FAD-binding protein [Thiobacillus denitri...    383   3e-127
ref|WP_028941036.1|  glycolate oxidase subunit GlcD [Pseudomon...    384   3e-127
ref|WP_008367795.1|  FAD-binding protein [Pseudomonas sp. M47T1]     383   3e-127
ref|WP_024617946.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   3e-127
ref|WP_024688347.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   3e-127
ref|WP_007968900.1|  FAD-binding protein [Pseudomonas sp. GM30]      383   3e-127
ref|WP_003297908.1|  MULTISPECIES: FAD-binding protein [Pseudo...    383   3e-127
ref|WP_007577380.1|  FAD-binding protein [Burkholderia terrae]       383   3e-127
ref|WP_028624431.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   3e-127
ref|WP_012367138.1|  FAD-binding protein [Burkholderia ambifaria]    383   3e-127
ref|WP_000829566.1|  glycolate oxidase [Shigella flexneri]           377   4e-127
ref|WP_016393624.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   4e-127
ref|WP_016492722.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   4e-127
gb|KGF64626.1|  glycolate oxidase subunit GlcD [Pseudomonas lu...    383   4e-127
ref|WP_007896065.1|  FAD-binding protein [Pseudomonas sp. GM102]     383   4e-127
ref|WP_002684371.1|  FAD-binding protein [Beggiatoa alba]            382   4e-127
ref|WP_020292857.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   4e-127
ref|WP_016487611.1|  FAD-binding protein [Pseudomonas putida]        383   4e-127
ref|WP_024766627.1|  glycolate oxidase subunit GlcD [Pseudomon...    383   4e-127
ref|WP_008065920.1|  FAD-binding protein [Pseudomonas sp. GM78]      383   4e-127
ref|WP_007947840.1|  FAD-binding protein [Pseudomonas sp. GM21]      383   5e-127
ref|WP_002554150.1|  FAD-binding protein [Pseudomonas savastanoi]    383   5e-127
gb|KFE46091.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    383   5e-127
ref|WP_005732614.1|  FAD-binding protein [Pseudomonas amygdali]      383   5e-127
ref|WP_010438662.1|  FAD-binding protein [Pseudomonas syringae]      382   6e-127
ref|WP_033044511.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   6e-127
gb|EXJ11679.1|  putative FAD-linked oxidoreductase [Nitrincola...    382   6e-127
ref|WP_007737419.1|  FAD-binding protein [Burkholderia sp. BT03]     382   6e-127
gb|AHZ68175.1|  glycolate oxidase subunit GlcD [Pseudomonas ma...    382   6e-127
ref|WP_031400852.1|  glycolate oxidase subunit GlcD [Burkholde...    382   6e-127
ref|WP_020801334.1|  glycolate oxidase, subunit GlcD [Pseudomo...    382   6e-127
ref|WP_010452972.1|  FAD-binding protein [Pseudomonas fuscovag...    382   7e-127
ref|WP_008569587.1|  FAD-binding protein [Pseudomonas sp. Chol1]     382   7e-127
gb|KGK81011.1|  glycolate oxidase subunit GlcD [Pseudomonas sp...    382   7e-127
ref|WP_018509249.1|  FAD-binding protein [Thiobacillus thioparus]    382   7e-127
ref|WP_003242234.1|  FAD-binding protein [Pseudomonas mendocina]     382   7e-127
ref|WP_004577334.1|  MULTISPECIES: FAD-binding protein [Pseudo...    382   8e-127
ref|WP_023410940.1|  hypothetical protein [uncultured Thiohalo...    382   8e-127
ref|WP_010657221.1|  FAD-binding protein [Pseudomonas fragi]         382   8e-127
ref|WP_003412219.1|  FAD-binding protein [Pseudomonas syringae]      382   8e-127
ref|WP_003446332.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   8e-127
ref|WP_010170941.1|  FAD-binding protein [Pseudomonas sp. PAMC...    382   1e-126
ref|WP_007919528.1|  MULTISPECIES: FAD-binding protein [Pseudo...    382   1e-126
ref|WP_024162066.1|  FAD-binding protein [Pseudomonas stutzeri]      382   1e-126
gb|AHG41754.1|  FAD-binding protein [Pseudomonas syringae CC1557]    382   1e-126
ref|WP_003286596.1|  FAD-binding protein [Pseudomonas stutzeri]      382   1e-126
ref|WP_016983313.1|  FAD-binding protein [Pseudomonas fluoresc...    382   1e-126
ref|WP_008049598.1|  FAD-binding protein [Pseudomonas sp. GM74]      382   1e-126
emb|CDK49093.1|  Glycolate dehydrogenase , subunit GlcD [Esche...    377   1e-126
ref|WP_019582698.1|  FAD-binding protein [Pseudomonas mandelii]      382   1e-126
ref|WP_003203701.1|  MULTISPECIES: FAD-binding protein [Pseudo...    382   1e-126
ref|WP_011659878.1|  FAD-binding protein [Burkholderia ambifaria]    382   1e-126
ref|WP_026345824.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   1e-126
ref|WP_024651388.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   1e-126
emb|CDZ95064.1|  glycolate oxidase subunit GlcD [Pseudomonas s...    382   1e-126
ref|WP_003378131.1|  FAD-binding protein [Pseudomonas syringae]      382   1e-126
ref|WP_024419700.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   1e-126
ref|WP_028241651.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   1e-126
ref|WP_024644026.1|  glycolate oxidase subunit GlcD [Pseudomon...    382   1e-126
ref|WP_007245321.1|  FAD-binding protein [Pseudomonas syringae...    382   1e-126
ref|WP_011268365.1|  FAD-binding protein [Pseudomonas syringae]      381   2e-126
ref|WP_024682147.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_016568526.1|  Glycolate oxidase, subunit GlcD [Pseudomo...    381   2e-126
ref|WP_024638676.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
gb|KES02358.1|  glycolate oxidase subunit GlcD [Pseudomonas me...    381   2e-126
ref|WP_024665168.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_011060567.1|  MULTISPECIES: FAD-binding protein [Pseudo...    381   2e-126
ref|WP_024677587.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_020358109.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_024661114.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
gb|EKG31266.1|  glycolate oxidase subunit GlcD [Pseudomonas av...    381   2e-126
ref|WP_024693349.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_024668057.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_003403770.1|  FAD-binding protein [Pseudomonas syringae]      381   2e-126
gb|KDR44186.1|  glycolate oxidase subunit GlcD [Burkholderia g...    381   2e-126
ref|WP_005765139.1|  MULTISPECIES: FAD-binding protein [Pseudo...    381   2e-126
ref|WP_008064833.1|  FAD-binding protein [Methyloversatilis un...    381   2e-126
gb|AHL73892.1|  glycolate oxidase subunit GlcD [Pseudomonas st...    381   2e-126
ref|WP_019407569.1|  FAD-binding protein [Pseudomonas stutzeri]      381   2e-126
ref|WP_018607075.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_029887047.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   2e-126
ref|WP_003283309.1|  FAD-binding protein [Pseudomonas stutzeri]      381   2e-126
ref|WP_025281537.1|  MULTISPECIES: glycolate oxidase subunit G...    381   2e-126
ref|WP_028366098.1|  glycolate oxidase subunit GlcD [Burkholde...    381   2e-126
dbj|BAO61656.1|  glycolate oxidase subunit GlcD [Pseudomonas p...    381   2e-126
ref|WP_003427179.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   3e-126
ref|WP_024684012.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   3e-126
ref|WP_018413402.1|  FAD-binding protein [Methyloversatilis sp...    381   3e-126
ref|WP_021163545.1|  Glycolate dehydrogenase, subunit GlcD [Bu...    381   3e-126
ref|WP_018418468.1|  FAD-binding protein [Burkholderia sp. WSM...    381   3e-126
ref|WP_017246133.1|  FAD-binding protein [Pseudomonas stutzeri]      381   3e-126
ref|WP_015635058.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   3e-126
ref|WP_019825612.1|  glycolate oxidase subunit GlcD [Pseudomon...    381   3e-126
ref|WP_016262547.1|  glycolate oxidase subunit glcD [Escherich...    380   3e-126
ref|WP_003226235.1|  FAD-binding protein [Pseudomonas fluoresc...    380   3e-126
ref|WP_011920510.1|  FAD-binding protein [Pseudomonas mendocina]     380   3e-126
ref|WP_029243767.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   3e-126
ref|WP_024675139.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   3e-126
ref|WP_004417149.1|  Glycolate oxidase, subunit GlcD [Pseudomo...    380   3e-126
ref|WP_015278497.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   3e-126
ref|WP_006761815.1|  FAD-binding protein [Burkholderia ambifaria]    380   3e-126
gb|AHY44529.1|  glycolate oxidase subunit GlcD [Pseudomonas st...    380   3e-126
ref|WP_001517089.1|  MULTISPECIES: glycolate oxidase subunit g...    380   3e-126
ref|WP_027907088.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   3e-126
gb|EZH77562.1|  glycolate oxidase subunit GlcD [Pseudomonas ps...    380   3e-126
ref|WP_017279105.1|  FAD-binding protein [Pseudomonas syringae]      380   3e-126
ref|WP_021443331.1|  FAD-binding protein [Pseudomonas sp. EGD-...    380   4e-126
ref|WP_000026086.1|  MULTISPECIES: FAD-binding protein [Escher...    380   4e-126
ref|WP_014337519.1|  FAD-binding protein [Pseudomonas fluoresc...    380   4e-126
ref|WP_025994556.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   4e-126
ref|WP_004423069.1|  FAD-binding protein [Pseudomonas pseudoal...    380   4e-126
ref|WP_011911667.1|  FAD-binding protein [Pseudomonas stutzeri]      380   4e-126
ref|WP_008043914.1|  FAD-binding protein [Pseudomonas sp. GM67]      380   4e-126
ref|WP_025163869.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   4e-126
ref|WP_014595640.1|  FAD-binding protein [Pseudomonas stutzeri]      380   4e-126
ref|WP_027781778.1|  glycolate oxidase subunit GlcD [Burkholde...    380   4e-126
ref|WP_013981565.1|  FAD-binding protein [Pseudomonas stutzeri]      380   4e-126
ref|WP_018228201.1|  FAD-binding protein [Methyloversatilis un...    380   4e-126
dbj|BAP57061.1|  FAD-binding protein [Thioploca ingrica]             380   4e-126
ref|WP_017676462.1|  MULTISPECIES: FAD-binding protein [Pseudo...    380   4e-126
ref|WP_017330932.1|  FAD-binding protein [Burkholderia pyrroci...    380   4e-126
ref|WP_032829134.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   5e-126
ref|WP_021571441.1|  glycolate oxidase subunit glcD [Escherich...    380   5e-126
ref|WP_016242950.1|  glycolate oxidase subunit glcD [Escherich...    380   5e-126
gb|AIO36427.1|  FAD binding domain protein [Burkholderia cenoc...    380   5e-126
ref|WP_011111296.1|  FAD-binding protein [Nitrosomonas europaea]     380   5e-126
ref|WP_024696965.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   5e-126
ref|WP_019408268.1|  FAD-binding protein [Pseudomonas psychrop...    380   5e-126
ref|WP_024306307.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   6e-126
gb|KER68663.1|  glycolate oxidase subunit GlcD [Burkholderia c...    380   7e-126
gb|EMX18694.1|  glycolate oxidase, subunit GlcD [Escherichia c...    380   7e-126
ref|WP_000829565.1|  hypothetical protein [Shigella flexneri]        374   7e-126
ref|WP_000026126.1|  FAD-binding protein [Escherichia coli]          380   7e-126
ref|WP_013693796.1|  FAD-binding protein [Pseudomonas brassica...    380   7e-126
ref|WP_000026121.1|  FAD-binding protein [Escherichia coli]          380   7e-126
gb|ADI22172.1|  FAD/FMN-containing dehydrogenases [uncultured ...    377   7e-126
ref|WP_009614179.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   8e-126
ref|WP_007184339.1|  FAD-binding protein [Hydrocarboniphaga ef...    380   8e-126
ref|WP_011333647.1|  FAD-binding protein [Pseudomonas fluoresc...    380   8e-126
ref|WP_017938186.1|  FAD-binding protein [Pseudomonas thermoto...    380   8e-126
ref|WP_009206079.1|  FAD-binding protein [Sulfuricella denitri...    380   8e-126
gb|KES24403.1|  glycolate oxidase subunit GlcD [Pseudomonas sp...    380   8e-126
ref|WP_000026145.1|  FAD-binding protein [Escherichia coli]          380   8e-126
ref|WP_023563523.1|  glycolate oxidase subunit GlcD [Escherich...    379   8e-126
ref|WP_027924740.1|  glycolate oxidase subunit GlcD [Pseudomon...    380   8e-126
ref|WP_024209412.1|  glycolate oxidase [Escherichia coli]            380   9e-126
ref|WP_001606136.1|  glycolate oxidase subunit glcD [Escherich...    379   9e-126
ref|WP_000026158.1|  FAD-binding protein [Escherichia coli]          379   9e-126
ref|WP_000026156.1|  FAD-binding protein [Escherichia coli]          379   9e-126
ref|WP_001527673.1|  glycolate oxidase subunit glcD [Escherich...    379   9e-126
ref|WP_001553423.1|  glycolate oxidase subunit glcD [Escherich...    379   9e-126
ref|WP_000026160.1|  FAD-binding protein [Escherichia coli]          379   9e-126
ref|WP_001696208.1|  glycolate oxidase subunit GlcD [Escherich...    379   9e-126
ref|WP_000026154.1|  FAD-binding protein [Escherichia coli]          379   9e-126
ref|WP_024658461.1|  glycolate oxidase subunit GlcD [Pseudomon...    379   9e-126
ref|WP_000026104.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_000026161.1|  FAD-binding protein [Escherichia coli]          379   1e-125
gb|KDX52151.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   1e-125
gb|AHE60837.1|  oxidoreductase [Escherichia albertii KF1]            379   1e-125
ref|WP_011353649.1|  FAD-binding protein [Burkholderia lata]         379   1e-125
ref|WP_000026125.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_021555709.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_005738716.1|  FAD-binding protein [Pseudomonas amygdali]      379   1e-125
gb|ENG02719.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   1e-125
ref|WP_021576468.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_001683289.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
gb|KDT46127.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   1e-125
ref|WP_000026119.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_003370418.1|  FAD-binding protein [Pseudomonas syringae]      379   1e-125
ref|WP_000026087.1|  FAD-binding protein [Escherichia albertii]      379   1e-125
ref|WP_028125924.1|  glycolate oxidase [Escherichia coli]            379   1e-125
ref|WP_021561393.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_000026157.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_029404379.1|  glycolate oxidase [Escherichia coli]            379   1e-125
ref|WP_022646112.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_001525642.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_028196520.1|  glycolate oxidase subunit GlcD [Burkholde...    379   1e-125
ref|WP_000026092.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_014639509.1|  FAD-binding protein [Escherichia coli]          379   1e-125
gb|AHF68377.1|  glycolate oxidase subunit GlcD [Pseudomonas ci...    379   1e-125
gb|KDZ54835.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   1e-125
ref|WP_021524516.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_000026155.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_000026153.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_021560038.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_000026102.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_000026112.1|  FAD-binding protein [Escherichia coli]          379   1e-125
gb|EHF99333.1|  glycolate oxidase subunit GlcD [Escherichia co...    379   1e-125
ref|WP_024166936.1|  glycolate oxidase [Escherichia coli]            379   1e-125
gb|KDZ67194.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   1e-125
ref|WP_018928039.1|  MULTISPECIES: FAD-binding protein [Pseudo...    379   1e-125
ref|WP_001608530.1|  glycolate oxidase subunit glcD [Escherich...    379   1e-125
ref|WP_027790225.1|  glycolate oxidase subunit GlcD [Burkholde...    379   1e-125
ref|WP_000026150.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_003436290.1|  glycolate oxidase subunit GlcD [Pseudomon...    379   1e-125
ref|WP_012311846.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_001298263.1|  FAD-binding protein [Escherichia coli]          379   1e-125
ref|WP_027662716.1|  glycolate oxidase [Escherichia coli]            379   1e-125
ref|WP_009849217.1|  FAD-binding protein [Mariprofundus ferroo...    379   1e-125
ref|WP_032270225.1|  glycolate oxidase [Escherichia coli]            379   2e-125
gb|ETJ24357.1|  Glycolate oxidase subunit glcD [Escherichia co...    378   2e-125
ref|WP_025491773.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_020232198.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_014148158.1|  FAD-binding protein [Methylomicrobium alc...    378   2e-125
ref|WP_000026110.1|  FAD-binding protein [Escherichia coli]          379   2e-125
gb|KFF49891.1|  glycolate oxidase subunit GlcD [Gammaproteobac...    379   2e-125
ref|WP_024250036.1|  glycolate oxidase [Shigella dysenteriae]        379   2e-125
ref|WP_024012466.1|  FAD-binding protein [Pseudomonas moravien...    379   2e-125
ref|WP_018294419.1|  FAD-binding protein [Mariprofundus ferroo...    379   2e-125
ref|WP_020165645.1|  FAD-binding protein [Methyloversatilis un...    379   2e-125
ref|WP_000026120.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_001296405.1|  glycolate oxidase subunit D [Escherichia ...    379   2e-125
gb|EFW69751.1|  Glycolate dehydrogenase , subunit GlcD [Escher...    379   2e-125
ref|WP_024247548.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_032611651.1|  glycolate oxidase subunit GlcD [Pseudomon...    379   2e-125
gb|EMW94837.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
ref|WP_027600386.1|  MULTISPECIES: glycolate oxidase subunit G...    379   2e-125
gb|EJM76292.1|  glycolate oxidase, subunit GlcD [Pseudomonas s...    380   2e-125
ref|WP_019691016.1|  FAD-binding protein [Pseudomonas fluoresc...    379   2e-125
dbj|BAP81578.1|  glycolate oxidase subunit GlcD [Pseudomonas s...    379   2e-125
ref|WP_021539794.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
ref|WP_016237531.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
ref|WP_013713372.1|  FAD-binding protein [Pseudomonas mendocina]     379   2e-125
gb|KEJ55519.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
ref|WP_000026159.1|  FAD-binding protein [Escherichia coli]          379   2e-125
gb|EZJ36139.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
ref|WP_000026146.1|  FAD-binding protein [Escherichia coli]          379   2e-125
gb|EMW98250.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
ref|WP_030103649.1|  glycolate oxidase subunit GlcD [Burkholde...    379   2e-125
ref|WP_000026085.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_001464673.1|  glycolate oxidase, subunit GlcD [Escheric...    379   2e-125
ref|WP_010222368.1|  FAD-binding protein [Pseudomonas sp. HYS]       379   2e-125
ref|WP_024662295.1|  glycolate oxidase subunit GlcD [Pseudomon...    379   2e-125
gb|KDA72341.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
gb|ENA04706.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
ref|WP_001652142.1|  glycolate oxidase, subunit GlcD [Escheric...    379   2e-125
ref|WP_000026098.1|  MULTISPECIES: FAD-binding protein [Escher...    379   2e-125
ref|WP_024226668.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_000026131.1|  MULTISPECIES: FAD-binding protein [Escher...    379   2e-125
gb|KDA56428.1|  glycolate oxidase, subunit GlcD [Escherichia c...    379   2e-125
emb|CDF86995.1|  Glycolate oxidase subunit glcD [Pseudomonas k...    379   2e-125
ref|WP_001498549.1|  glycolate oxidase, subunit GlcD [Escheric...    379   2e-125
ref|WP_000026144.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_013966912.1|  FAD-binding protein [Nitrosomonas sp. Is7...    378   2e-125
gb|EYD83663.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   2e-125
gb|END31309.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   2e-125
ref|WP_000026083.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_024169860.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_021577955.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
gb|EHW54155.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   2e-125
ref|WP_032226261.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_024240088.1|  glycolate oxidase [Escherichia coli]            379   2e-125
gb|ENG01226.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   2e-125
ref|WP_000026106.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_001376037.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_029401350.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_021557207.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
ref|WP_000026094.1|  MULTISPECIES: FAD-binding protein [Escher...    379   2e-125
ref|WP_000026143.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_021553869.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
ref|WP_020239840.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_000026097.1|  FAD-binding protein [Escherichia coli]          379   2e-125
ref|WP_000026140.1|  FAD-binding protein [Escherichia coli]          379   2e-125
gb|EZJ83424.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   2e-125
ref|WP_001588251.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
ref|WP_000026084.1|  FAD-binding protein [Escherichia coli]          379   2e-125
gb|EHW86985.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   2e-125
ref|WP_027598094.1|  glycolate oxidase subunit GlcD [Pseudomon...    379   2e-125
ref|WP_024167677.1|  glycolate oxidase [Escherichia coli]            379   2e-125
ref|WP_000026093.1|  FAD-binding protein [Escherichia sp. TW11...    379   2e-125
ref|WP_001596200.1|  glycolate oxidase subunit glcD [Escherich...    379   2e-125
gb|ESA29683.1|  Glycolate dehydrogenase, subunit GlcD [Escheri...    378   2e-125
ref|WP_001343595.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_021572952.1|  glycolate oxidase subunit glcD [Escherich...    378   2e-125
ref|WP_016159801.1|  MULTISPECIES: glycolate oxidase subunit g...    378   2e-125
ref|WP_000026090.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_000026103.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_000026095.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_000026096.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_001418734.1|  FAD-binding protein [Escherichia coli]          378   2e-125
ref|WP_001297762.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_016231447.1|  glycolate oxidase subunit glcD [Escherich...    378   3e-125
ref|WP_000026117.1|  MULTISPECIES: glycolate oxidase subunit, ...    378   3e-125
gb|ENB93424.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   3e-125
ref|WP_005076945.1|  FAD-binding protein [Shigella flexneri]         378   3e-125
ref|WP_000026091.1|  FAD-binding protein [Escherichia coli]          378   3e-125
gb|ENF29203.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   3e-125
ref|WP_032347221.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_032324093.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_032343908.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_000026132.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_005110531.1|  FAD-binding protein [Shigella flexneri]         378   3e-125
ref|WP_024220066.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_001581751.1|  glycolate oxidase, subunit GlcD [Escheric...    378   3e-125
ref|WP_000026148.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_000026128.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_032281587.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_000026108.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_032271716.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_024208082.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_001679489.1|  glycolate oxidase, subunit GlcD [Escheric...    378   3e-125
ref|WP_024205931.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_000026113.1|  FAD-binding protein [Escherichia coli]          378   3e-125
gb|EMW55243.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   3e-125
ref|WP_001600486.1|  glycolate oxidase subunit glcD [Escherich...    378   3e-125
emb|CDL25131.1|  Glycolate dehydrogenase , subunit GlcD [Esche...    378   3e-125
gb|ESA31006.1|  Glycolate dehydrogenase, subunit GlcD [Escheri...    378   3e-125
ref|WP_027915725.1|  glycolate oxidase subunit GlcD [Pseudomon...    378   3e-125
ref|WP_024208701.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_032284568.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_000026099.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_000026135.1|  FAD-binding protein [Shigella flexneri]         378   3e-125
ref|WP_032329304.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_021551407.1|  glycolate oxidase subunit glcD [Escherich...    378   3e-125
ref|WP_007251237.1|  FAD-binding protein [Pseudomonas syringae...    378   3e-125
ref|WP_012406568.1|  FAD-binding protein [Burkholderia phymatum]     378   3e-125
gb|EEH85580.1|  putative glycolate oxidase, subunit GlcD [Esch...    370   3e-125
gb|ENF49608.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   3e-125
ref|WP_024209335.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_000026127.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_000026151.1|  FAD-binding protein [Escherichia coli]          378   3e-125
ref|WP_024231635.1|  glycolate oxidase [Escherichia coli]            378   3e-125
ref|WP_000026142.1|  FAD-binding protein [Escherichia coli]          378   3e-125
gb|EMX08230.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   3e-125
ref|WP_028461606.1|  glycolate oxidase subunit GlcD [Nitrosomo...    377   3e-125
ref|WP_011310560.1|  FAD-binding protein [Thiobacillus denitri...    377   4e-125
ref|WP_023381128.1|  glycolate oxidase subunit GlcD [Pseudomon...    378   4e-125
ref|WP_019917042.1|  MULTISPECIES: FAD-binding protein [Rhodoc...    378   4e-125
ref|WP_027605712.1|  glycolate oxidase subunit GlcD [Pseudomon...    378   4e-125
ref|WP_000026118.1|  FAD-binding protein [Escherichia coli]          378   4e-125
ref|WP_021564643.1|  glycolate oxidase subunit glcD [Escherich...    378   4e-125
ref|WP_002461243.1|  FAD-binding protein [Escherichia albertii]      378   4e-125
ref|WP_000026123.1|  FAD-binding protein [Escherichia coli]          378   4e-125
ref|WP_010122710.1|  FAD-binding protein [Burkholderia oklahom...    378   4e-125
gb|EFR14825.1|  glycolate oxidase, subunit GlcD [Escherichia c...    378   4e-125
dbj|GAL54568.1|  glycolate oxidase subunit GlcD [Escherichia a...    378   5e-125
ref|WP_010111904.1|  FAD-binding protein [Burkholderia oklahom...    378   5e-125
ref|WP_001603739.1|  glycolate oxidase subunit glcD [Escherich...    378   5e-125
ref|WP_014854338.1|  FAD-binding protein [Pseudomonas stutzeri]      378   5e-125
gb|KEL76668.1|  glycolate oxidase, subunit GlcD [Escherichia c...    377   5e-125
gb|KDY22127.1|  glycolate oxidase, subunit GlcD [Escherichia c...    377   5e-125
ref|WP_001539704.1|  glycolate oxidase subunit glcD [Escherich...    377   5e-125
ref|WP_006753193.1|  FAD-binding protein [Burkholderia ambifaria]    377   5e-125
gb|ENC90097.1|  glycolate oxidase, subunit GlcD [Escherichia c...    377   5e-125
gb|KEM61061.1|  glycolate oxidase, subunit GlcD [Escherichia c...    377   5e-125
ref|WP_001559936.1|  glycolate oxidase subunit glcD [Escherich...    377   5e-125
ref|WP_024764354.1|  glycolate oxidase subunit GlcD [Pseudomon...    377   6e-125
ref|WP_024649355.1|  glycolate oxidase subunit GlcD [Pseudomon...    377   6e-125
ref|WP_032289857.1|  glycolate oxidase [Escherichia coli]            377   6e-125
ref|WP_019341699.1|  FAD-binding protein [Pseudomonas stutzeri]      377   6e-125
ref|WP_021518319.1|  glycolate oxidase subunit glcD [Escherich...    377   6e-125
ref|WP_021247861.1|  FAD-binding protein [Thauera terpenica]         377   7e-125
ref|WP_001537466.1|  glycolate oxidase subunit glcD [Escherich...    377   7e-125
emb|CCQ05977.1|  Glycolate dehydrogenase [Escherichia coli Nis...    377   7e-125
ref|WP_024204674.1|  glycolate oxidase [Escherichia coli]            377   7e-125
ref|WP_021517905.1|  glycolate oxidase subunit glcD [Escherich...    377   7e-125
ref|WP_001702592.1|  FAD-binding protein [Escherichia coli]          377   7e-125
ref|WP_021207216.1|  FAD-binding protein [Pseudomonas stutzeri]      377   7e-125
ref|WP_001617264.1|  glycolate oxidase subunit glcD [Escherich...    377   8e-125
ref|WP_000026133.1|  FAD-binding protein [Escherichia coli]          377   8e-125
ref|WP_000026124.1|  FAD-binding protein [Escherichia coli]          377   8e-125
ref|WP_000026111.1|  FAD-binding protein [Escherichia coli]          377   8e-125
ref|WP_015476425.1|  glycolate oxidase subunit GlcD [Pseudomon...    377   9e-125
ref|WP_001521315.1|  glycolate oxidase subunit glcD [Escherich...    377   9e-125
ref|WP_028689367.1|  glycolate oxidase subunit GlcD [Pseudomon...    377   1e-124
ref|WP_026145091.1|  glycolate oxidase subunit GlcD [Pseudomon...    377   1e-124
ref|WP_032251869.1|  glycolate oxidase [Escherichia coli]            377   1e-124
ref|WP_011634917.1|  FAD-binding protein [Nitrosomonas eutropha]     376   1e-124
ref|WP_000026116.1|  FAD-binding protein [Escherichia coli]          377   1e-124
gb|KDU27390.1|  glycolate oxidase, subunit GlcD [Escherichia c...    377   1e-124
ref|WP_021542240.1|  glycolate oxidase subunit glcD [Escherich...    377   1e-124
ref|WP_001653389.1|  glycolate oxidase, subunit GlcD [Escheric...    376   1e-124
ref|WP_001300655.1|  FAD-binding protein [Escherichia coli]          376   1e-124
ref|WP_003417707.1|  FAD-binding protein [Pseudomonas syringae]      376   1e-124
emb|CEE07451.1|  glycolate oxidase, subunit GlcD [Escherichia ...    376   2e-124
gb|EMW78381.1|  glycolate oxidase, subunit GlcD [Escherichia c...    376   2e-124
ref|WP_004175404.1|  Glycolate dehydrogenase, subunit GlcD [Ni...    375   2e-124
ref|WP_017773414.1|  FAD-binding protein [Burkholderia kururie...    376   2e-124
ref|WP_010796002.1|  glycolate oxidase subunit glcD [Pseudomon...    376   2e-124
ref|WP_000026147.1|  FAD-binding protein [Escherichia coli]          376   2e-124
ref|WP_000026130.1|  FAD-binding protein [Escherichia coli]          376   2e-124
ref|WP_028686394.1|  glycolate oxidase subunit GlcD [Pseudomon...    376   2e-124
gb|ENA94324.1|  glycolate oxidase, subunit GlcD [Escherichia c...    376   2e-124
gb|END01841.1|  glycolate oxidase, subunit GlcD [Escherichia c...    376   2e-124
ref|WP_024168324.1|  glycolate oxidase [Escherichia coli]            376   3e-124
ref|WP_007161470.1|  FAD-binding protein [Pseudomonas psychrot...    376   3e-124
ref|WP_021528317.1|  glycolate oxidase subunit glcD [Escherich...    376   3e-124
ref|WP_000026115.1|  FAD-binding protein [Escherichia coli]          375   3e-124
ref|WP_024206047.1|  glycolate oxidase [Escherichia coli]            375   3e-124
ref|WP_023143009.1|  glycolate oxidase, subunit GlcD [Escheric...    375   3e-124
ref|WP_012428216.1|  FAD-binding protein [Burkholderia phytofi...    375   3e-124
gb|ENG28587.1|  glycolate oxidase, subunit GlcD [Escherichia c...    375   3e-124
ref|WP_024252569.1|  glycolate oxidase [Escherichia coli]            375   3e-124
emb|CEA04991.1|  glycolate oxidase subunit GlcD [Pseudomonas s...    375   4e-124
ref|WP_024240638.1|  glycolate oxidase [Escherichia coli]            375   4e-124
ref|WP_022296663.1|  glycolate oxidase subunit GlcD [Escherich...    375   4e-124
ref|WP_027147057.1|  glycolate oxidase subunit GlcD [Methyloba...    375   4e-124
ref|WP_024689575.1|  glycolate oxidase subunit GlcD [Pseudomon...    375   4e-124
ref|WP_000026088.1|  FAD-binding protein [Escherichia albertii]      375   4e-124
ref|WP_022964653.1|  FAD-binding protein [Pseudomonas pelagia]       375   4e-124
ref|WP_024671056.1|  glycolate oxidase subunit GlcD [Pseudomon...    375   4e-124
ref|WP_001625968.1|  glycolate oxidase subunit glcD [Escherich...    375   4e-124
ref|WP_021567031.1|  glycolate oxidase subunit glcD [Escherich...    375   5e-124
gb|KDN98293.1|  glycolate oxidase, subunit GlcD [Pseudomonas s...    375   5e-124
ref|WP_028634392.1|  glycolate oxidase subunit GlcD [Pseudomon...    375   5e-124
ref|WP_000026105.1|  FAD-binding protein [Escherichia coli]          375   5e-124
ref|WP_017838974.1|  FAD-binding protein [Methylomicrobium bur...    375   5e-124
ref|WP_019364216.1|  FAD-binding protein [Pseudomonas luteola]       375   5e-124
ref|WP_016855768.1|  FAD-binding protein [Halomonas smyrnensis]      375   6e-124
ref|WP_026223816.1|  glycolate oxidase subunit GlcD [Methylosa...    374   6e-124
ref|WP_017520230.1|  FAD-binding protein [Pseudomonas nitrored...    375   6e-124
ref|WP_002813112.1|  FAD-binding protein [Nitrosococcus oceani]      375   7e-124
gb|KDT59351.1|  glycolate oxidase, subunit GlcD [Escherichia c...    374   8e-124
gb|ENG53707.1|  glycolate oxidase, subunit GlcD [Escherichia c...    374   8e-124
gb|ENF32558.1|  glycolate oxidase, subunit GlcD [Escherichia c...    374   8e-124
ref|WP_024254039.1|  glycolate oxidase [Escherichia coli]            374   8e-124
ref|WP_024208264.1|  glycolate oxidase [Escherichia coli]            374   8e-124
ref|WP_032257647.1|  glycolate oxidase [Escherichia coli]            374   9e-124
ref|WP_005115815.1|  FAD-binding protein [Shigella flexneri]         374   1e-123
ref|WP_024916832.1|  glycolate oxidase subunit GlcD [Pseudomon...    374   1e-123
ref|WP_025757541.1|  glycolate oxidase [Shigella flexneri]           374   1e-123
ref|WP_017941756.1|  MULTISPECIES: FAD-binding protein [Thioal...    374   1e-123
gb|AIN58143.1|  glycolate oxidase subunit GlcD [Pseudomonas mo...    374   1e-123
gb|ADI23641.1|  FAD/FMN-containing dehydrogenases [uncultured ...    374   1e-123
ref|WP_000026136.1|  FAD-binding protein [Shigella flexneri]         374   2e-123
gb|ENA77739.1|  glycolate oxidase, subunit GlcD [Escherichia c...    374   2e-123
ref|WP_024170232.1|  glycolate oxidase [Escherichia coli]            374   2e-123
ref|WP_017365658.1|  FAD-binding protein [Methylococcus capsul...    373   2e-123
ref|WP_024173521.1|  glycolate oxidase [Escherichia coli]            374   2e-123
gb|ENB10236.1|  glycolate oxidase, subunit GlcD [Escherichia c...    374   2e-123
ref|WP_025766358.1|  hypothetical protein [Shigella flexneri]        366   2e-123
gb|EZQ17888.1|  glycolate oxidase subunit GlcD [Pseudomonas ba...    374   2e-123
gb|EMV69777.1|  glycolate oxidase, subunit GlcD [Escherichia c...    373   2e-123
ref|WP_031384020.1|  glycolate oxidase subunit GlcD [Halomonas...    373   3e-123
ref|WP_012077955.1|  FAD-binding protein [Pseudomonas aeruginosa]    373   3e-123
ref|WP_024172833.1|  glycolate oxidase [Escherichia coli]            373   3e-123
ref|WP_031631502.1|  glycolate oxidase subunit GlcD [Pseudomon...    373   3e-123
ref|WP_031641610.1|  glycolate oxidase subunit GlcD [Pseudomon...    373   3e-123
ref|WP_024947522.1|  glycolate oxidase subunit GlcD [Pseudomon...    373   3e-123
ref|WP_023107419.1|  glycolate oxidase subunit glcD [Pseudomon...    373   3e-123
ref|WP_003136273.1|  FAD-binding protein [Pseudomonas aeruginosa]    373   3e-123
ref|WP_013221449.1|  FAD-binding protein [Nitrosococcus watsonii]    373   4e-123
gb|KFF33569.1|  glycolate oxidase subunit GlcD [Pseudomonas ae...    373   4e-123
ref|WP_010960777.1|  FAD-binding protein [Methylococcus capsul...    372   5e-123
ref|WP_015503855.1|  glycolate oxidase subunit GlcD [Pseudomon...    372   5e-123
ref|WP_007181941.1|  FAD-binding protein [Burkholderia sp. Ch1-1]    372   7e-123
ref|WP_001664735.1|  glycolate oxidase, subunit GlcD [Escheric...    372   7e-123
ref|WP_009314538.1|  FAD-binding protein [Pseudomonas sp. 2_1_26]    372   9e-123
gb|KDR26905.1|  glycolate oxidase subunit GlcD [Burkholderia g...    372   1e-122
ref|WP_023112011.1|  glycolate oxidase subunit glcD [Pseudomon...    372   1e-122
ref|WP_011488365.1|  FAD-binding protein [Burkholderia xenovor...    372   1e-122
gb|EDN67110.1|  glycolate oxidase,  subunit D [Beggiatoa sp. PS]     371   1e-122
gb|EEZ79525.1|  glycolate oxidase subunit GlcD [uncultured SUP...    369   2e-122
ref|WP_013033685.1|  FAD-binding protein [Nitrosococcus haloph...    371   2e-122
ref|WP_018864067.1|  MULTISPECIES: FAD-binding protein [Thioal...    370   3e-122
ref|WP_022976093.1|  FAD-binding protein [Nevskia ramosa]            370   4e-122
ref|WP_031763541.1|  glycolate oxidase subunit GlcD [Pseudomon...    370   4e-122
ref|WP_003162880.1|  Glycolate dehydrogenase, subunit GlcD [Ps...    370   4e-122
ref|WP_012614688.1|  FAD-binding protein [Pseudomonas aeruginosa]    370   4e-122
ref|WP_003121313.1|  FAD-binding protein [Pseudomonas aeruginosa]    370   4e-122
ref|WP_023113504.1|  glycolate oxidase subunit glcD [Pseudomon...    370   5e-122
ref|WP_011507980.1|  FAD-binding protein [Chromohalobacter sal...    370   5e-122
ref|WP_008919046.1|  FAD-binding protein [Burkholderia sp. H160]     370   5e-122
ref|WP_003114372.1|  FAD-binding protein [Pseudomonas aeruginosa]    370   5e-122
emb|CDQ35023.1|  putative FAD-linked oxidoreductase [Virgibaci...    370   5e-122
ref|WP_023085878.1|  glycolate oxidase subunit glcD [Pseudomon...    370   5e-122
ref|WP_025511188.1|  glycolate oxidase subunit GlcD [Oxalobact...    370   5e-122
ref|WP_028681426.1|  glycolate oxidase subunit GlcD [Pseudomon...    370   6e-122
ref|WP_003096641.1|  FAD-binding protein [Pseudomonas aeruginosa]    370   6e-122
ref|WP_025041382.1|  glycolate oxidase subunit GlcD [Nitrososp...    369   6e-122
ref|WP_023090974.1|  glycolate oxidase subunit glcD [Pseudomon...    370   6e-122
ref|WP_018995277.1|  MULTISPECIES: FAD-binding protein [Thioal...    370   6e-122
ref|WP_017429682.1|  FAD-binding protein [Halomonas jeotgali]        370   7e-122
ref|WP_018993570.1|  FAD-binding protein [Thioalkalivibrio sp....    369   7e-122
gb|ABE60034.1|  glycolate oxidase, subunit GlcD [Chromohalobac...    370   8e-122
ref|WP_011534335.1|  FAD-binding protein [Pseudomonas entomoph...    369   9e-122
ref|WP_011379535.1|  FAD-binding protein [Nitrosospira multifo...    369   9e-122
ref|WP_018990921.1|  FAD-binding protein [Azoarcus toluclasticus]    369   9e-122
ref|WP_021818337.1|  FAD-binding protein [Halomonas sp. BJGMM-...    369   9e-122
ref|WP_003161146.1|  FAD-binding protein [Pseudomonas aeruginosa]    369   1e-121
ref|WP_018139084.1|  MULTISPECIES: FAD-binding protein [Thioal...    369   1e-121
gb|KGF79556.1|  glycolate oxidase subunit GlcD [Massilia sp. J...    369   1e-121
ref|WP_031435498.1|  glycolate oxidase subunit GlcD [Methyloma...    369   1e-121
ref|WP_023096334.1|  glycolate oxidase subunit glcD [Pseudomon...    369   1e-121
gb|AHW74104.1|  glycolate oxidase subunit GlcD [Pseudomonas ae...    369   1e-121
ref|WP_018940519.1|  FAD-binding protein [Thioalkalivibrio sp....    369   1e-121
ref|WP_005668038.1|  glycolate oxidase, subunit GlcD [Massilia...    369   1e-121
ref|WP_028022409.1|  glycolate oxidase subunit GlcD [Enterovib...    368   2e-121
ref|WP_026340791.1|  glycolate oxidase subunit GlcD [Thioalkal...    369   2e-121
gb|KDE40915.1|  Glycolate dehydrogenase, subunit GlcD [Nitrinc...    368   2e-121
ref|WP_011156694.1|  FAD-binding protein [Rhodopseudomonas pal...    368   2e-121
ref|WP_028499799.1|  glycolate oxidase subunit GlcD [Microvirg...    368   3e-121
ref|WP_018950127.1|  FAD-binding protein [Thioalkalivibrio sp....    368   3e-121
ref|WP_006913509.1|  FAD-binding protein [Salinisphaera shaban...    368   3e-121
ref|WP_024327209.1|  glycolate oxidase subunit GlcD [Thioalkal...    368   3e-121
ref|WP_022948029.1|  FAD-binding protein [Methylohalobius crim...    367   3e-121
ref|WP_013648008.1|  FAD-binding protein [Nitrosomonas sp. AL212]    367   5e-121
ref|WP_003104603.1|  FAD-binding protein [Pseudomonas aeruginosa]    367   5e-121
ref|WP_018861628.1|  MULTISPECIES: FAD-binding protein [Thioal...    367   5e-121
ref|WP_016562494.1|  FAD-binding protein [Pseudomonas aeruginosa]    367   5e-121
ref|WP_023122427.1|  glycolate oxidase subunit glcD [Pseudomon...    367   6e-121
ref|WP_031598395.1|  glycolate oxidase subunit GlcD [Ferrovum ...    367   6e-121
ref|WP_023129204.1|  glycolate oxidase subunit glcD [Pseudomon...    367   7e-121
ref|WP_026344512.1|  glycolate oxidase subunit GlcD [Thioalkal...    367   7e-121
ref|WP_017006894.1|  hypothetical protein [Enterovibrio norveg...    366   8e-121
ref|WP_019024538.1|  MULTISPECIES: FAD-binding protein [Thioal...    367   8e-121
ref|WP_023435327.1|  FAD-binding protein [Pseudomonas aeruginosa]    367   8e-121
ref|WP_023115822.1|  glycolate oxidase subunit glcD [Pseudomon...    367   1e-120
ref|WP_018872955.1|  FAD-binding protein [Thioalkalivibrio sp....    366   1e-120
ref|WP_028874058.1|  glycolate oxidase subunit GlcD [Tepidiphi...    366   1e-120
ref|WP_024808484.1|  glycolate oxidase subunit GlcD [Verrucomi...    365   1e-120
ref|WP_028491182.1|  glycolate oxidase subunit GlcD [Thioalkal...    366   2e-120
ref|WP_020591184.1|  FAD-binding protein [Kiloniella laminariae]     366   2e-120
ref|WP_009877269.1|  MULTISPECIES: FAD-binding protein [Pseudo...    366   2e-120
ref|WP_026300559.1|  glycolate oxidase subunit GlcD [Halomonas...    366   2e-120
gb|EZP25123.1|  Glycolate dehydrogenase subunit GlcD [Burkhold...    365   2e-120
ref|WP_018867028.1|  MULTISPECIES: FAD-binding protein [Thioal...    365   2e-120
ref|WP_015259014.1|  Glycolate dehydrogenase, subunit GlcD [Th...    365   2e-120
ref|WP_014077795.1|  FAD-binding protein [Sphingobium sp. SYK-6]     365   3e-120
ref|WP_011813038.1|  FAD-binding protein [Halorhodospira halop...    365   3e-120
ref|WP_011504517.1|  FAD-binding protein [Rhodopseudomonas pal...    365   3e-120
ref|WP_018649384.1|  MULTISPECIES: FAD-binding protein [Thioal...    365   3e-120
ref|WP_012982406.1|  MULTISPECIES: FAD-binding protein [Thioal...    365   4e-120
ref|WP_011238354.1|  FAD-binding protein [Aromatoleum aromaticum]    365   4e-120
ref|WP_016958542.1|  hypothetical protein [Enterovibrio norveg...    364   4e-120
ref|WP_019593270.1|  FAD-binding protein [Thioalkalivibrio sp....    365   5e-120
ref|WP_017003405.1|  hypothetical protein [Enterovibrio norveg...    364   6e-120
ref|WP_018875620.1|  FAD-binding protein [Thioalkalivibrio sp....    365   6e-120
ref|WP_018877491.1|  MULTISPECIES: FAD-binding protein [Thioal...    364   7e-120
ref|WP_013501077.1|  FAD-binding protein [Rhodopseudomonas pal...    364   7e-120
ref|WP_018880556.1|  FAD-binding protein [Thioalkalivibrio sp....    364   8e-120
ref|WP_018169896.1|  FAD-binding protein [Thioalkalivibrio sp....    364   8e-120
ref|WP_018951911.1|  MULTISPECIES: FAD-binding protein [Thioal...    364   9e-120
ref|WP_011440723.1|  FAD-binding protein [Rhodopseudomonas pal...    364   1e-119
ref|WP_023083651.1|  glycolate oxidase subunit glcD [Pseudomon...    364   1e-119
ref|WP_019568306.1|  FAD-binding protein [Thioalkalivibrio sp....    364   1e-119
gb|AHE97904.1|  FAD-binding protein [Thioalkalivibrio thiocyan...    364   1e-119
ref|WP_018880306.1|  FAD-binding protein [Thioalkalivibrio sp....    363   1e-119
ref|WP_028484020.1|  glycolate oxidase subunit GlcD [Thioalkal...    363   2e-119
ref|WP_019571357.1|  FAD-binding protein [Thioalkalivibrio sp....    363   2e-119
ref|WP_018176702.1|  FAD-binding protein [Thioalkalivibrio sp....    363   2e-119
ref|WP_018140984.1|  MULTISPECIES: FAD-binding protein [Thioal...    363   2e-119
gb|KGA01724.1|  glycolate oxidase subunit GlcD [Cobetia marina]      363   3e-119
ref|WP_018882012.1|  MULTISPECIES: FAD-binding protein [Thioal...    363   3e-119
ref|WP_027593705.1|  glycolate oxidase subunit GlcD [Pseudomon...    363   3e-119
ref|WP_016746134.1|  FAD-binding protein [Sphingomonas wittichii]    362   4e-119
ref|WP_013331343.1|  FAD-binding protein [Halomonas elongata]        362   4e-119
ref|WP_030092201.1|  glycolate oxidase subunit GlcD [Sphingomo...    362   4e-119
gb|KGE78795.1|  glycolate oxidase subunit GlcD [Halomonas salina]    362   5e-119
ref|WP_011951836.1|  FAD-binding protein [Sphingomonas wittichii]    362   5e-119
ref|WP_029995224.1|  glycolate oxidase subunit GlcD [Sphingomo...    362   5e-119
gb|KDB06359.1|  D-lactate dehydrogenase (cytochrome) [Burkhold...    362   5e-119
ref|WP_010123839.1|  FAD-binding protein [Sphingomonas sp. KC8]      362   5e-119
ref|WP_015434748.1|  glycolate oxidase (FAD-linked subunit) ox...    362   6e-119
ref|WP_013742609.1|  FAD-binding protein [Pusillimonas sp. T7-7]     362   6e-119
ref|WP_018145537.1|  MULTISPECIES: FAD-binding protein [Thioal...    362   8e-119
ref|WP_022643685.1|  FAD-binding protein [Pseudomonas sp. CMAA...    362   8e-119
ref|WP_027349856.1|  glycolate oxidase subunit GlcD [Halotalea...    362   8e-119
ref|WP_009058941.1|  FAD-binding protein [Methylacidiphilum fu...    362   9e-119
ref|WP_006408365.1|  FAD-binding protein [Burkholderia multivo...    361   1e-118
ref|WP_013028964.1|  FAD-binding protein [Sideroxydans lithotr...    361   1e-118
ref|WP_018007941.1|  FAD-binding protein [Cupriavidus taiwanen...    361   2e-118
gb|ETP66342.1|  FAD-binding protein [Burkholderia dolosa PC543]      360   2e-118
ref|WP_023493845.1|  glycolate oxidase subunit GlcD [Methylogl...    360   2e-118
ref|WP_009757794.1|  FAD-binding protein [Ahrensia sp. R2A130]       360   2e-118
ref|WP_012353796.1|  FAD-binding protein [Cupriavidus taiwanen...    360   3e-118
ref|WP_027958133.1|  MULTISPECIES: glycolate oxidase subunit G...    360   3e-118
ref|WP_010091427.1|  FAD-binding protein [Burkholderia ubonensis]    360   3e-118
ref|WP_022522234.1|  Glycolate oxidase subunit GlcD [Halomonas...    360   3e-118
ref|WP_027336691.1|  glycolate oxidase subunit GlcD [Halomonas...    360   3e-118
ref|WP_008955987.1|  FAD-binding protein [Halomonas sp. HAL1]        360   3e-118
ref|WP_013957923.1|  FAD-binding protein [Cupriavidus necator]       360   4e-118
ref|WP_006401625.1|  FAD-binding protein [Burkholderia multivo...    360   4e-118
ref|WP_011280914.1|  FAD-binding protein [Psychrobacter arcticus]    360   4e-118
ref|WP_011315785.1|  FAD-binding protein [Nitrobacter winograd...    360   5e-118
gb|KFI07419.1|  glycolate oxidase subunit GlcD [Massilia sp. B...    360   5e-118
gb|AIT82082.1|  glycolate oxidase subunit GlcD [Novosphingobiu...    360   5e-118
ref|WP_018443776.1|  FAD-binding protein [Burkholderia sp. JPY...    359   6e-118
gb|AIO75350.1|  FAD binding domain protein [Burkholderia multi...    359   7e-118
ref|WP_011475135.1|  FAD-binding protein [Rhodopseudomonas pal...    359   7e-118
ref|WP_004383549.1|  FAD linked oxidase [Thauera phenylacetica]      359   8e-118
gb|AIO34296.1|  FAD binding domain protein [Burkholderia cenoc...    359   8e-118
ref|WP_004882658.1|  glycolate oxidase subunit GlcD [Pseudomon...    359   9e-118
ref|WP_018938575.1|  MULTISPECIES: FAD-binding protein [Thioal...    359   9e-118
emb|CDM23958.1|  Glycolate dehydrogenase, subunit GlcD [Castel...    359   9e-118
ref|WP_020409374.1|  hypothetical protein [Hahella ganghwensis]      358   1e-117
ref|WP_026285607.1|  glycolate oxidase subunit GlcD [Halomonas...    359   1e-117
ref|WP_016725995.1|  FAD-binding protein [Ralstonia solanacearum]    358   1e-117
ref|WP_018311524.1|  FAD-binding protein [Cupriavidus sp. UYPR...    359   1e-117
gb|KFC09784.1|  D-lactate dehydrogenase (cytochrome) [Halomona...    358   1e-117
gb|AIO42296.1|  FAD binding domain protein [Burkholderia cenoc...    358   1e-117
ref|WP_029757509.1|  glycolate oxidase subunit GlcD [Oxalobact...    355   2e-117
ref|WP_007014446.1|  FAD-binding protein [Novosphingobium pent...    360   2e-117
ref|WP_011514205.1|  MULTISPECIES: FAD-binding protein [Psychr...    358   2e-117
ref|WP_027865746.1|  glycolate oxidase subunit GlcD [Massilia ...    358   2e-117
ref|WP_011656020.1|  FAD-binding protein [Burkholderia ambifaria]    358   3e-117
ref|WP_004322879.1|  FAD linked oxidase [Thauera aminoaromatica]     358   3e-117
ref|WP_027134001.1|  glycolate oxidase subunit GlcD [Geminicoc...    357   3e-117
gb|KFC71998.1|  Glycolate oxidase, subunit GlcD [Massilia sp. ...    357   3e-117
ref|WP_009095960.1|  FAD-binding protein [Halomonas sp. GFAJ-1]      358   3e-117
ref|WP_028355750.1|  glycolate oxidase subunit GlcD [Bordetell...    358   3e-117
ref|WP_030540866.1|  glycolate oxidase subunit GlcD [Sphingobi...    357   3e-117
ref|WP_004342021.1|  glycolate oxidase subunit GlcD [Thauera l...    357   3e-117
ref|WP_012585121.1|  FAD-binding protein [Thauera sp. MZ1T]          358   4e-117
ref|WP_006760043.1|  FAD-binding protein [Burkholderia ambifaria]    357   4e-117
ref|WP_011002576.1|  FAD-binding protein [Ralstonia solanacearum]    357   4e-117
ref|WP_014898026.1|  FAD-binding protein [Burkholderia cepacia]      357   5e-117
gb|KFL51166.1|  glycolate oxidase subunit GlcD [Burkholderia p...    357   5e-117
ref|WP_006388443.1|  FAD-binding protein [Achromobacter xyloso...    357   5e-117
ref|WP_019718297.1|  FAD-binding protein [Ralstonia solanacearum]    357   5e-117
ref|WP_025140326.1|  glycolate oxidase subunit GlcD [Alcaligen...    357   6e-117
ref|WP_020924479.1|  Glycolate dehydrogenase [Achromobacter xy...    357   6e-117
ref|WP_028860944.1|  glycolate oxidase subunit GlcD [Ralstonia...    357   6e-117
ref|WP_028853584.1|  glycolate oxidase subunit GlcD [Ralstonia...    357   6e-117
ref|WP_029048949.1|  glycolate oxidase subunit GlcD [Cupriavid...    357   6e-117
ref|WP_010815040.1|  MULTISPECIES: FAD-binding protein [Burkho...    357   7e-117
ref|WP_009721310.1|  FAD-binding protein [Halomonas sp. TD01]        357   7e-117
emb|CAL60511.2|  Glycolate oxidase subunit glcD [Herminiimonas...    357   9e-117
ref|WP_021163857.1|  Glycolate dehydrogenase, subunit GlcD [Bu...    356   1e-116
ref|WP_009798837.1|  FAD-binding protein [Nitrobacter sp. Nb-3...    356   1e-116
ref|WP_011869857.1|  FAD-binding protein [Herminiimonas arseni...    357   1e-116
ref|WP_016916194.1|  FAD-binding protein [Halomonas stevensii]       356   1e-116
gb|KGC03696.1|  FAD binding domain protein [Burkholderia cepacia]    356   1e-116
ref|WP_027783607.1|  glycolate oxidase subunit GlcD [Burkholde...    356   1e-116
ref|WP_026384187.1|  glycolate oxidase subunit GlcD [Achromoba...    356   1e-116
ref|WP_023367218.1|  hypothetical protein [Spiribacter sp. UAH...    356   1e-116
ref|WP_018402201.1|  hypothetical protein [gamma proteobacteri...    352   1e-116
ref|WP_026610517.1|  glycolate oxidase subunit GlcD [Methyloca...    356   1e-116
ref|WP_031402171.1|  glycolate oxidase subunit GlcD [Burkholde...    356   1e-116
ref|WP_006218384.1|  FAD-binding protein [Achromobacter piecha...    356   1e-116
ref|WP_026334999.1|  glycolate oxidase subunit GlcD [Oxalobact...    356   1e-116
ref|WP_016353450.1|  FAD linked oxidase domain-containing prot...    356   1e-116
ref|WP_024068246.1|  Glycolate dehydrogenase, subunit GlcD [Ac...    357   1e-116
ref|WP_030074001.1|  glycolate oxidase subunit GlcD [Halomonas...    356   1e-116
gb|KGF82777.1|  glycolate oxidase subunit GlcD [Massilia sp. J...    356   1e-116
ref|WP_024974807.1|  glycolate oxidase subunit GlcD [Ralstonia...    356   1e-116
ref|WP_012078200.1|  FAD-binding protein [Janthinobacterium sp...    356   1e-116
ref|WP_016417657.1|  FAD-binding protein [Halomonas anticarien...    356   2e-116
ref|WP_009955571.1|  FAD-binding protein [Burkholderia pseudom...    356   2e-116
ref|WP_007113789.1|  FAD-binding protein [Halomonas boliviensis]     356   2e-116
ref|WP_004631634.1|  FAD/FMN-dependent dehydrogenase [Ralstoni...    355   2e-116
ref|WP_012436365.1|  MULTISPECIES: FAD-binding protein [Betapr...    355   2e-116
ref|WP_009241460.1|  MULTISPECIES: FAD-binding protein [Ralsto...    355   2e-116
gb|KER67277.1|  glycolate oxidase subunit GlcD [Burkholderia c...    355   2e-116
gb|AIA73677.1|  glycolate oxidase subunit GlcD [Halomonas camp...    355   2e-116
gb|AHV92038.1|  FAD linked oxidase, C-terminal domain protein ...    350   2e-116
ref|WP_006393786.1|  FAD-binding protein [Achromobacter insuavis]    355   2e-116
ref|WP_004251576.1|  glycolate oxidase subunit GlcD [Thauera s...    355   2e-116
ref|WP_006497501.1|  FAD-binding protein [Burkholderia cenocep...    355   2e-116
ref|WP_026439358.1|  glycolate oxidase subunit GlcD [Acidocell...    355   2e-116
ref|WP_019570535.1|  FAD-binding protein [Thioalkalivibrio sp....    355   2e-116
ref|WP_006157561.1|  FAD-binding protein [Cupriavidus basilensis]    352   2e-116
ref|WP_026868614.1|  glycolate oxidase subunit GlcD [Inquilinu...    355   3e-116
ref|WP_008331860.1|  FAD-binding protein [Herbaspirillum sp. G...    355   3e-116
ref|WP_025917484.1|  glycolate oxidase subunit GlcD [Herminiim...    355   3e-116
ref|WP_013235767.1|  FAD-binding protein [Herbaspirillum serop...    355   3e-116
gb|KEA59696.1|  glycolate oxidase subunit GlcD [Burkholderia c...    355   3e-116
ref|WP_019139518.1|  FAD-binding protein [Herbaspirillum massi...    355   3e-116
ref|WP_013392577.1|  FAD-binding protein [Achromobacter xyloso...    356   3e-116
ref|WP_018231105.1|  FAD-binding protein [Thioalkalivibrio thi...    355   3e-116
ref|WP_011883331.1|  MULTISPECIES: FAD-binding protein [Burkho...    355   3e-116
ref|WP_022536518.1|  FAD-binding protein [Ralstonia pickettii]       355   3e-116
ref|WP_020747607.1|  Glycolate oxidase subunit glcD [Ralstonia...    355   4e-116
ref|WP_006224976.1|  FAD-binding protein [Achromobacter piecha...    355   4e-116
ref|WP_019448160.1|  FAD-binding protein [Cupriavidus sp. BIS7]      355   4e-116
ref|WP_003271904.1|  FAD-binding protein [Ralstonia solanacearum]    355   4e-116
gb|KGD94297.1|  glycolate oxidase subunit GlcD [Achromobacter ...    355   4e-116
gb|KFX28520.1|  glycolate oxidase subunit GlcD [Ralstonia sola...    355   5e-116
ref|WP_011351007.1|  MULTISPECIES: FAD-binding protein [Burkho...    354   5e-116
ref|WP_010106234.1|  FAD-binding protein [Burkholderia oklahom...    354   5e-116
ref|WP_004550017.1|  FAD-binding protein [Burkholderia pseudom...    354   5e-116
ref|WP_011544628.1|  FAD-binding protein [Burkholderia cenocep...    354   5e-116
ref|WP_019963209.1|  FAD-binding protein [Pannonibacter phragm...    354   5e-116
gb|AIA56107.1|  Glycolate dehydrogenase, subunit GlcD [Acidith...    354   5e-116
ref|WP_013205213.1|  FAD-binding protein [Ralstonia solanacearum]    354   6e-116
ref|WP_012417815.1|  FAD-binding protein [Bordetella avium]          354   6e-116
ref|WP_021195921.1|  FAD-binding protein [Ralstonia sp. AU12-08]     354   6e-116
ref|WP_029579670.1|  glycolate oxidase subunit GlcD [Bordetell...    354   6e-116
emb|CAQ62568.1|  glycolate oxidase (fad-linked subunit) protei...    354   7e-116
ref|WP_023477001.1|  Glycolate dehydrogenase, subunit GlcD [Bu...    354   7e-116
ref|WP_006935602.1|  FAD-binding protein [Labrenzia aggregata]       354   8e-116
ref|WP_008494228.1|  FAD-binding protein [Acidocella sp. MX-AZ02]    354   8e-116
ref|WP_008164340.1|  FAD-binding protein [Achromobacter arseni...    354   8e-116
ref|WP_004194074.1|  MULTISPECIES: FAD-binding protein [pseudo...    354   8e-116
ref|WP_027551970.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    354   9e-116
ref|WP_012762825.1|  FAD-binding protein [Ralstonia pickettii]       354   9e-116
ref|WP_014616197.1|  FAD-binding protein [Ralstonia solanacearum]    354   9e-116
ref|WP_013211559.1|  FAD-binding protein [Ralstonia solanacearum]    354   9e-116
gb|KCB35944.1|  glycolate oxidase subunit GlcD [Bordetella hin...    353   1e-115
ref|WP_011832244.1|  FAD-binding protein [Burkholderia mallei]       353   1e-115
emb|CCA79750.1|  glycolate oxidase subunit glcD [blood disease...    353   1e-115
ref|WP_017333242.1|  FAD-binding protein [Burkholderia pyrroci...    353   1e-115
ref|WP_026332958.1|  glycolate oxidase subunit GlcD [Thioalkal...    353   1e-115
ref|WP_026300739.1|  glycolate oxidase subunit GlcD [Thioalkal...    353   1e-115
ref|WP_014917878.1|  FAD-binding protein [Burkholderia pseudom...    353   2e-115
ref|WP_004579115.1|  FAD linked oxidase domain-containing prot...    353   2e-115
ref|WP_002927589.1|  FAD linked oxidase [Thauera sp. 28]             353   2e-115
ref|WP_002536218.1|  Glycolate dehydrogenase , subunit GlcD [G...    352   2e-115
ref|WP_002943643.1|  FAD linked oxidase [Thauera sp. 27]             353   2e-115
ref|WP_027288293.1|  glycolate oxidase subunit GlcD [Rhodovibr...    353   2e-115
ref|WP_006492994.1|  FAD-binding protein [Burkholderia cenocep...    353   2e-115
gb|EXI75618.1|  putative FAD-linked oxidoreductase [Candidatus...    353   2e-115
gb|KCB27410.1|  glycolate oxidase subunit GlcD [Bordetella hin...    354   2e-115
ref|WP_027680600.1|  glycolate oxidase subunit GlcD [Ralstonia...    353   2e-115
ref|WP_004522136.1|  FAD-binding protein [Burkholderia pseudom...    353   2e-115
ref|WP_012463232.1|  FAD-binding protein [Methylacidiphilum in...    353   2e-115
ref|WP_018058906.1|  FAD-binding protein [Oxalobacteraceae bac...    352   2e-115
ref|WP_027575916.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    353   3e-115
ref|WP_017452401.1|  MULTISPECIES: FAD-binding protein [Herbas...    352   3e-115
gb|KGD53067.1|  FAD binding domain protein [Burkholderia pseud...    352   3e-115
ref|WP_006461990.1|  glycolate oxidase (FAD-linked subunit) ox...    352   4e-115
ref|WP_003263094.1|  FAD-binding protein [Ralstonia solanacearum]    354   4e-115
gb|KDP86187.1|  glycolate oxidase subunit GlcD [Cupriavidus sp...    352   4e-115
ref|WP_004538734.1|  FAD-binding protein [Burkholderia pseudom...    352   4e-115
ref|WP_028445121.1|  glycolate oxidase subunit GlcD [Chitinimo...    352   4e-115
ref|WP_012729920.1|  FAD-binding protein [Burkholderia pseudom...    352   5e-115
ref|WP_008112882.1|  FAD-binding protein [Herbaspirillum sp. Y...    352   5e-115
ref|WP_012590712.1|  FAD-binding protein [Methylocella silvest...    352   5e-115
ref|WP_011517471.1|  FAD-binding protein [Cupriavidus metallid...    352   5e-115
ref|WP_012384880.1|  FAD-binding protein [Beijerinckia indica]       352   6e-115
ref|WP_028816810.1|  glycolate oxidase subunit GlcD [beta prot...    352   7e-115
gb|KFB68497.1|  putative FAD-linked oxidoreductase [Candidatus...    352   7e-115
emb|CCA84939.1|  glycolate oxidase subunit glcD [Ralstonia syz...    352   7e-115
ref|WP_018946157.1|  FAD-binding protein [Thioalkalivibrio sp....    351   8e-115
gb|EZP40741.1|  Glycolate oxidase subunit GlcD [Janthinobacter...    351   8e-115
ref|WP_014003413.1|  FAD-binding protein [Acidithiobacillus ca...    351   8e-115
ref|WP_020204167.1|  FAD-binding protein [Cupriavidus sp. WS]        351   8e-115
ref|WP_006047900.1|  FAD-binding protein [Burkholderia graminis]     351   9e-115
ref|WP_006575627.1|  glycolate oxidase subunit, FAD-linked [Cu...    352   9e-115
ref|WP_017685961.1|  FAD-binding protein [Bordetella holmesii]       350   9e-115
ref|WP_020656304.1|  FAD-binding protein [Massilia niastensis]       351   1e-114
ref|WP_009664962.1|  FAD-binding protein [Oxalobacteraceae bac...    351   1e-114
ref|WP_031406131.1|  glycolate oxidase subunit GlcD [Thiomonas...    351   1e-114
ref|WP_029970436.1|  glycolate oxidase subunit GlcD [Burkholde...    351   1e-114
ref|WP_008445247.1|  glycolate oxidase subunit GlcD [Janthinob...    351   1e-114
ref|WP_008945897.1|  FAD-binding protein [Oceanibaculum indicum]     351   1e-114
ref|WP_015001651.1|  FAD-binding protein [Burkholderia phenoli...    351   1e-114
ref|WP_007670606.1|  FAD-binding protein [alpha proteobacteriu...    351   1e-114
ref|WP_019939386.1|  FAD-binding protein [Bordetella sp. FB-8]       351   2e-114
ref|WP_012249644.1|  FAD-binding protein [Bordetella petrii]         350   2e-114
ref|WP_019590181.1|  MULTISPECIES: FAD-binding protein [Thioal...    350   2e-114
ref|WP_026638077.1|  glycolate oxidase subunit GlcD [Bordetell...    350   2e-114
ref|WP_026087939.1|  glycolate oxidase subunit GlcD [Bordetell...    350   2e-114
ref|WP_028469500.1|  glycolate oxidase subunit GlcD [Neptunomo...    350   2e-114
ref|WP_008641953.1|  glycolate oxidase subunit, FAD-linked [Cu...    350   2e-114
ref|WP_025601586.1|  glycolate oxidase subunit GlcD [Burkholde...    350   2e-114
ref|WP_011289041.1|  FAD-binding protein [Dechloromonas aromat...    350   2e-114
ref|WP_026988017.1|  glycolate oxidase subunit GlcD [Fodinicur...    350   2e-114
ref|WP_031269770.1|  MULTISPECIES: glycolate oxidase subunit G...    350   2e-114
ref|WP_020069693.1|  MULTISPECIES: FAD-binding protein [Burkho...    350   2e-114
ref|WP_027799424.1|  glycolate oxidase subunit GlcD [Burkholde...    350   3e-114
ref|WP_029048623.1|  glycolate oxidase subunit GlcD [Cupriavid...    350   3e-114
ref|WP_029351530.1|  glycolate oxidase subunit GlcD [Bosea sp....    350   3e-114
ref|WP_028221107.1|  glycolate oxidase subunit GlcD [Burkholde...    350   3e-114
gb|ERP88704.1|  FAD-binding protein [Labrenzia sp. C1B10]            350   3e-114
ref|WP_024329898.1|  glycolate oxidase subunit GlcD [Thioalkal...    350   3e-114
ref|WP_010394794.1|  FAD-binding protein [Janthinobacterium li...    350   4e-114
ref|WP_028997378.1|  glycolate oxidase subunit GlcD [Azohydrom...    350   4e-114
ref|WP_022729462.1|  FAD-binding protein [Fodinicurvata sedimi...    350   4e-114
ref|WP_007191482.1|  FAD-binding protein [Thiocapsa marina]          351   4e-114
gb|EXI92524.1|  putative FAD-linked oxidoreductase [Candidatus...    349   5e-114
gb|ADI21923.1|  FAD/FMN-containing dehydrogenases [uncultured ...    347   5e-114
ref|WP_006025348.1|  FAD-binding protein [Burkholderia thailan...    350   6e-114
ref|WP_009913510.1|  FAD-binding protein [Burkholderia thailan...    349   6e-114
ref|WP_012523568.1|  FAD-binding protein [Phenylobacterium zuc...    349   6e-114
ref|WP_029646648.1|  glycolate oxidase subunit GlcD [Methylosa...    349   6e-114
ref|WP_005019053.1|  glycolate oxidase subunit [Bordetella hol...    349   6e-114
gb|KFB75623.1|  putative FAD-linked oxidoreductase [Candidatus...    349   7e-114
gb|AHI28142.1|  FAD-binding protein [Marinobacter sp. A3d10]         349   7e-114
ref|WP_029556367.1|  glycolate oxidase subunit GlcD [Xanthobac...    349   7e-114
ref|WP_027816820.1|  glycolate oxidase subunit GlcD [Burkholde...    349   7e-114
gb|KCV63539.1|  glycolate oxidase subunit GlcD [Bordetella bro...    349   7e-114
ref|WP_028361810.1|  glycolate oxidase subunit GlcD [Burkholde...    349   8e-114
ref|WP_005012671.1|  glycolate oxidase subunit [Bordetella hol...    349   8e-114
ref|WP_007877881.1|  FAD-binding protein [Herbaspirillum sp. C...    348   8e-114
ref|WP_013587163.1|  FAD-binding protein [Burkholderia sp. CCG...    349   9e-114
ref|WP_012113893.1|  FAD-binding protein [Xanthobacter autotro...    349   9e-114
gb|KDD15060.1|  glycolate oxidase subunit GlcD [Bordetella bro...    348   9e-114
ref|WP_024281384.1|  glycolate oxidase subunit GlcD [Xanthobac...    349   1e-113
gb|KDC13448.1|  glycolate oxidase subunit GlcD [Bordetella bro...    348   1e-113
gb|KAK50357.1|  glycolate oxidase subunit GlcD [Bordetella bro...    348   1e-113
ref|WP_003820322.1|  glycolate oxidase subunit [Bordetella bro...    348   1e-113
ref|WP_015039543.1|  glycolate oxidase subunit [Bordetella par...    348   1e-113
ref|WP_003813050.1|  FAD-binding protein [Bordetella bronchise...    348   1e-113
ref|WP_025514538.1|  glycolate oxidase subunit GlcD [Bordetell...    348   1e-113
ref|WP_011629632.1|  FAD-binding protein [Alkalilimnicola ehrl...    348   1e-113
ref|WP_028102177.1|  glycolate oxidase subunit GlcD [Duganella...    348   1e-113
gb|KEA65018.1|  Glycolate dehydrogenase, subunit GlcD [Marinob...    348   1e-113
ref|WP_013338083.1|  FAD-binding protein [Burkholderia sp. CCG...    348   1e-113
ref|WP_018290511.1|  hypothetical protein [Verrucomicrobium sp...    349   1e-113
ref|WP_009889224.1|  FAD-binding protein [Burkholderia thailan...    348   2e-113
ref|WP_020680433.1|  FAD-binding protein [Marinobacterium rhiz...    348   2e-113
gb|KAK82322.1|  glycolate oxidase subunit GlcD [Bordetella hol...    348   2e-113
ref|WP_006476857.1|  FAD linked oxidase-like [Burkholderia cen...    342   2e-113
ref|WP_023853660.1|  glycolate oxidase subunit GlcD [Bordetell...    348   2e-113
ref|WP_018871363.1|  FAD-binding protein [Thioalkalivibrio sp....    348   2e-113
ref|WP_010931193.1|  FAD-binding protein [Bordetella pertussis]      348   2e-113
ref|WP_023473971.1|  putative FAD-linked oxidoreductase [Betap...    348   2e-113
gb|EPM60953.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    348   2e-113
ref|WP_028996223.1|  glycolate oxidase subunit GlcD [Azonexus ...    347   2e-113
ref|WP_027211722.1|  glycolate oxidase subunit GlcD [Burkholde...    347   3e-113
ref|WP_014905988.1|  FAD-binding protein [Bordetella pertussis]      347   3e-113
ref|WP_028371893.1|  glycolate oxidase subunit GlcD [Burkholde...    348   3e-113
ref|WP_029363111.1|  glycolate oxidase subunit GlcD [Herbaspir...    347   3e-113
ref|WP_014004728.1|  FAD-binding protein [Collimonas fungivorans]    347   3e-113
gb|KDB10474.1|  D-lactate dehydrogenase (cytochrome) [Burkhold...    347   3e-113
gb|ETF01750.1|  FAD-binding protein [Advenella kashmirensis W1...    347   3e-113
ref|WP_031242885.1|  glycolate oxidase subunit GlcD [Advenella...    347   3e-113
ref|WP_019562058.1|  FAD-binding protein [Caldimonas manganoxi...    347   4e-113
emb|CDQ09732.1|  Glycolate oxidase subunit glcD [Acidithiobaci...    347   4e-113
ref|WP_009542736.1|  Glycolate dehydrogenase , subunit GlcD [C...    347   5e-113
ref|WP_014778031.1|  FAD-binding protein [Thiocystis violascens]     347   5e-113
ref|WP_007223515.1|  FAD-binding protein [marine gamma proteob...    347   5e-113
ref|WP_007578613.1|  MULTISPECIES: FAD-binding protein [Burkho...    347   5e-113
ref|WP_008939436.1|  glycolate oxidase, FAD-linked subunit [Ma...    346   8e-113
ref|WP_017879274.1|  FAD-binding protein [Janthinobacterium sp...    346   8e-113
ref|WP_012401890.1|  FAD-binding protein [Burkholderia phymatum]     346   8e-113
ref|WP_027996365.1|  glycolate oxidase subunit GlcD [Simplicis...    346   8e-113
ref|WP_010928571.1|  FAD-binding protein [Bordetella parapertu...    346   9e-113
ref|WP_028100153.1|  glycolate oxidase subunit GlcD [Dongia sp...    346   9e-113
ref|WP_016344304.1|  D-lactate dehydrogenase [Burkholderia sp....    347   1e-112
ref|WP_028201996.1|  glycolate oxidase subunit GlcD [Burkholde...    346   1e-112
gb|AHG64394.1|  glycolate oxidase subunit GlcD [Advenella mimi...    346   1e-112
gb|EXI78728.1|  putative FAD-linked oxidoreductase [Candidatus...    345   1e-112
ref|WP_025899345.1|  glycolate oxidase subunit GlcD [Sneathiel...    345   1e-112
ref|WP_028226562.1|  glycolate oxidase subunit GlcD [Burkholde...    345   1e-112
gb|EWY37460.1|  FAD-binding protein [Skermanella stibiiresiste...    345   1e-112
ref|WP_011764732.1|  FAD-binding protein [Azoarcus sp. BH72]         345   2e-112
ref|WP_018716994.1|  hypothetical protein [Arhodomonas aquaeolei]    345   2e-112
ref|WP_029134884.1|  glycolate oxidase subunit GlcD [Sedimenti...    345   2e-112
ref|WP_007228775.1|  F420H2:quinone oxidoreductase [marine gam...    342   2e-112
ref|WP_012971128.1|  FAD-binding protein [Allochromatium vinosum]    345   2e-112
gb|ETY79681.1|  Glycolate dehydrogenase, subunit GlcD [Burkhol...    345   3e-112
ref|WP_008125540.1|  FAD-binding protein [Phyllobacterium sp. ...    345   3e-112
ref|WP_028216121.1|  glycolate oxidase subunit GlcD [Burkholde...    345   4e-112
ref|WP_029652358.1|  glycolate oxidase subunit GlcD [Marinobac...    344   4e-112
ref|WP_008923437.1|  FAD-binding protein [Burkholderia sp. H160]     344   4e-112
gb|KDB53480.1|  FAD linked oxidase domain-containing protein [...    345   4e-112
ref|WP_028209473.1|  glycolate oxidase subunit GlcD [Burkholde...    345   4e-112
ref|WP_027230226.1|  glycolate oxidase subunit GlcD [Phyllobac...    344   4e-112
ref|WP_012431780.1|  FAD-binding protein [Burkholderia phytofi...    344   4e-112
ref|WP_007009700.1|  FAD-binding protein [Nitratireductor aqui...    344   5e-112
emb|CCQ72516.1|  glycolate oxidase, subunit GlcD [Magnetospira...    344   5e-112
ref|WP_007153416.1|  FAD-binding protein [Marinobacter algicola]     344   5e-112
ref|WP_020505568.1|  FAD-binding protein [Lamprocystis purpurea]     344   6e-112
emb|CDG85159.1|  FAD linked oxidases, C-terminal domain protei...    344   6e-112
ref|WP_028230109.1|  glycolate oxidase subunit GlcD [Burkholde...    344   7e-112
ref|WP_010640889.1|  FAD-binding protein [Acidithiobacillus th...    343   8e-112
ref|WP_014748079.1|  FAD-binding protein [Tistrella mobilis]         343   1e-111
ref|WP_019924650.1|  FAD-binding protein [Duganella zoogloeoides]    343   1e-111
ref|WP_027196742.1|  glycolate oxidase subunit GlcD [Burkholde...    343   1e-111
ref|WP_014290904.1|  FAD-binding protein [Oceanimonas sp. GK1]       342   1e-111
ref|WP_022990758.1|  FAD-binding protein [Marinobacter sp. C1S70]    343   1e-111
ref|WP_026229539.1|  glycolate oxidase subunit GlcD [Burkholde...    343   1e-111
ref|WP_023008668.1|  FAD-binding protein [Marinobacter sp. EVN1]     343   1e-111
ref|WP_030102046.1|  glycolate oxidase subunit GlcD [Burkholde...    343   1e-111
gb|EXI87611.1|  putative FAD-linked oxidoreductase [Candidatus...    343   1e-111
ref|WP_026287498.1|  glycolate oxidase subunit GlcD [Thioalkal...    343   2e-111
ref|WP_008593895.1|  FAD-binding protein [Nitratireductor paci...    343   2e-111
ref|WP_019996702.1|  FAD-binding protein [Aureimonas ureilytica]     343   2e-111
ref|WP_027795794.1|  glycolate oxidase subunit GlcD [Burkholde...    343   2e-111
ref|WP_031572716.1|  glycolate oxidase subunit GlcD [Acidithio...    342   2e-111
ref|WP_002717117.1|  glycolate oxidase, subunit GlcD [Afipia f...    343   2e-111
ref|WP_011486844.1|  FAD-binding protein [Burkholderia xenovor...    343   2e-111
ref|WP_014422552.1|  FAD-binding protein [Marinobacter hydroca...    342   2e-111
ref|WP_025030026.1|  glycolate oxidase subunit GlcD [Nitratire...    342   2e-111
ref|WP_012136829.1|  FAD linked oxidase domain-containing prot...    342   2e-111
ref|WP_007179215.1|  FAD-binding protein [Burkholderia sp. Ch1-1]    342   2e-111
ref|WP_024510533.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    342   3e-111
ref|WP_028198847.1|  glycolate oxidase subunit GlcD [Burkholde...    342   3e-111
ref|WP_023010666.1|  FAD-binding protein [Marinobacter sp. EN3]      342   3e-111
ref|WP_012168614.1|  FAD-binding protein [Azorhizobium caulino...    343   3e-111
dbj|BAO79951.1|  FAD/FMN-containing dehydrogenase [Comamonadac...    342   5e-111
ref|WP_009208278.1|  FAD-binding protein [Aurantimonas mangano...    342   5e-111
ref|WP_024894359.1|  glycolate oxidase subunit GlcD [Acidithio...    341   5e-111
ref|WP_008169283.1|  MULTISPECIES: FAD-binding protein [Marino...    341   6e-111
ref|WP_028351541.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    342   6e-111
ref|WP_013088487.1|  MULTISPECIES: FAD-binding protein [Burkho...    342   6e-111
ref|WP_029583272.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    341   7e-111
ref|WP_014246802.1|  FAD-binding protein [Azospirillum lipoferum]    341   7e-111
gb|KDV25018.1|  glycolate oxidase subunit GlcD [Burkholderia c...    338   7e-111
ref|WP_018419466.1|  FAD-binding protein [Burkholderia sp. WSM...    341   7e-111
ref|WP_015766525.1|  FAD-binding protein [Candidatus Accumulib...    341   8e-111
ref|WP_014239816.1|  FAD-binding protein [Azospirillum brasile...    341   8e-111
ref|WP_027833170.1|  glycolate oxidase subunit GlcD [Marinobac...    341   9e-111
ref|WP_007043009.1|  FAD-binding protein [Thiorhodococcus drew...    341   1e-110
ref|WP_014030502.1|  FAD-binding protein [Acidithiobacillus fe...    341   1e-110
ref|WP_018698891.1|  FAD-binding protein [Amorphus coralli]          341   1e-110
ref|WP_024349282.1|  glycolate oxidase subunit GlcD [Aurantimo...    341   1e-110
gb|KFB10991.1|  FAD linked oxidase-like protein [Nitratireduct...    341   1e-110
ref|WP_013654208.1|  FAD-binding protein [Polymorphum gilvum]        341   1e-110
gb|KGC17626.1|  hypothetical protein DM48_3594 [Burkholderia m...    340   1e-110
ref|WP_017776965.1|  FAD-binding protein [Burkholderia kururie...    340   1e-110
ref|WP_013696706.1|  FAD-binding protein [Burkholderia gladioli]     341   1e-110
gb|KEF30543.1|  Glycolate dehydrogenase , subunit GlcD [Marino...    340   2e-110
gb|EZQ09126.1|  glycolate oxidase subunit GlcD [Azospirillum b...    340   2e-110
ref|WP_028467148.1|  glycolate oxidase subunit GlcD [Nisaea de...    340   2e-110
ref|WP_029058561.1|  glycolate oxidase subunit GlcD [Stappia s...    340   3e-110
ref|WP_009451544.1|  FAD-binding protein [Nitratireductor indi...    340   3e-110
ref|WP_009339845.1|  FAD-binding protein [Afipia sp. 1NLS2]          340   3e-110
gb|EXJ14044.1|  Glycolate dehydrogenase , subunit GlcD [Thiorh...    339   3e-110
ref|WP_027298422.1|  glycolate oxidase subunit GlcD [Rhodospir...    339   3e-110
gb|ABI29278.1|  GlcD [uncultured marine bacterium]                   332   4e-110
ref|WP_011786716.1|  FAD-binding protein [Marinobacter hydroca...    339   4e-110
ref|WP_027580161.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    339   5e-110
ref|WP_032355159.1|  glycolate oxidase [Shigella flexneri]           330   5e-110
ref|WP_024588352.1|  glycolate oxidase subunit GlcD [Aliihoefl...    339   6e-110
ref|WP_028033989.1|  glycolate oxidase subunit GlcD [Chelativo...    339   6e-110
ref|WP_012029670.1|  FAD-binding protein [Bradyrhizobium sp. O...    338   8e-110
gb|AHF02953.1|  FAD-binding protein [Marichromatium purpuratum...    338   8e-110
ref|WP_012041905.1|  FAD-binding protein [Bradyrhizobium sp. B...    338   9e-110
gb|EXL03715.1|  glycolate oxidase subunit GlcD [Aquamicrobium ...    338   9e-110
ref|WP_029950115.1|  glycolate oxidase subunit GlcD [Burkholde...    338   1e-109
ref|WP_019575803.1|  FAD-binding protein [Curvibacter lanceola...    338   1e-109
ref|WP_015688626.1|  FAD-binding protein [Bradyrhizobium sp. S...    338   1e-109
ref|WP_007068086.1|  FAD-binding protein [Fulvimarina pelagi]        338   2e-109
ref|WP_006611368.1|  FAD-binding protein [Bradyrhizobium sp. O...    338   2e-109
ref|WP_028601706.1|  glycolate oxidase subunit GlcD [Ottowia t...    338   2e-109
ref|WP_024514150.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    338   2e-109
ref|WP_027476069.1|  glycolate oxidase subunit GlcD [Curvibact...    338   2e-109
ref|WP_027546060.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    338   2e-109
ref|WP_008965755.1|  FAD-binding protein [Bradyrhizobium sp. S...    338   2e-109
gb|KGE11585.1|  glycolate oxidase subunit GlcD [Burkholderia g...    337   2e-109
ref|WP_027565448.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    338   2e-109
ref|WP_009028894.1|  FAD-binding protein [Bradyrhizobium sp. O...    338   2e-109
ref|WP_011399516.1|  FAD-binding protein [Hahella chejuensis]        337   2e-109
ref|WP_027537052.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    337   2e-109
ref|WP_027520443.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    337   2e-109
ref|WP_015669376.1|  glycolate oxidase, subunit GlcD [Bradyrhi...    337   2e-109
ref|WP_028182289.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    337   2e-109
ref|WP_011579711.1|  FAD-binding protein [Chelativorans sp. BNC1]    337   2e-109
ref|WP_007596965.1|  FAD-binding protein [Bradyrhizobium sp. W...    337   2e-109
ref|WP_018453423.1|  FAD-binding protein [Mesorhizobium sp. WS...    337   3e-109
gb|ABI29386.1|  GlcD [uncultured marine bacterium]                   330   3e-109
ref|WP_028166969.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    337   3e-109
ref|WP_011090275.1|  FAD-binding protein [Bradyrhizobium diazo...    337   4e-109
ref|WP_028482461.1|  glycolate oxidase subunit GlcD [Nesiotoba...    337   4e-109
ref|WP_028174604.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    337   4e-109
ref|WP_008969043.1|  FAD-binding protein [Bradyrhizobium sp. S...    337   4e-109
gb|EXI69416.1|  putative FAD-linked oxidoreductase [Candidatus...    337   4e-109
ref|WP_025033768.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    337   5e-109
ref|WP_011666068.1|  FAD-binding protein [Rhodopseudomonas pal...    337   5e-109
ref|WP_011298936.1|  FAD-binding protein [Cupriavidus pinatubo...    337   5e-109
ref|WP_011828559.1|  FAD-binding protein [Methylibium petrolei...    337   5e-109
ref|WP_024813184.1|  glycolate oxidase subunit GlcD [Acidovora...    337   6e-109
ref|WP_024337506.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    336   6e-109
ref|WP_028147977.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    336   8e-109
ref|WP_007614999.1|  FAD-binding protein [Bradyrhizobium sp. W...    336   9e-109
ref|WP_029526448.1|  glycolate oxidase subunit GlcD [Polaromon...    336   9e-109
ref|WP_019644274.1|  FAD-binding protein [Novispirillum iterso...    335   1e-108
ref|WP_018648437.1|  FAD-binding protein [Bradyrhizobium japon...    335   1e-108
emb|CDS52225.1|  Glycolate dehydrogenase , subunit GlcD [Polar...    335   1e-108
ref|WP_027525014.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    335   1e-108
ref|WP_027534146.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    335   2e-108
gb|EWH01659.1|  F420H2:quinone oxidoreductase [Halomonas sp. B...    328   2e-108
ref|WP_014491901.1|  FAD-binding protein [Bradyrhizobium japon...    335   2e-108
ref|WP_009758947.1|  FAD-binding protein [Roseibium sp. TrichS...    335   2e-108
ref|WP_028157907.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    335   2e-108
ref|WP_018913823.1|  FAD-binding protein [Thiomonas sp. FB-6]        335   2e-108
gb|ERS81998.1|  FAD-binding protein [Halomonas sp. PBN3]             335   2e-108
ref|WP_009604064.1|  FAD-binding protein [SAR116 cluster alpha...    335   2e-108
ref|WP_012973123.1|  FAD-binding protein [Azospirillum lipoferum]    335   2e-108
ref|WP_008250580.1|  FAD-binding protein [Limnobacter sp. MED105]    335   3e-108
ref|WP_029011123.1|  glycolate oxidase subunit GlcD [Azospiril...    335   3e-108
ref|WP_028341115.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    334   5e-108
ref|WP_008130109.1|  FAD/FMN-dependent dehydrogenase [Bradyrhi...    332   5e-108
ref|WP_031218749.1|  glycolate oxidase subunit GlcD [Halomonas...    333   6e-108
ref|WP_018405372.1|  FAD-binding protein [Marinobacter lipolyt...    333   6e-108
ref|WP_007352595.1|  FAD-binding protein [Marinobacter sp. ELB17]    333   7e-108
ref|WP_027027681.1|  glycolate oxidase subunit GlcD [Mesorhizo...    333   7e-108
ref|WP_027563116.1|  MULTISPECIES: glycolate oxidase subunit G...    333   7e-108
ref|WP_009523417.1|  FAD-binding protein [Ralstonia sp. PBA]         333   1e-107
ref|WP_024581183.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    333   1e-107
ref|WP_028333008.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    333   1e-107
ref|WP_018269765.1|  FAD-binding protein [Bradyrhizobium elkanii]    333   1e-107
ref|WP_018321895.1|  FAD-binding protein [Bradyrhizobium japon...    333   1e-107
ref|WP_014238424.1|  FAD-binding protein [Azospira oryzae]           332   2e-107
ref|WP_027101714.1|  glycolate oxidase subunit GlcD [Comamonad...    333   2e-107
ref|WP_012348265.1|  FAD-binding protein [Leptothrix cholodnii]      333   2e-107
gb|ESZ14869.1|  F420H2:quinone oxidoreductase [Mesorhizobium s...    326   2e-107
ref|WP_028140084.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    332   2e-107
ref|WP_019173059.1|  FAD-binding protein [Pseudaminobacter sal...    332   2e-107
ref|WP_011831211.1|  FAD-binding protein [Methylibium petrolei...    332   3e-107
ref|WP_013045598.1|  FAD-binding protein [Candidatus Puniceisp...    332   3e-107
ref|WP_028819382.1|  glycolate oxidase subunit GlcD [beta prot...    332   4e-107
ref|WP_027279377.1|  glycolate oxidase subunit GlcD [Rhodopseu...    332   4e-107
ref|WP_029564091.1|  glycolate oxidase subunit GlcD [alpha pro...    332   4e-107
ref|WP_011511595.1|  FAD-binding protein [Nitrobacter hamburge...    332   5e-107
gb|KGM35563.1|  glycolate oxidase subunit GlcD [Inquilinus lim...    331   6e-107
ref|WP_005673956.1|  FAD-binding protein [Lautropia mirabilis]       333   6e-107
ref|WP_002713448.1|  glycolate oxidase, subunit GlcD [Afipia c...    331   6e-107
ref|WP_011903617.1|  FAD-binding protein [Polynucleobacter nec...    331   6e-107
ref|WP_028134310.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    331   7e-107
gb|ESY65344.1|  FAD-binding protein [Mesorhizobium sp. LNHC232...    331   8e-107
ref|WP_021080990.1|  glycolate oxidase, subunit GlcD [Bradyrhi...    331   8e-107
ref|WP_018426615.1|  FAD-binding protein [Hoeflea sp. 108]           331   8e-107
gb|ETR78502.1|  FAD-binding protein [Afipia sp. P52-10]              331   9e-107
ref|WP_014869649.1|  FAD-binding protein [Marinobacter sp. BSs...    331   9e-107
ref|WP_031258078.1|  glycolate oxidase subunit GlcD [Mesorhizo...    331   1e-106
ref|WP_023815113.1|  FAD-binding protein [Mesorhizobium sp. L2...    330   1e-106
ref|WP_021588171.1|  hypothetical protein [Ochrobactrum sp. EG...    330   1e-106
ref|WP_010914420.1|  FAD-binding protein [Mesorhizobium loti]        330   1e-106
ref|WP_029079257.1|  glycolate oxidase subunit GlcD [Bradyrhiz...    330   1e-106
ref|WP_017235823.1|  FAD-binding protein [Pandoraea sp. B-6]         331   1e-106
ref|WP_007091659.1|  FAD-binding protein [Thalassospira xiamen...    330   1e-106
ref|WP_010808258.1|  D-lactate dehydrogenase [Pandoraea sp. SD...    331   1e-106
ref|WP_015316501.1|  FAD-binding protein [Mesorhizobium austra...    330   1e-106
ref|WP_023771361.1|  FAD-binding protein [Mesorhizobium sp. LN...    330   2e-106
ref|WP_028731239.1|  MULTISPECIES: glycolate oxidase subunit G...    330   2e-106
ref|WP_027042599.1|  glycolate oxidase subunit GlcD [Mesorhizo...    330   2e-106
ref|WP_023782439.1|  FAD-binding protein [Mesorhizobium sp. LN...    330   2e-106
ref|WP_023794748.1|  FAD-binding protein [Mesorhizobium sp. LN...    330   2e-106
ref|WP_027033627.1|  glycolate oxidase subunit GlcD [Mesorhizo...    330   2e-106
ref|WP_013893877.1|  FAD-binding protein [Mesorhizobium opport...    330   2e-106
ref|WP_029708991.1|  glycolate oxidase subunit GlcD [Rhodofera...    329   2e-106
ref|WP_027056187.1|  glycolate oxidase subunit GlcD [Mesorhizo...    330   2e-106
gb|AID28319.1|  FAD binding domain protein [Mesorhizobium huak...    330   2e-106
ref|WP_027061431.1|  glycolate oxidase subunit GlcD [Mesorhizo...    330   2e-106
ref|WP_023670550.1|  FAD-binding protein [Mesorhizobium sp. LS...    330   2e-106
ref|WP_027047180.1|  glycolate oxidase subunit GlcD [Mesorhizo...    330   2e-106
ref|WP_026608278.1|  glycolate oxidase subunit GlcD [Methyloca...    329   3e-106
ref|WP_032929030.1|  glycolate oxidase subunit GlcD [Mesorhizo...    329   3e-106
emb|CDX45562.1|  glycolate oxidase, subunit GlcD [Mesorhizobiu...    329   3e-106
ref|WP_012567324.1|  FAD-binding protein [Rhodospirillum cente...    329   3e-106
emb|CDX54406.1|  glycolate oxidase subunit, FAD-linked [Mesorh...    329   4e-106
emb|CDX33447.1|  glycolate oxidase, subunit GlcD [Mesorhizobiu...    329   4e-106
gb|AHN76554.1|  glycolate oxidase subunit GlcD [Pandoraea pnom...    330   4e-106
ref|WP_023827921.1|  FAD-binding protein [Mesorhizobium sp. L1...    329   4e-106
ref|WP_023872219.1|  FAD-binding protein [Pandoraea sp. RB-44]       330   4e-106
emb|CDX19581.1|  glycolate oxidase, subunit GlcD [Mesorhizobiu...    329   4e-106
ref|WP_023728111.1|  FAD-binding protein [Mesorhizobium sp. LS...    329   4e-106
ref|WP_023776655.1|  FAD-binding protein [Mesorhizobium sp. LN...    329   4e-106
ref|WP_012734701.1|  FAD-binding protein [Burkholderia glumae]       329   5e-106
ref|WP_023710128.1|  MULTISPECIES: FAD-binding protein [Mesorh...    329   5e-106
ref|WP_023695104.1|  MULTISPECIES: FAD-binding protein [Mesorh...    329   5e-106
ref|WP_009734345.1|  FAD-binding protein [Bradyrhizobiaceae ba...    329   5e-106
ref|WP_028639783.1|  glycolate oxidase subunit GlcD [Novosphin...    328   5e-106
gb|EGD01242.1|  (S)-2-hydroxy-acid oxidase [Burkholderia sp. T...    328   5e-106
ref|WP_023738270.1|  FAD-binding protein [Mesorhizobium sp. LN...    328   6e-106
ref|WP_023756824.1|  FAD-binding protein [Mesorhizobium sp. LN...    328   6e-106
gb|KDB51465.1|  FAD linked oxidase domain-containing protein [...    328   6e-106
ref|WP_023686828.1|  MULTISPECIES: FAD-binding protein [Mesorh...    328   6e-106
ref|WP_015280825.1|  FAD/FMN-dependent dehydrogenase [Thioflav...    328   6e-106
ref|WP_023809027.1|  MULTISPECIES: FAD-binding protein [Mesorh...    328   7e-106
ref|WP_013530350.1|  MULTISPECIES: FAD-binding protein [Mesorh...    328   7e-106
ref|WP_024919844.1|  MULTISPECIES: glycolate oxidase subunit G...    328   7e-106
ref|WP_008877375.1|  glycolate oxidase, subunit GlcD [Mesorhiz...    328   8e-106
ref|WP_011982731.1|  FAD-binding protein [Ochrobactrum anthropi]     328   8e-106
ref|WP_023715639.1|  FAD-binding protein [Mesorhizobium sp. LS...    328   8e-106
ref|WP_031357477.1|  glycolate oxidase subunit GlcD [Burkholde...    328   8e-106
ref|WP_006022251.1|  glycolate oxidase, subunit GlcD [Afipia b...    328   8e-106
ref|WP_008552241.1|  FAD-binding protein [Pseudovibrio sp. JE062]    328   8e-106
ref|WP_023740494.1|  FAD-binding protein [Mesorhizobium sp. LN...    328   8e-106
ref|WP_023748625.1|  FAD-binding protein [Mesorhizobium sp. LN...    328   8e-106
ref|WP_029928001.1|  glycolate oxidase subunit GlcD [Ochrobact...    328   9e-106
ref|WP_027164317.1|  glycolate oxidase subunit GlcD [Mesorhizo...    328   1e-105
ref|WP_023732345.1|  FAD-binding protein [Mesorhizobium sp. LN...    328   1e-105
ref|WP_024848641.1|  glycolate oxidase subunit GlcD [Aminobact...    328   1e-105
ref|WP_010660975.1|  FAD-binding protein [Ochrobactrum anthropi]     328   1e-105
ref|WP_006204031.1|  FAD-binding protein [Mesorhizobium amorphae]    328   1e-105
ref|WP_006329414.1|  glycolate oxidase, subunit GlcD [Mesorhiz...    328   1e-105
gb|EEX85270.1|  glycolate oxidase subunit GlcD [Brucella ceti ...    322   1e-105
ref|WP_014284232.1|  FAD-binding protein [Pseudovibrio sp. FO-...    328   1e-105
ref|WP_023707956.1|  FAD-binding protein [Mesorhizobium sp. LS...    328   1e-105
ref|WP_008838638.1|  FAD-binding protein [Mesorhizobium alhagi]      328   2e-105
ref|WP_023692348.1|  FAD-binding protein [Mesorhizobium sp. LS...    328   2e-105
emb|CDX43629.1|  glycolate oxidase subunit, FAD-linked [Mesorh...    327   2e-105
ref|WP_024574207.1|  MULTISPECIES: glycolate oxidase subunit G...    327   2e-105
ref|WP_024924641.1|  MULTISPECIES: glycolate oxidase subunit G...    327   3e-105
ref|WP_023800348.1|  FAD-binding protein [Mesorhizobium sp. L4...    327   3e-105
ref|WP_006468478.1|  FAD-binding protein [Ochrobactrum interme...    327   3e-105
ref|WP_027156344.1|  glycolate oxidase subunit GlcD [Mesorhizo...    327   3e-105
ref|WP_006472494.1|  D-lactate dehydrogenase [Ochrobactrum int...    327   3e-105
ref|WP_023709138.1|  FAD-binding protein [Mesorhizobium sp. LS...    327   3e-105
gb|KDR44705.1|  glycolate oxidase subunit GlcD [Burkholderia g...    327   3e-105
ref|WP_029348380.1|  glycolate oxidase subunit GlcD [Mesorhizo...    327   3e-105
ref|WP_023701295.1|  MULTISPECIES: FAD-binding protein [Mesorh...    327   3e-105
emb|CDX23585.1|  glycolate oxidase, subunit GlcD [Mesorhizobiu...    327   4e-105
ref|WP_023830451.1|  FAD-binding protein [Mesorhizobium sp. L1...    327   4e-105
gb|KDR36110.1|  glycolate oxidase subunit GlcD [Burkholderia g...    327   4e-105
gb|AIU26727.1|  glycolate oxidase subunit GlcD [Pandoraea pnom...    327   4e-105
ref|WP_007878006.1|  D-lactate dehydrogenase [Ochrobactrum sp....    327   4e-105
gb|EEY01762.1|  LOW QUALITY PROTEIN: D-lactate dehydrogenase [...    322   4e-105
ref|WP_023680457.1|  FAD-binding protein [Mesorhizobium sp. LS...    327   4e-105
ref|WP_010805144.1|  FAD linked oxidase [Pandoraea sp. SD6-2]        327   6e-105
ref|WP_027146159.1|  glycolate oxidase subunit GlcD [Mesorhizo...    326   6e-105
gb|KEO59477.1|  FAD-binding protein [Thalassospira permensis N...    326   6e-105
ref|WP_027811877.1|  glycolate oxidase subunit GlcD [Burkholde...    325   7e-105
ref|WP_023820854.1|  FAD-binding protein [Mesorhizobium sp. L2...    326   7e-105
ref|WP_024897718.1|  glycolate oxidase subunit GlcD [Ochrobact...    326   8e-105
ref|WP_026152946.1|  glycolate oxidase subunit GlcD [alpha pro...    326   9e-105
ref|WP_026152929.1|  MULTISPECIES: glycolate oxidase subunit G...    325   9e-105
ref|WP_008509458.1|  FAD-binding protein [Brucella inopinata]        325   9e-105
gb|EFM60265.1|  (S)-2-hydroxy-acid oxidase chain D [Brucella s...    323   9e-105
ref|WP_023594493.1|  MULTISPECIES: FAD-binding protein [Pandor...    326   1e-104
ref|WP_012564413.1|  FAD-binding protein [Oligotropha carboxid...    325   1e-104
ref|WP_009118698.1|  FAD-binding protein [Neisseria shayeganii]      325   2e-104
ref|WP_009373185.1|  FAD-binding protein [alpha proteobacteriu...    325   2e-104
ref|WP_028469247.1|  glycolate oxidase subunit GlcD [Neptunomo...    324   3e-104
gb|AIJ49263.1|  FAD-binding protein [Comamonas testosteroni TK...    325   3e-104
ref|WP_003050665.1|  FAD-binding protein [Comamonas testosteroni]    325   3e-104
ref|WP_023716471.1|  FAD-binding protein [Mesorhizobium sp. LS...    324   3e-104
gb|ENQ09695.1|  glycolate oxidase, subunit GlcD [Brucella abor...    323   3e-104
ref|WP_008446554.1|  glycolate oxidase subunit GlcD [Janthinob...    324   3e-104
ref|WP_008351488.1|  FAD-binding protein [Burkholderia sp. SJ98]     324   6e-104
ref|WP_025662956.1|  glycolate oxidase subunit GlcD [alpha pro...    323   6e-104
gb|KAK49696.1|  glycolate oxidase subunit GlcD [Burkholderia s...    324   7e-104
ref|WP_003073745.1|  FAD-binding protein [Comamonas testosteroni]    324   7e-104
gb|KGH11662.1|  FAD-binding protein [Comamonas testosteroni]         324   7e-104
ref|WP_006175792.1|  MULTISPECIES: FAD-binding protein [Brucella]    323   7e-104
ref|WP_006191685.1|  MULTISPECIES: FAD-binding protein [Brucella]    323   8e-104
ref|WP_002968275.1|  FAD-binding protein [Brucella abortus]          323   8e-104
ref|WP_002971289.1|  FAD-binding protein [Brucella melitensis]       323   8e-104
ref|WP_029016490.1|  glycolate oxidase subunit GlcD [alpha pro...    323   8e-104
ref|WP_002966402.1|  MULTISPECIES: FAD-binding protein [Brucella]    323   8e-104
ref|WP_019621126.1|  hypothetical protein [Amphritea japonica]       323   8e-104
gb|KGG90254.1|  FAD-binding protein [Comamonas testosteroni]         323   8e-104
ref|WP_029167899.1|  glycolate oxidase subunit GlcD [alpha pro...    323   9e-104
ref|WP_007856006.1|  FAD-binding protein [Acidovorax sp. CF316]      323   9e-104
gb|KGH26713.1|  FAD-binding protein [Comamonas testosteroni]         323   9e-104
ref|WP_006073310.1|  FAD-binding protein [Brucella suis]             323   9e-104
gb|EEP61719.1|  (S)-2-hydroxy-acid oxidase chain D [Brucella a...    324   9e-104
ref|WP_006203607.1|  glycolate oxidase, subunit GlcD [Brucella...    323   9e-104
ref|WP_004690013.1|  FAD-binding protein [Brucella suis]             323   9e-104
gb|ADI16527.1|  fad/fmn-containing dehydrogenases [uncultured ...    323   9e-104
gb|KGG91404.1|  FAD-binding protein [Comamonas testosteroni]         323   1e-103
ref|WP_021310842.1|  hypothetical protein [Brucella melitensis]      323   1e-103
ref|WP_005960011.1|  FAD-binding protein [endosymbiont of Rift...    323   1e-103
ref|WP_006474584.1|  FAD-binding protein [endosymbiont of Tevn...    322   1e-103
ref|WP_003068550.1|  FAD-binding protein [Comamonas testosteroni]    323   1e-103
ref|WP_014190448.1|  FAD-binding protein [Burkholderia sp. YI23]     323   1e-103
ref|WP_006108299.1|  glycolate oxidase, subunit GlcD [Brucella...    322   2e-103
ref|WP_011005798.1|  FAD-binding protein [Brucella melitensis]       323   2e-103
ref|WP_005971915.1|  glycolate oxidase, subunit GlcD [Brucella...    322   2e-103
ref|WP_021004977.1|  glycolate oxidase, subunit GlcD [Variovor...    322   2e-103
ref|WP_006084296.1|  glycolate oxidase, subunit GlcD [Brucella...    322   3e-103
ref|WP_006092450.1|  glycolate oxidase, subunit GlcD [Brucella...    322   3e-103
ref|WP_029005952.1|  glycolate oxidase subunit GlcD [Azorhizob...    322   3e-103
ref|WP_004692534.1|  MULTISPECIES: FAD-binding protein [Brucella]    322   3e-103
ref|WP_006119413.1|  glycolate oxidase, subunit GlcD [Brucella...    322   3e-103
ref|WP_012346201.1|  FAD-binding protein [Leptothrix cholodnii]      322   4e-103
ref|WP_012840043.1|  FAD-binding protein [Comamonas testosteroni]    322   4e-103
gb|KGH00899.1|  FAD-binding protein [Comamonas testosteroni]         322   5e-103
ref|WP_020705677.1|  FAD-binding protein [Oxalobacteraceae bac...    321   6e-103
gb|KFJ10303.1|  FAD binding domain protein [Delftia acidovorans]     318   6e-103
dbj|BAO82354.1|  FAD/FMN-containing dehydrogenase [Comamonadac...    321   7e-103
ref|WP_013168662.1|  FAD-binding protein [Starkeya novella]          321   7e-103
ref|WP_018266319.1|  FAD-binding protein [Methylosinus sp. LW4]      320   8e-103
ref|WP_006277553.1|  glycolate oxidase, subunit GlcD [Brucella...    320   8e-103
ref|WP_029461363.1|  glycolate oxidase subunit GlcD [Comamonad...    320   8e-103
gb|EFG35851.1|  glycolate oxidase [Brucella sp. NVSL 07-0026]        321   8e-103
ref|WP_032450195.1|  glycolate oxidase subunit GlcD [Brucella ...    320   9e-103
ref|WP_018388650.1|  MULTISPECIES: FAD-binding protein [Xantho...    320   1e-102
gb|EGI02317.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    311   2e-102
ref|WP_028795081.1|  glycolate oxidase subunit GlcD [Thalassob...    320   2e-102
ref|WP_018907531.1|  MULTISPECIES: FAD-binding protein [Variov...    320   2e-102
ref|WP_010109550.1|  FAD-binding protein [Verminephrobacter ap...    319   2e-102
ref|WP_025770104.1|  glycolate oxidase subunit GlcD [Thioalkal...    320   3e-102
ref|WP_026293067.1|  glycolate oxidase subunit GlcD [Rudaea ce...    319   3e-102
ref|WP_018039203.1|  FAD-binding protein [alpha proteobacteriu...    319   3e-102
ref|WP_005800778.1|  FAD-binding protein [Acidovorax delafieldii]    316   4e-102
ref|WP_012745386.1|  FAD-binding protein [Variovorax paradoxus]      319   4e-102
ref|WP_013104853.1|  Glycolate oxidase subunit glcD [Thiomonas...    318   5e-102
ref|WP_013122357.1|  FAD-binding protein [Thiomonas intermedia]      318   5e-102
ref|WP_016446647.1|  glycolate oxidase, subunit GlcD [Delftia ...    318   6e-102
ref|WP_013804417.1|  FAD-binding protein [Delftia sp. Cs1-4]         318   6e-102
ref|WP_017405259.1|  FAD-binding protein [Chryseobacterium tae...    318   7e-102
emb|CDW95007.1|  glycolate oxidase subunit, FAD-linked [Thiomo...    318   7e-102
ref|WP_016451964.1|  glycolate oxidase, subunit GlcD [Delftia ...    318   7e-102
gb|KGM42191.1|  glycolate oxidase subunit GlcD [Aquabacterium ...    318   8e-102
ref|WP_009553143.1|  FAD-binding protein [Burkholderiales bact...    318   9e-102
ref|WP_012203014.1|  FAD-binding protein [Delftia acidovorans]       318   9e-102
gb|EZP57756.1|  FAD linked oxidase domain protein [Delftia sp....    318   1e-101
ref|WP_013695090.1|  FAD-binding protein [Candidatus Pelagibac...    318   1e-101
ref|WP_026096997.1|  glycolate oxidase subunit GlcD [Ideonella...    317   2e-101
ref|WP_013538694.1|  FAD-binding protein [Variovorax paradoxus]      317   2e-101
ref|WP_015046880.1|  FAD-binding protein [Simiduia agarivorans]      316   3e-101
ref|WP_024880678.1|  glycolate oxidase subunit GlcD [Methylosi...    317   3e-101
ref|WP_017972168.1|  FAD-binding protein [alpha proteobacteriu...    317   3e-101
ref|WP_028036029.1|  glycolate oxidase subunit GlcD [Candidatu...    316   4e-101
ref|WP_008386971.1|  FAD-binding protein [Rhodovulum sp. PH10]       316   5e-101
ref|WP_026599098.1|  glycolate oxidase subunit GlcD [Methylocy...    316   6e-101
ref|WP_003613094.1|  FAD-binding protein [Methylosinus trichos...    316   6e-101
ref|WP_015421918.1|  D-lactate dehydrogenase (Cytochrome) [bet...    316   6e-101
ref|WP_008907113.1|  FAD-binding protein [Acidovorax sp. NO-1]       316   6e-101
dbj|BAN68859.1|  glycolate oxidase [endosymbiont of unidentifi...    315   8e-101
ref|WP_011799723.1|  FAD-binding protein [Polaromonas naphthal...    315   1e-100
ref|WP_024538740.1|  glycolate oxidase subunit GlcD [Comamonas...    315   1e-100
ref|WP_015012270.1|  FAD-binding protein [Acidovorax sp. KKS102]     315   1e-100
ref|WP_014954012.1|  FAD-binding protein [alpha proteobacteriu...    315   2e-100
ref|WP_011808422.1|  FAD-binding protein [Verminephrobacter ei...    315   3e-100
ref|WP_007869125.1|  FAD-binding protein [Polaromonas sp. CF318]     314   3e-100
ref|WP_020228906.1|  FAD-binding protein [Acidovorax sp. MR-S7]      314   3e-100
ref|WP_028300082.1|  glycolate oxidase subunit GlcD [Oceanospi...    314   3e-100
ref|WP_029651377.1|  glycolate oxidase subunit GlcD [Methylocy...    314   3e-100
ref|WP_023854606.1|  FAD/FMN-dependent dehydrogenase [Candidat...    313   4e-100
ref|WP_018409013.1|  FAD-binding protein [Methylocystis rosea]       313   4e-100
ref|WP_022680352.1|  FAD-binding protein [Sandarakinorhabdus l...    313   5e-100
ref|WP_021027603.1|  FAD-binding protein [Comamonas sp. B-9]         313   5e-100
ref|WP_022568422.1|  FAD-binding protein [Ochrobactrum interme...    313   6e-100
ref|WP_011481404.1|  FAD-binding protein [Polaromonas sp. JS666]     313   8e-100
gb|EXU80010.1|  FAD-binding protein [Comamonas aquatica DA1877]      312   1e-99 
dbj|BAO30712.1|  FAD/FMN-dependent dehydrogenase [Sulfuritalea...    312   2e-99 
ref|WP_026436282.1|  glycolate oxidase subunit GlcD [Acidovora...    312   2e-99 
ref|WP_019426185.1|  FAD-binding protein [Limnohabitans sp. Ri...    311   3e-99 
ref|WP_019657968.1|  FAD-binding protein [Variovorax paradoxus]      311   3e-99 
ref|WP_010463024.1|  FAD-binding protein [Acidovorax radicis]        311   3e-99 
ref|WP_014890323.1|  FAD-binding protein [Methylocystis sp. SC2]     311   3e-99 
ref|WP_011793820.1|  FAD-binding protein [Acidovorax citrulli]       311   3e-99 
ref|WP_011281593.1|  FAD-binding protein [Candidatus Pelagibac...    311   5e-99 
ref|WP_010132703.1|  FAD-binding protein [Microbulbifer agaril...    310   5e-99 
ref|WP_027016212.1|  glycolate oxidase subunit GlcD [Comamonas...    310   1e-98 
ref|WP_016918876.1|  FAD-binding protein [Methylocystis parvus]      310   2e-98 
ref|WP_009859008.1|  FAD-binding protein [Rubrivivax benzoatil...    310   2e-98 
ref|WP_019429226.1|  FAD-binding protein [Limnohabitans sp. Ri...    309   2e-98 
ref|WP_013903010.1|  FAD-binding protein [Ramlibacter tataouin...    308   2e-98 
ref|WP_007833382.1|  FAD-binding protein [Variovorax sp. CF313]      309   3e-98 
ref|WP_006997634.1|  FAD-binding protein [Candidatus Pelagibac...    309   3e-98 
ref|WP_017667729.1|  hypothetical protein [Sandarakinorhabdus ...    309   3e-98 
ref|WP_029412351.1|  glycolate oxidase subunit GlcD [Acidovora...    308   3e-98 
ref|WP_014426437.1|  FAD-binding protein [Rubrivivax gelatinosus]    309   4e-98 
ref|WP_026431295.1|  glycolate oxidase subunit GlcD [Acidovora...    308   4e-98 
ref|WP_013593096.1|  FAD-binding protein [Acidovorax avenae]         308   6e-98 
ref|WP_028250865.1|  glycolate oxidase subunit GlcD [Variovora...    308   6e-98 
ref|WP_026781282.1|  glycolate oxidase subunit GlcD [Polaromon...    308   1e-97 
ref|WP_019957376.1|  hypothetical protein [Vitreoscilla sterco...    307   1e-97 
ref|WP_027307361.1|  hypothetical protein [Candidatus Pelagiba...    300   1e-97 
ref|WP_026381261.1|  glycolate oxidase subunit GlcD [Afifella ...    307   1e-97 
ref|WP_011803886.1|  FAD-binding protein [Acidovorax sp. JS42]       307   2e-97 
ref|WP_013434187.1|  FAD-binding protein [Burkholderia rhizoxi...    307   2e-97 
ref|WP_019814612.1|  glycolate oxidase subunit D [Osedax symbi...    306   2e-97 
gb|EYC52719.1|  glycolate oxidase subunit GlcD [Hylemonella gr...    306   2e-97 
ref|WP_027307209.1|  glycolate oxidase subunit GlcD [Candidatu...    306   3e-97 
ref|WP_006298903.1|  FAD-binding protein [Hylemonella gracilis]      306   3e-97 
ref|WP_012655461.1|  FAD-binding protein [Acidovorax ebreus]         306   3e-97 
ref|WP_011462930.1|  FAD-binding protein [Albidiferax ferrired...    305   6e-97 
ref|WP_028311102.1|  glycolate oxidase subunit GlcD [Derxia gu...    304   9e-97 
gb|EJZ34443.1|  glycolate oxidase subunit [Bradyrhizobium sp. ...    295   5e-96 
dbj|BAN69353.1|  glycolate oxidase [endosymbiont of unidentifi...    298   5e-95 
ref|WP_013517397.1|  FAD-binding protein [Alicycliphilus denit...    300   7e-95 
ref|WP_013721284.1|  FAD-binding protein [Alicycliphilus denit...    300   8e-95 
ref|WP_022730929.1|  FAD-binding protein [Thalassospira lucent...    298   4e-94 
ref|WP_033067886.1|  glycolate oxidase subunit GlcD [Thalassos...    298   5e-94 
ref|WP_009519831.1|  FAD-binding protein [Hydrogenophaga sp. PBC]    298   8e-94 
ref|XP_005967818.1|  PREDICTED: uncharacterized protein LOC102...    316   9e-94 
ref|WP_024972770.1|  glycolate oxidase subunit GlcD [Ralstonia...    297   1e-93 
emb|CDN89996.1|  Glycolate oxidase subunit glcD [Hydrogenophag...    297   2e-93 
ref|WP_025861064.1|  glycolate oxidase subunit GlcD [Acetobact...    296   2e-93 
ref|WP_027814152.1|  glycolate oxidase subunit GlcD [Burkholde...    295   2e-93 
ref|WP_008888341.1|  FAD-binding protein [Thalassospira profun...    295   6e-93 
gb|AAZ67911.1|  glycolate oxidase subunit D [Oceanimonas doudo...    288   1e-92 
ref|WP_012553680.1|  FAD-binding protein [Gluconacetobacter di...    294   1e-92 
ref|WP_012223405.1|  FAD-binding protein [Gluconacetobacter di...    294   2e-92 
gb|ESD62616.1|  glycolate oxidase, subunit GlcD [Escherichia c...    290   7e-92 
ref|WP_005001194.1|  FAD-binding protein [Shigella boydii]           288   4e-91 
ref|WP_000026114.1|  FAD-binding protein [Shigella dysenteriae]      287   2e-90 
gb|ABI29510.1|  GlcD [uncultured marine bacterium]                   282   2e-90 
ref|YP_002260628.2|  glycolate oxidase (fad-linked subunit) pr...    286   2e-89 
ref|WP_025748942.1|  hypothetical protein [Shigella flexneri]        276   2e-89 
ref|WP_027285321.1|  glycolate oxidase subunit GlcD [Rubritepi...    285   2e-89 
ref|WP_020315672.1|  glycolate oxidase subunit GlcD [Pseudomon...    274   1e-88 
gb|EGH00281.1|  Glycolate dehydrogenase2C subunit GlcD [gamma ...    271   1e-87 
ref|WP_032632299.1|  glycolate oxidase subunit GlcD [Pseudomon...    271   1e-87 
gb|EGH76196.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    279   2e-87 
ref|WP_003774954.1|  FAD-binding protein [Neisseria elongata]        280   4e-87 
gb|AAZ67912.1|  glycolate oxidase subunit D [Pseudomonas stutz...    274   4e-87 
gb|ABI29352.1|  GlcD [uncultured marine bacterium]                   273   5e-87 
gb|EPN01245.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    269   7e-87 
ref|WP_026015055.1|  glycolate oxidase subunit GlcD [Chelatoco...    278   1e-86 
ref|WP_012874117.1|  FAD-binding protein [Thermobaculum terrenum]    278   3e-86 
gb|ABI29737.1|  GlcD [uncultured marine bacterium]                   271   3e-86 
ref|WP_024921943.1|  MULTISPECIES: glycolate oxidase subunit G...    273   8e-86 
gb|ABI29776.1|  GlcD [uncultured marine bacterium]                   270   9e-86 
gb|ADC44822.1|  glycolate oxidase D-subunit [uncultured bacter...    270   9e-86 
gb|ABI29530.1|  GlcD [uncultured marine bacterium]                   270   1e-85 
gb|ABI29565.1|  GlcD [uncultured marine bacterium]                   270   2e-85 
ref|WP_019014604.1|  FAD-binding protein [Elioraea tepidiphila]      275   2e-85 
gb|ABI29601.1|  GlcD [uncultured marine bacterium]                   270   2e-85 
gb|ABI29343.1|  GlcD [uncultured marine bacterium]                   269   2e-85 
gb|ABI29284.1|  GlcD [uncultured marine bacterium]                   269   2e-85 
gb|AAY81774.1|  putative GlcD [uncultured marine bacterium]          269   2e-85 
gb|ABI29543.1|  GlcD [uncultured marine bacterium]                   269   2e-85 
gb|ABI29324.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29790.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29569.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29593.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29474.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29315.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29487.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29283.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29630.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29536.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29514.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29509.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29645.1|  GlcD [uncultured marine bacterium]                   269   3e-85 
gb|ABI29385.1|  GlcD [uncultured marine bacterium]                   269   4e-85 
gb|ABI29349.1|  GlcD [uncultured marine bacterium]                   269   4e-85 
gb|ABI29594.1|  GlcD [uncultured marine bacterium]                   269   4e-85 
gb|ABI29455.1|  GlcD [uncultured marine bacterium]                   268   4e-85 
gb|ABI29736.1|  GlcD [uncultured marine bacterium]                   268   4e-85 
gb|ABI29329.1|  GlcD [uncultured marine bacterium]                   268   4e-85 
gb|ABI29637.1|  GlcD [uncultured marine bacterium]                   268   4e-85 
gb|ADC44803.1|  glycolate oxidase D-subunit [uncultured bacter...    268   5e-85 
gb|ABI29647.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ABI29370.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ADC44823.1|  glycolate oxidase D-subunit [uncultured bacter...    268   5e-85 
gb|ABI29391.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ABI29550.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ABI29479.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ABI29375.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|AAY81775.1|  putative GlcD [uncultured marine bacterium]          268   5e-85 
gb|ABI29388.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ABI29643.1|  GlcD [uncultured marine bacterium]                   268   5e-85 
gb|ABI29521.1|  GlcD [uncultured marine bacterium]                   268   6e-85 
gb|ABI29470.1|  GlcD [uncultured marine bacterium]                   268   6e-85 
gb|ABI29458.1|  GlcD [uncultured marine bacterium]                   268   6e-85 
gb|ABI29316.1|  GlcD [uncultured marine bacterium]                   268   6e-85 
gb|ABI29335.1|  GlcD [uncultured marine bacterium]                   268   6e-85 
gb|ABI29634.1|  GlcD [uncultured marine bacterium]                   268   6e-85 
gb|AAY81802.1|  putative GlcD [uncultured marine bacterium]          268   6e-85 
gb|ABI29650.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|ABI29547.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|ABI29592.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|ABI29325.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|ABI29447.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|AAY81792.1|  putative GlcD [uncultured marine bacterium]          268   7e-85 
gb|ABI29408.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|ABI29649.1|  GlcD [uncultured marine bacterium]                   268   7e-85 
gb|ABI29571.1|  GlcD [uncultured marine bacterium]                   268   8e-85 
gb|ABI29631.1|  GlcD [uncultured marine bacterium]                   268   8e-85 
gb|ABI29794.1|  GlcD [uncultured marine bacterium]                   268   9e-85 
gb|ABI29519.1|  GlcD [uncultured marine bacterium]                   268   9e-85 
gb|ABI29611.1|  GlcD [uncultured marine bacterium]                   268   9e-85 
ref|WP_007003647.1|  FAD-binding protein [Roseomonas cervicalis]     274   1e-84 
gb|ABI29281.1|  GlcD [uncultured marine bacterium]                   268   1e-84 
gb|ABI29344.1|  GlcD [uncultured marine bacterium]                   268   1e-84 
ref|WP_009737312.1|  FAD-binding protein [Bradyrhizobiaceae ba...    273   1e-84 
gb|ABI29762.1|  GlcD [uncultured marine bacterium]                   268   1e-84 
gb|AAY81780.1|  putative GlcD [uncultured marine bacterium]          268   1e-84 
gb|ABI29605.1|  GlcD [uncultured marine bacterium]                   268   1e-84 
gb|ABI29438.1|  GlcD [uncultured marine bacterium]                   268   1e-84 
ref|WP_029312129.1|  glycolate oxidase subunit GlcD [Acidiphil...    273   1e-84 
gb|ABI29264.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|AAY81788.1|  putative GlcD [uncultured marine bacterium]          267   1e-84 
gb|ABI29590.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29336.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|AAY81779.1|  putative GlcD [uncultured marine bacterium]          267   1e-84 
gb|AAY81786.1|  putative GlcD [uncultured marine bacterium]          267   1e-84 
ref|WP_002713029.1|  glycolate oxidase, subunit GlcD [Afipia c...    273   1e-84 
gb|ABI29255.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29618.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29668.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29698.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29523.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29421.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29527.1|  GlcD [uncultured marine bacterium]                   267   1e-84 
gb|ABI29753.1|  GlcD [uncultured marine bacterium]                   267   2e-84 
gb|ABI29598.1|  GlcD [uncultured marine bacterium]                   267   2e-84 
gb|ABI29407.1|  GlcD [uncultured marine bacterium]                   267   2e-84 
gb|ABI29453.1|  GlcD [uncultured marine bacterium]                   267   2e-84 
ref|WP_027280056.1|  glycolate oxidase subunit GlcD [Roseomona...    273   2e-84 
ref|WP_028736745.1|  glycolate oxidase subunit GlcD [Rhizobium...    272   2e-84 
gb|ABI29554.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29277.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29394.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29676.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29252.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29419.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29392.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29538.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|AAY81776.1|  putative GlcD [uncultured marine bacterium]          266   3e-84 
gb|ABI29710.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29270.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29468.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29633.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29544.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|AAY81793.1|  putative GlcD [uncultured marine bacterium]          266   3e-84 
gb|ABI29488.1|  GlcD [uncultured marine bacterium]                   266   3e-84 
gb|ABI29441.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29429.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29534.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29644.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29431.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|AAY81791.1|  putative GlcD [uncultured marine bacterium]          266   4e-84 
gb|ABI29779.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29387.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29300.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29641.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29475.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29436.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|AAY81801.1|  putative GlcD [uncultured marine bacterium]          266   4e-84 
gb|ABI29515.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29689.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29599.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29368.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29271.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29409.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29460.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29619.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29541.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
ref|WP_012795747.1|  FAD-binding protein [Saccharomonospora vi...    272   4e-84 
gb|ABI29484.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29627.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29454.1|  GlcD [uncultured marine bacterium]                   266   4e-84 
gb|ABI29662.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29675.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29310.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29721.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29658.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29425.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29382.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29381.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29273.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29286.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29568.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29580.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29265.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
gb|ABI29578.1|  GlcD [uncultured marine bacterium]                   266   5e-84 
ref|WP_026613040.1|  glycolate oxidase subunit GlcD [Ensifer s...    271   6e-84 
gb|ABI29437.1|  GlcD [uncultured marine bacterium]                   266   6e-84 
gb|ABI29602.1|  GlcD [uncultured marine bacterium]                   266   6e-84 
gb|ABI29318.1|  GlcD [uncultured marine bacterium]                   266   6e-84 
gb|ABI29720.1|  GlcD [uncultured marine bacterium]                   266   6e-84 
gb|ABI29687.1|  GlcD [uncultured marine bacterium]                   265   6e-84 
gb|ABI29493.1|  GlcD [uncultured marine bacterium]                   265   7e-84 
gb|ADC44824.1|  glycolate oxidase D-subunit [uncultured bacter...    265   7e-84 
gb|ABI29682.1|  GlcD [uncultured marine bacterium]                   265   7e-84 
gb|ABI29491.1|  GlcD [uncultured marine bacterium]                   265   7e-84 
gb|ABI29327.1|  GlcD [uncultured marine bacterium]                   265   7e-84 
gb|ABI29432.1|  GlcD [uncultured marine bacterium]                   265   7e-84 
gb|ABI29529.1|  GlcD [uncultured marine bacterium]                   265   7e-84 
ref|WP_009763828.1|  FAD-binding protein [Microvirga lotononidis]    271   7e-84 
gb|ABI29376.1|  GlcD [uncultured marine bacterium]                   265   8e-84 
gb|ABI29433.1|  GlcD [uncultured marine bacterium]                   265   8e-84 
gb|AAY81807.1|  putative GlcD [uncultured marine bacterium]          265   8e-84 
ref|WP_004285702.1|  FAD-binding protein [Neisseria weaveri]         271   9e-84 
gb|ABI29716.1|  GlcD [uncultured marine bacterium]                   265   9e-84 
ref|WP_012706973.1|  FAD-binding protein [Sinorhizobium fredii]      271   1e-83 
gb|ABI29600.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29262.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29691.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29652.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29648.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29317.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29476.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29548.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29481.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29469.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29290.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29350.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29508.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29440.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
ref|WP_019461069.1|  MULTISPECIES: FAD-binding protein [Roseom...    271   1e-83 
gb|ABI29567.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
ref|WP_018302197.1|  FAD-binding protein [Wenxinia marina]           270   1e-83 
gb|ABI29461.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
ref|WP_020326079.1|  glycolate oxidase subunit GlcD [Pseudomon...    260   1e-83 
gb|ABI29248.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29396.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
gb|ABI29624.1|  GlcD [uncultured marine bacterium]                   265   1e-83 
ref|WP_012654093.1|  FAD-binding protein [Agrobacterium vitis]       270   2e-83 
gb|ABI29655.1|  GlcD [uncultured marine bacterium]                   265   2e-83 
gb|ABI29326.1|  GlcD [uncultured marine bacterium]                   265   2e-83 
gb|ABI29467.1|  GlcD [uncultured marine bacterium]                   265   2e-83 
gb|ABI29595.1|  GlcD [uncultured marine bacterium]                   265   2e-83 
gb|ABI29444.1|  GlcD [uncultured marine bacterium]                   264   2e-83 
gb|AAY81797.1|  putative GlcD [uncultured marine bacterium]          264   2e-83 
ref|WP_018111500.1|  FAD-binding protein [Thermus igniterrae]        270   2e-83 
gb|ABI29742.1|  GlcD [uncultured marine bacterium]                   264   2e-83 
ref|WP_007699918.1|  MULTISPECIES: FAD-binding protein [Rhizob...    270   2e-83 
gb|ABI29511.1|  GlcD [uncultured marine bacterium]                   264   2e-83 
gb|ABI29551.1|  GlcD [uncultured marine bacterium]                   264   2e-83 
ref|WP_026618406.1|  glycolate oxidase subunit GlcD [Sinorhizo...    270   2e-83 
gb|ABI29477.1|  GlcD [uncultured marine bacterium]                   264   2e-83 
gb|ABI29545.1|  GlcD [uncultured marine bacterium]                   264   2e-83 
ref|WP_014327474.1|  FAD-binding protein [Sinorhizobium fredii]      270   2e-83 
gb|ABI29328.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
gb|ABI29678.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
ref|WP_004282847.1|  FAD-binding protein [Neisseria weaveri]         270   3e-83 
gb|ABI29717.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
gb|ABI29294.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
gb|ABI29685.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
gb|ABI29401.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
ref|WP_018182695.1|  FAD-binding protein [Kaistia granuli]           270   3e-83 
gb|ABI29296.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
gb|ABI29659.1|  GlcD [uncultured marine bacterium]                   264   3e-83 
gb|ADC44832.1|  glycolate oxidase D-subunit [uncultured bacter...    264   3e-83 
gb|ADC44825.1|  glycolate oxidase D-subunit [uncultured bacter...    264   4e-83 
gb|ABI29302.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
ref|WP_029075840.1|  glycolate oxidase subunit GlcD [Kaistia a...    269   4e-83 
gb|ABI29345.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
gb|ABI29731.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
ref|WP_012040137.1|  FAD-binding protein [Acidiphilium cryptum]      270   4e-83 
gb|ABI29389.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
gb|ABI29553.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
gb|ABI29574.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
gb|ABI29322.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
ref|WP_013640881.1|  FAD-binding protein [Acidiphilium multivo...    269   4e-83 
gb|ABI29623.1|  GlcD [uncultured marine bacterium]                   263   4e-83 
ref|WP_012482805.1|  FAD-binding protein [Rhizobium etli]            269   4e-83 
ref|WP_023665691.1|  FAD-binding protein [Rhodobacter sp. CACI...    269   4e-83 
gb|ADC44622.1|  glycolate oxidase D-subunit [uncultured bacter...    263   5e-83 
ref|WP_011424158.1|  FAD-binding protein [Rhizobium etli]            269   5e-83 
gb|ABI29496.1|  GlcD [uncultured marine bacterium]                   263   5e-83 
gb|KEC72700.1|  glycolate oxidase subunit D [Rhizobium legumin...    269   5e-83 
gb|ADC44618.1|  glycolate oxidase D-subunit [uncultured bacter...    263   5e-83 
gb|ABI29680.1|  GlcD [uncultured marine bacterium]                   263   5e-83 
gb|ABI29528.1|  GlcD [uncultured marine bacterium]                   263   5e-83 
gb|ABI29549.1|  GlcD [uncultured marine bacterium]                   263   5e-83 
gb|ABI29473.1|  GlcD [uncultured marine bacterium]                   263   5e-83 
gb|ADC44619.1|  glycolate oxidase D-subunit [uncultured bacter...    263   5e-83 
gb|ADC44617.1|  glycolate oxidase D-subunit [uncultured bacter...    263   5e-83 
gb|AAY81787.1|  putative GlcD [uncultured marine bacterium]          263   6e-83 
gb|AIC25997.1|  glycolate oxidase subunit GlcD [Rhizobium etli...    269   6e-83 
ref|WP_012332844.1|  MULTISPECIES: FAD-binding protein [Methyl...    269   6e-83 
gb|ABI29378.1|  GlcD [uncultured marine bacterium]                   263   6e-83 
gb|ABI29340.1|  GlcD [uncultured marine bacterium]                   263   6e-83 
ref|WP_015338910.1|  glycolate oxidase subunit D protein [Rhiz...    269   7e-83 
gb|ABI29361.1|  GlcD [uncultured marine bacterium]                   263   7e-83 
gb|ABI29482.1|  GlcD [uncultured marine bacterium]                   263   7e-83 
ref|WP_028750512.1|  glycolate oxidase subunit GlcD [Rhizobium...    268   7e-83 
ref|WP_018329992.1|  FAD-binding protein [Rhizobium giardinii]       268   7e-83 
ref|WP_016734690.1|  FAD-binding protein [Rhizobium phaseoli]        268   7e-83 
ref|WP_007421633.1|  FAD-binding protein [Acidiphilium sp. PM]       269   8e-83 
gb|ADC44831.1|  glycolate oxidase D-subunit [uncultured bacter...    263   9e-83 
gb|ABI29338.1|  GlcD [uncultured marine bacterium]                   263   9e-83 
gb|ABI29253.1|  GlcD [uncultured marine bacterium]                   263   9e-83 
gb|ABI29709.1|  GlcD [uncultured marine bacterium]                   263   9e-83 
gb|ABI29478.1|  GlcD [uncultured marine bacterium]                   263   1e-82 
gb|EGE58196.1|  glycolate oxidase protein, subunit D [Rhizobiu...    269   1e-82 
gb|ABI29661.1|  GlcD [uncultured marine bacterium]                   263   1e-82 
gb|ABI29274.1|  GlcD [uncultured marine bacterium]                   263   1e-82 
gb|ADC44829.1|  glycolate oxidase D-subunit [uncultured bacter...    263   1e-82 
ref|WP_029372186.1|  glycolate oxidase subunit GlcD [Paracoccu...    268   1e-82 
gb|ADC44836.1|  glycolate oxidase D-subunit [uncultured bacter...    262   1e-82 
gb|ABI29443.1|  GlcD [uncultured marine bacterium]                   262   1e-82 
gb|ADC44827.1|  glycolate oxidase D-subunit [uncultured bacter...    262   1e-82 
gb|KGF68585.1|  glycolate oxidase subunit GlcD [Hoeflea sp. BA...    269   1e-82 
gb|ADC44834.1|  glycolate oxidase D-subunit [uncultured bacter...    262   1e-82 
gb|ADC44830.1|  glycolate oxidase D-subunit [uncultured bacter...    262   1e-82 
gb|ADC44835.1|  glycolate oxidase D-subunit [uncultured bacter...    262   1e-82 
gb|ABI29485.1|  GlcD [uncultured marine bacterium]                   262   1e-82 
ref|WP_010438780.1|  FAD-binding protein [Ruegeria sp. TW15]         268   2e-82 
ref|WP_027315364.1|  glycolate oxidase subunit GlcD [Microvirg...    268   2e-82 
gb|ADC44833.1|  glycolate oxidase D-subunit [uncultured bacter...    262   2e-82 
ref|WP_029617238.1|  glycolate oxidase subunit GlcD [Rhizobium...    268   2e-82 
gb|ABI29305.1|  GlcD [uncultured marine bacterium]                   262   2e-82 
ref|WP_024810943.1|  glycolate oxidase subunit GlcD [Oceanicol...    268   2e-82 
gb|ABI29494.1|  GlcD [uncultured marine bacterium]                   262   2e-82 
ref|WP_027509992.1|  glycolate oxidase subunit GlcD [Rhizobium...    267   2e-82 
ref|WP_007196219.1|  FAD-binding protein [Hoeflea phototrophica]     268   2e-82 
ref|WP_007436692.1|  FAD-binding protein [Acetobacteraceae bac...    268   2e-82 
gb|ADC44826.1|  glycolate oxidase D-subunit [uncultured bacter...    261   2e-82 
gb|ABI29587.1|  GlcD [uncultured marine bacterium]                   261   2e-82 
ref|WP_025426042.1|  glycolate oxidase subunit GlcD [Ensifer a...    267   2e-82 
gb|KGJ10962.1|  glycolate oxidase subunit GlcD [Paracoccus ver...    267   3e-82 
ref|WP_016330001.1|  FAD/FMN-dependent dehydrogenase [Thermus ...    266   3e-82 
gb|ABI29483.1|  GlcD [uncultured marine bacterium]                   261   3e-82 
gb|ABI29490.1|  GlcD [uncultured marine bacterium]                   261   3e-82 
ref|WP_027999602.1|  glycolate oxidase subunit GlcD [Sinorhizo...    267   3e-82 
ref|WP_006726570.1|  FAD-binding protein [Agrobacterium albert...    267   3e-82 
gb|ABI29560.1|  GlcD [uncultured marine bacterium]                   261   3e-82 
gb|ABI29374.1|  GlcD [uncultured marine bacterium]                   261   3e-82 
ref|WP_027887053.1|  glycolate oxidase subunit GlcD [Meiotherm...    267   3e-82 
ref|WP_018856901.1|  MULTISPECIES: FAD-binding protein [Rhizob...    266   4e-82 
ref|WP_022717289.1|  FAD-binding protein [Rhizobium mongolense]      266   4e-82 
ref|WP_024317776.1|  glycolate oxidase subunit GlcD [Rhizobium...    266   4e-82 
ref|WP_018496901.1|  FAD-binding protein [Rhizobium leguminosa...    266   5e-82 
ref|WP_018461294.1|  FAD-binding protein [Thermus oshimai]           266   5e-82 
ref|WP_007904968.1|  FAD-binding protein [Ktedonobacter racemi...    266   5e-82 
gb|KFG67175.1|  glycolate oxidase subunit GlcD [Microvirga sp....    266   6e-82 
ref|WP_007819199.1|  FAD-binding protein [Rhizobium sp. CF142]       266   6e-82 
gb|ABI29683.1|  GlcD [uncultured marine bacterium]                   260   7e-82 
ref|WP_019120910.1|  FAD-binding protein [Brevibacillus sp. phR]     266   7e-82 
gb|ABI29334.1|  GlcD [uncultured marine bacterium]                   260   7e-82 
ref|WP_023786540.1|  FAD-binding protein [Hyphomicrobium nitra...    266   8e-82 
ref|WP_018010853.1|  FAD-binding protein [Sinorhizobium medicae]     266   9e-82 
gb|ADC44628.1|  glycolate oxidase D-subunit [uncultured bacter...    260   1e-81 
ref|WP_007633076.1|  FAD-binding protein [Rhizobium sp. CCGE 510]    266   1e-81 
ref|WP_015931087.1|  FAD-binding protein [Methylobacterium nod...    265   1e-81 
gb|ADC44616.1|  glycolate oxidase D-subunit [uncultured bacter...    259   1e-81 
gb|ADC44643.1|  glycolate oxidase D-subunit [uncultured bacter...    259   1e-81 
gb|KEQ09308.1|  glycolate oxidase subunit GlcD [Rhizobium sp. ...    265   1e-81 
gb|ADC44642.1|  glycolate oxidase D-subunit [uncultured bacter...    259   1e-81 
gb|AHJ63031.1|  (S)-2-hydroxy-acid oxidase chain D [Granulibac...    266   1e-81 
ref|WP_011974599.1|  MULTISPECIES: FAD-binding protein [Sinorh...    265   1e-81 
gb|EXG81694.1|  FAD/FMN-dependent dehydrogenase [Cryptosporang...    265   1e-81 
ref|WP_008631781.1|  FAD-binding protein [Thermus sp. RL]            265   2e-81 
ref|WP_014761279.1|  FAD-binding protein [Sinorhizobium fredii]      265   2e-81 
gb|ADC44615.1|  glycolate oxidase D-subunit [uncultured bacter...    259   2e-81 
ref|WP_024842555.1|  glycolate oxidase subunit GlcD [Paracoccu...    265   2e-81 
ref|WP_028713006.1|  MULTISPECIES: glycolate oxidase subunit G...    265   2e-81 
gb|AHJ68969.1|  (S)-2-hydroxy-acid oxidase chain D [Granulibac...    265   2e-81 
ref|WP_013178055.1|  FAD-binding protein [Truepera radiovictrix]     265   2e-81 
ref|WP_017967158.1|  FAD-binding protein [Rhizobium leguminosa...    265   2e-81 
ref|WP_004109665.1|  putative glycolate oxidase subunit [Rhizo...    265   2e-81 
ref|WP_011631937.1|  FAD-binding protein [Granulibacter bethes...    265   2e-81 
ref|WP_011750625.1|  FAD-binding protein [Paracoccus denitrifi...    265   2e-81 
ref|WP_018483293.1|  FAD-binding protein [Rhizobium leguminosa...    265   2e-81 
ref|WP_018070179.1|  FAD-binding protein [Rhizobium leguminosa...    265   2e-81 
ref|WP_007799264.1|  FAD-binding protein [Rhizobium sp. CF122]       265   3e-81 
ref|WP_033181688.1|  glycolate oxidase subunit GlcD [Rhizobium...    265   3e-81 
gb|AHF82599.1|  FAD-binding protein [Rhizobium leguminosarum b...    265   3e-81 
gb|ADC44627.1|  glycolate oxidase D-subunit [uncultured bacter...    259   3e-81 
gb|KEC81459.1|  glycolate oxidase subunit D [Sinorhizobium ame...    264   3e-81 
gb|ADC44624.1|  glycolate oxidase D-subunit [uncultured bacter...    259   3e-81 
ref|WP_016552874.1|  glycolate oxidase subunit D [Rhizobium gr...    264   3e-81 
ref|WP_014465549.1|  FAD-binding protein [Alicyclobacillus aci...    265   3e-81 
gb|ADC44872.1|  glycolate oxidase D-subunit [uncultured bacter...    259   3e-81 
ref|WP_014509973.1|  FAD-binding protein [Thermus thermophilus]      264   3e-81 
ref|WP_027685857.1|  glycolate oxidase subunit GlcD [Rhizobium...    264   3e-81 
ref|WP_018898545.1|  FAD-binding protein [Rhizobium sp. 2MFCol...    264   4e-81 
gb|EXL02603.1|  glycolate oxidase subunit GlcD [Ochrobactrum a...    264   4e-81 
ref|WP_003588331.1|  FAD-binding protein [Rhizobium leguminosa...    264   5e-81 
ref|WP_014516115.1|  FAD-binding protein [Thermus sp. CCB_US3_...    263   5e-81 
ref|WP_003584482.1|  FAD-binding protein [Rhizobium leguminosa...    264   5e-81 
ref|WP_012556698.1|  FAD-binding protein [Rhizobium leguminosa...    264   5e-81 
gb|ADC44640.1|  glycolate oxidase D-subunit [uncultured bacter...    258   6e-81 
ref|WP_003545764.1|  FAD-binding protein [Rhizobium leguminosa...    264   6e-81 
gb|ADC44651.1|  glycolate oxidase D-subunit [uncultured bacter...    258   6e-81 
ref|WP_027666545.1|  glycolate oxidase subunit GlcD [Rhizobium...    263   7e-81 
ref|WP_008758216.1|  FAD-binding protein [Rhodobacteraceae bac...    263   7e-81 
ref|WP_028435948.1|  glycolate oxidase subunit GlcD [Streptomy...    263   7e-81 
ref|WP_029872574.1|  glycolate oxidase subunit GlcD [Rhizobium...    263   7e-81 
ref|WP_031213153.1|  glycolate oxidase subunit GlcD [Geobacill...    261   7e-81 
gb|ABI29358.1|  GlcD [uncultured marine bacterium]                   258   7e-81 
gb|ADC44661.1|  glycolate oxidase D-subunit [uncultured bacter...    258   8e-81 
ref|WP_012756186.1|  FAD-binding protein [Rhizobium leguminosa...    263   8e-81 
ref|WP_030902262.1|  glycolate oxidase subunit GlcD [Streptomy...    263   8e-81 
ref|WP_017959129.1|  FAD-binding protein [Rhizobium leguminosa...    263   9e-81 
gb|ADC44623.1|  glycolate oxidase D-subunit [uncultured bacter...    257   9e-81 
ref|WP_028010429.1|  glycolate oxidase subunit GlcD [Sinorhizo...    263   9e-81 
gb|ADC44629.1|  glycolate oxidase D-subunit [uncultured bacter...    257   1e-80 
gb|KDP71989.1|  glycolate oxidase subunit GlcD [Ensifer adhaer...    263   1e-80 
ref|WP_013015000.1|  FAD-binding protein [Meiothermus ruber]         263   1e-80 
ref|WP_008309096.1|  FAD/FMN-dependent dehydrogenase [Leptolyn...    263   1e-80 
ref|WP_018244950.1|  FAD-binding protein [Rhizobium leguminosa...    263   1e-80 
ref|WP_020048615.1|  FAD-binding protein [Rhizobium leguminosa...    263   1e-80 
ref|WP_018449400.1|  MULTISPECIES: FAD-binding protein [Rhizob...    263   1e-80 
gb|KDB04908.1|  FAD-binding protein [Defluviimonas sp. 20V17]        262   2e-80 
gb|ADC44654.1|  glycolate oxidase D-subunit [uncultured bacter...    257   2e-80 
ref|WP_028067926.1|  glycolate oxidase subunit GlcD [Solirubro...    263   2e-80 
ref|WP_011049161.1|  FAD-binding protein [Ruegeria pomeroyi]         263   2e-80 
gb|ABI29339.1|  GlcD [uncultured marine bacterium]                   257   2e-80 
gb|KGB81319.1|  glycolate oxidase subunit GlcD [Rhodovulum sp....    262   2e-80 
gb|KAJ54652.1|  glycolate oxidase subunit GlcD [Actibacterium ...    262   2e-80 
gb|ADC44639.1|  glycolate oxidase D-subunit [uncultured bacter...    256   2e-80 
ref|WP_028431676.1|  glycolate oxidase subunit GlcD [Streptomy...    263   2e-80 
gb|ABI29285.1|  GlcD [uncultured marine bacterium]                   256   2e-80 
gb|ADC44656.1|  glycolate oxidase D-subunit [uncultured bacter...    256   2e-80 
ref|WP_011565754.1|  FAD-binding protein [Rubrobacter xylanoph...    262   2e-80 
gb|ADC44653.1|  glycolate oxidase D-subunit [uncultured bacter...    256   2e-80 
ref|WP_007118645.1|  FAD-binding protein [Oceanibulbus indolifex]    262   2e-80 
gb|ADC44657.1|  glycolate oxidase D-subunit [uncultured bacter...    256   2e-80 
ref|WP_014445210.1|  FAD-binding protein [Actinoplanes missour...    262   2e-80 
ref|WP_009159770.1|  FAD-binding protein [Thalassiobium sp. R2...    262   2e-80 
ref|WP_010968808.1|  FAD-binding protein [Sinorhizobium meliloti]    262   2e-80 
gb|ADC44664.1|  glycolate oxidase D-subunit [uncultured bacter...    256   2e-80 
ref|WP_003527237.1|  FAD-binding protein [Sinorhizobium meliloti]    262   2e-80 
ref|WP_015007216.1|  FAD-binding protein [Sinorhizobium meliloti]    262   2e-80 
ref|WP_033017741.1|  glycolate oxidase subunit GlcD [Geobacill...    262   3e-80 
ref|WP_011650610.1|  FAD-binding protein [Rhizobium leguminosa...    262   3e-80 
gb|ADC44650.1|  glycolate oxidase D-subunit [uncultured bacter...    256   3e-80 
gb|ADC44641.1|  glycolate oxidase D-subunit [uncultured bacter...    256   3e-80 
ref|WP_017990393.1|  FAD-binding protein [Rhizobium leguminosa...    262   3e-80 
gb|KEI43153.1|  glycolate oxidase subunit GlcD [Saccharopolysp...    262   3e-80 
ref|WP_006447109.1|  FAD-binding protein [Alicyclobacillus hes...    263   3e-80 
gb|ADC44660.1|  glycolate oxidase D-subunit [uncultured bacter...    256   3e-80 
gb|AHG44204.1|  FAD-binding protein [Rhizobium leguminosarum b...    262   3e-80 
ref|WP_020951064.1|  glycolate oxidase [Paracoccus aminophilus]      262   3e-80 
ref|WP_017993045.1|  FAD-binding protein [Rhizobium leguminosa...    261   3e-80 
gb|ADC44659.1|  glycolate oxidase D-subunit [uncultured bacter...    256   3e-80 
gb|ADC44630.1|  glycolate oxidase D-subunit [uncultured bacter...    256   3e-80 
gb|ADC44631.1|  glycolate oxidase D-subunit [uncultured bacter...    256   4e-80 
gb|AAY81804.1|  putative GlcD [uncultured marine bacterium]          256   4e-80 
gb|AAY81828.1|  putative GlcD [uncultured marine bacterium]          256   4e-80 
ref|WP_009337719.1|  FAD-binding protein [Afipia sp. 1NLS2]          261   4e-80 
gb|AAY81813.1|  putative GlcD [uncultured marine bacterium]          256   4e-80 
gb|AAY81823.1|  putative GlcD [uncultured marine bacterium]          256   4e-80 
ref|WP_008334052.1|  FAD-binding protein [Maritimibacter alkal...    261   4e-80 
gb|ADC44648.1|  glycolate oxidase D-subunit [uncultured bacter...    256   4e-80 
gb|AAY81811.1|  putative GlcD [uncultured marine bacterium]          256   4e-80 
ref|WP_015170335.1|  glycolate oxidase subunit GlcD [Geitlerin...    262   4e-80 
ref|WP_011231028.1|  FAD-binding protein [Geobacillus kaustoph...    261   4e-80 
gb|AAY81772.1|  putative GlcD [uncultured marine bacterium]          256   5e-80 
gb|AAY81835.1|  putative GlcD [uncultured marine bacterium]          256   5e-80 
gb|KGK79205.1|  glycolate oxidase subunit GlcD [Thalassobacter...    261   5e-80 
ref|WP_005979408.1|  FAD-binding protein [Ruegeria lacuscaerul...    261   6e-80 
gb|ADC44632.1|  glycolate oxidase D-subunit [uncultured bacter...    255   6e-80 
emb|CCF18121.1|  Glycolate oxidase subunit glcD [Rhizobium sp.]      261   6e-80 
ref|WP_015498444.1|  FAD-binding protein [Octadecabacter antar...    261   6e-80 
ref|WP_015888027.1|  FAD-binding protein [Sinorhizobium fredii]      261   7e-80 
ref|WP_026187329.1|  glycolate oxidase subunit GlcD [Ensifer s...    261   7e-80 
ref|WP_008030469.1|  FAD-binding protein [Rhodobacter sp. SW2]       261   7e-80 
ref|WP_026148582.1|  glycolate oxidase subunit GlcD [Leptolyng...    261   7e-80 
ref|WP_014195677.1|  MULTISPECIES: FAD-binding protein [Geobac...    261   8e-80 
ref|WP_013145472.1|  MULTISPECIES: FAD-binding protein [Geobac...    261   8e-80 
gb|ADC44634.1|  glycolate oxidase D-subunit [uncultured bacter...    255   8e-80 
ref|WP_013523646.1|  MULTISPECIES: FAD-binding protein [Geobac...    261   8e-80 
gb|ADC44633.1|  glycolate oxidase D-subunit [uncultured bacter...    255   8e-80 
ref|WP_027877261.1|  glycolate oxidase subunit GlcD [Meiotherm...    261   8e-80 
ref|WP_022704009.1|  FAD-binding protein [Pseudorhodobacter fe...    260   9e-80 
ref|WP_033006033.1|  glycolate oxidase subunit GlcD [Geobacill...    261   9e-80 
ref|WP_028287012.1|  glycolate oxidase subunit GlcD [Oceanicol...    261   9e-80 
ref|WP_015223488.1|  glycolate oxidase subunit GlcD [Cyanobact...    261   9e-80 
gb|AAY81834.1|  putative GlcD [uncultured marine bacterium]          255   1e-79 
ref|WP_011431581.1|  FAD-binding protein [Synechococcus sp. JA...    261   1e-79 
ref|WP_008341116.1|  FAD-binding protein [Alicyclobacillus aci...    261   1e-79 
ref|WP_017324901.1|  FAD-binding protein [Synechococcus sp. PC...    261   1e-79 
ref|WP_014630032.1|  FAD-binding protein [Thermus thermophilus]      260   1e-79 
gb|AAY81819.1|  putative GlcD [uncultured marine bacterium]          254   1e-79 
ref|WP_027487267.1|  glycolate oxidase subunit GlcD [Rhizobium...    260   1e-79 
ref|WP_014762545.1|  FAD-binding protein [Sinorhizobium fredii]      260   1e-79 
ref|WP_011172584.1|  FAD-binding protein [Thermus thermophilus]      259   1e-79 
gb|ADC44614.1|  glycolate oxidase D-subunit [uncultured bacter...    254   1e-79 
gb|AAY81754.1|  putative GlcD [uncultured marine bacterium]          254   1e-79 
ref|WP_020084161.1|  hypothetical protein [Hyphomicrobium zava...    261   1e-79 
emb|CDN52764.1|  Glycolate oxidase, subunit GlcD [Rhizobium ga...    260   1e-79 
gb|ADC44655.1|  glycolate oxidase D-subunit [uncultured bacter...    254   1e-79 
gb|ADC44649.1|  glycolate oxidase D-subunit [uncultured bacter...    254   1e-79 
ref|WP_007605284.1|  FAD-binding protein [Rhizobium sp. PDO1-076]    260   1e-79 
gb|ADC44638.1|  glycolate oxidase D-subunit [uncultured bacter...    254   1e-79 
ref|WP_011434385.1|  FAD-binding protein [Synechococcus sp. JA...    261   2e-79 
ref|WP_012811777.1|  FAD-binding protein [Alicyclobacillus aci...    261   2e-79 
gb|EPR27734.1|  (S)-2-hydroxy-acid oxidase chain D [Geobacillu...    260   2e-79 
ref|WP_029098826.1|  glycolate oxidase subunit GlcD [Brevibaci...    260   2e-79 
gb|AAY81822.1|  putative GlcD [uncultured marine bacterium]          254   2e-79 
gb|KGJ03229.1|  glycolate oxidase subunit GlcD [Paracoccus hal...    260   2e-79 
ref|WP_031409850.1|  glycolate oxidase subunit GlcD [Geobacill...    260   2e-79 
gb|ADC44804.1|  glycolate oxidase D-subunit [uncultured bacter...    254   2e-79 
gb|AAY81838.1|  putative GlcD [uncultured marine bacterium]          254   2e-79 
ref|WP_028743749.1|  glycolate oxidase subunit GlcD [Rhizobium...    260   2e-79 
ref|WP_013157891.1|  FAD-binding protein [Meiothermus silvanus]      260   2e-79 
gb|AAY81836.1|  putative GlcD [uncultured marine bacterium]          254   2e-79 
ref|WP_018094326.1|  FAD-binding protein [Sinorhizobium meliloti]    259   2e-79 
gb|KGI79959.1|  glycolate oxidase subunit GlcD [Actinopolyspor...    260   2e-79 
ref|WP_029958711.1|  glycolate oxidase subunit GlcD [Ensifer s...    259   2e-79 
ref|WP_033009249.1|  glycolate oxidase subunit GlcD [Geobacill...    259   2e-79 
gb|ADC44807.1|  glycolate oxidase D-subunit [uncultured bacter...    254   2e-79 
ref|WP_006464792.1|  glycolate oxidase subunit GlcD [Herbaspir...    259   2e-79 
gb|ADC44809.1|  glycolate oxidase D-subunit [uncultured bacter...    254   2e-79 
ref|WP_010305048.1|  FAD-binding protein [Saccharopolyspora sp...    260   2e-79 
gb|AAY81817.1|  putative GlcD [uncultured marine bacterium]          254   2e-79 
gb|ADC44806.1|  glycolate oxidase D-subunit [uncultured bacter...    254   2e-79 
ref|WP_022707843.1|  FAD-binding protein [Paracoccus zeaxanthi...    259   2e-79 
ref|WP_029423075.1|  glycolate oxidase subunit GlcD [Alicyclob...    260   2e-79 
ref|WP_026388916.1|  glycolate oxidase subunit GlcD [Acidobact...    259   3e-79 
ref|WP_003570099.1|  FAD-binding protein [Rhizobium leguminosa...    259   3e-79 
gb|ADC44658.1|  glycolate oxidase D-subunit [uncultured bacter...    254   3e-79 
ref|WP_007756442.1|  FAD-binding protein [Rhizobium sp. CF080]       259   3e-79 
ref|WP_028928356.1|  glycolate oxidase subunit GlcD [Pseudonoc...    259   3e-79 
ref|WP_023848498.1|  FAD-binding protein [Rhodobacteraceae bac...    259   3e-79 
ref|WP_022845611.1|  FAD-binding protein [Acidobacteriaceae ba...    259   3e-79 
ref|WP_020919832.1|  glycolate oxidase subunit GlcD 2 [Rhizobi...    259   3e-79 
gb|EGE61580.1|  glycolate oxidase, subunit GlcD [Rhizobium etl...    259   3e-79 
ref|WP_028749947.1|  glycolate oxidase subunit GlcD [Rhizobium...    259   3e-79 
ref|WP_011907273.1|  FAD-binding protein [Rhodobacter sphaeroi...    259   3e-79 
gb|ADC44645.1|  glycolate oxidase D-subunit [uncultured bacter...    253   3e-79 
gb|AAY81805.1|  putative GlcD [uncultured marine bacterium]          253   4e-79 
ref|WP_005461074.1|  FAD-binding protein [Saccharomonospora gl...    259   4e-79 
ref|WP_029029436.1|  glycolate oxidase subunit GlcD [Salinarim...    259   4e-79 
ref|WP_011227986.1|  FAD-binding protein [Thermus thermophilus]      258   4e-79 
ref|WP_008886830.1|  D-lactate dehydrogenase [Citreicella sp. ...    253   5e-79 
gb|ADC44808.1|  glycolate oxidase D-subunit [uncultured bacter...    253   5e-79 
ref|WP_006517809.1|  glycolate oxidase, subunit GlcD [Leptolyn...    259   6e-79 
ref|WP_026187145.1|  glycolate oxidase subunit GlcD [Ensifer s...    258   6e-79 
gb|ADC44652.1|  glycolate oxidase D-subunit [uncultured bacter...    253   6e-79 
ref|WP_025059200.1|  glycolate oxidase subunit GlcD [Sulfitoba...    258   7e-79 
ref|WP_008879331.1|  FAD-binding protein [Geobacillus sp. G11M...    258   7e-79 
ref|WP_028494189.1|  glycolate oxidase subunit GlcD [Thermus a...    258   7e-79 
ref|WP_011887304.1|  FAD-binding protein [Geobacillus thermode...    258   7e-79 
emb|CDN46517.1|  Glycolate oxidase, subunit GlcD [Rhizobium ga...    258   7e-79 
ref|WP_003250038.1|  MULTISPECIES: FAD-binding protein [Geobac...    258   7e-79 
dbj|GAJ42828.1|  glycolate oxidase subunit GlcD [Geobacillus t...    258   7e-79 
ref|WP_009572220.1|  FAD-binding protein [Celeribacter baekdon...    258   7e-79 
ref|WP_015226234.1|  glycolate oxidase subunit GlcD [Halothece...    258   8e-79 
ref|WP_013876822.1|  FAD-binding protein [Geobacillus thermogl...    258   8e-79 
ref|WP_011243549.1|  FAD-binding protein [Synechococcus elonga...    258   8e-79 
ref|WP_025950057.1|  glycolate oxidase subunit GlcD [Geobacill...    258   8e-79 
gb|ABI29412.1|  GlcD [uncultured marine bacterium]                   252   9e-79 
ref|WP_029720315.1|  glycolate oxidase subunit GlcD [Saccharop...    258   9e-79 
ref|WP_011377517.1|  FAD-binding protein [Synechococcus elonga...    258   9e-79 
ref|WP_029760872.1|  glycolate oxidase subunit GlcD [Geobacill...    258   9e-79 
ref|WP_009177838.1|  FAD-binding protein [Silicibacter sp. Tri...    258   9e-79 
ref|WP_007307788.1|  FAD-binding protein [Crocosphaera watsonii]     258   9e-79 
gb|KGM49860.1|  glycolate oxidase subunit GlcD [Oceanicola sp....    258   1e-78 
ref|WP_015716457.1|  FAD-binding protein [Thermus scotoductus]       257   1e-78 
gb|EZP76924.1|  FAD linked oxidase [Geobacillus stearothermoph...    258   1e-78 
ref|WP_009767843.1|  glycolate oxidase, subunit GlcD [Oscillat...    258   1e-78 
ref|WP_028932509.1|  glycolate oxidase subunit GlcD [Pseudonoc...    258   1e-78 
gb|ABI29357.1|  GlcD [uncultured marine bacterium]                   252   1e-78 
gb|ABI29332.1|  GlcD [uncultured marine bacterium]                   252   1e-78 
ref|WP_026595602.1|  glycolate oxidase subunit GlcD [Methylofe...    257   1e-78 
gb|AAY81832.1|  putative GlcD [uncultured marine bacterium]          252   1e-78 
ref|WP_003594247.1|  FAD-binding protein [Rhizobium leguminosa...    258   1e-78 
ref|WP_005614248.1|  D-lactate dehydrogenase [Ruegeria mobilis]      257   2e-78 
ref|WP_008275908.1|  FAD-binding protein [Cyanothece sp. CCY0110]    258   2e-78 
ref|WP_007530351.1|  FAD-binding protein [Rhizobium mesoameric...    257   2e-78 
ref|WP_017437364.1|  FAD-binding protein [Geobacillus caldoxyl...    257   2e-78 
ref|WP_026479400.1|  glycolate oxidase subunit GlcD [Ahrensia ...    257   2e-78 
gb|KEC80455.1|  glycolate oxidase subunit D [Sinorhizobium ame...    257   2e-78 
ref|WP_033046930.1|  glycolate oxidase subunit GlcD [Ensifer s...    257   2e-78 
ref|WP_005452950.1|  FAD-binding protein [Saccharomonospora cy...    258   2e-78 
ref|WP_021693152.1|  glycolate dehydrogenase, subunit glcD [Lo...    257   2e-78 
gb|ADC44805.1|  glycolate oxidase D-subunit [uncultured bacter...    251   2e-78 
gb|ADC44801.1|  glycolate oxidase D-subunit [uncultured bacter...    251   2e-78 
gb|ADC44646.1|  glycolate oxidase D-subunit [uncultured bacter...    251   2e-78 
gb|AII85686.1|  glycolate oxidase subunit GlcD [Candidatus Pla...    258   2e-78 
ref|WP_017299236.1|  FAD-binding protein [Nodosilinea nodulosa]      257   2e-78 
ref|WP_007811440.1|  FAD-binding protein [Roseobacter sp. AzwK...    257   2e-78 
ref|WP_006018754.1|  MULTISPECIES: FAD-binding protein [Bradyr...    257   3e-78 
gb|ETX15826.1|  FAD-binding protein [Roseivivax halodurans JCM...    257   3e-78 
ref|WP_023515771.1|  glycolate oxidase subunit GlcD [Shinella ...    257   3e-78 
ref|WP_007426276.1|  FAD-binding protein [Oceaniovalibus guish...    256   3e-78 
ref|WP_019297350.1|  FAD-binding protein [Phaeobacter gallaeci...    256   3e-78 
ref|WP_015496504.1|  FAD-binding protein [Octadecabacter arcti...    256   3e-78 
ref|WP_027673871.1|  glycolate oxidase subunit GlcD [Agrobacte...    256   3e-78 
ref|WP_009946002.1|  FAD-binding protein [Saccharopolyspora er...    257   3e-78 
gb|KEO51154.1|  FAD-binding protein [Thioclava pacifica DSM 10...    256   4e-78 
ref|WP_019550256.1|  FAD-binding protein [Thermus scotoductus]       256   4e-78 
ref|WP_006102120.1|  FAD-binding protein [Coleofasciculus chth...    256   4e-78 
gb|KGD86175.1|  glycolate oxidase subunit GlcD [Rhizobium sp. ...    256   5e-78 
ref|WP_021829695.1|  Glycolate dehydrogenase, subunit GlcD [Cr...    256   5e-78 
ref|WP_009813828.1|  FAD-binding protein [Roseovarius nubinhib...    256   5e-78 
ref|WP_032088356.1|  glycolate oxidase subunit GlcD [Bacillus ...    256   5e-78 
ref|WP_029322453.1|  glycolate oxidase subunit GlcD [Bacillus ...    256   6e-78 
ref|WP_026352300.1|  glycolate oxidase subunit GlcD [Loktanell...    256   6e-78 
ref|WP_005442916.1|  FAD-binding protein [Saccharomonospora az...    256   6e-78 
ref|WP_003045154.1|  FAD-binding protein [Thermus aquaticus]         255   6e-78 
ref|WP_015864086.1|  FAD-binding protein [Geobacillus sp. WCH70]     256   7e-78 
ref|WP_026699655.1|  glycolate oxidase subunit GlcD [Bacillus ...    256   7e-78 
ref|WP_025046137.1|  glycolate oxidase subunit GlcD [Sulfitoba...    256   7e-78 
gb|ADC44802.1|  glycolate oxidase D-subunit [uncultured bacter...    250   7e-78 
ref|WP_015123179.1|  FAD/FMN-dependent dehydrogenase [Synechoc...    256   8e-78 
ref|WP_005450061.1|  FAD-binding protein [Saccharomonospora az...    256   8e-78 
ref|WP_009543137.1|  MULTISPECIES: FAD-binding protein [Cyanot...    256   8e-78 
ref|WP_017929206.1|  FAD-binding protein [Loktanella hongkonge...    255   9e-78 
ref|WP_011539821.1|  FAD-binding protein [Ruegeria sp. TM1040]       255   9e-78 
ref|WP_025047173.1|  glycolate oxidase subunit GlcD [Sulfitoba...    255   9e-78 
ref|WP_007312818.1|  FAD-binding protein [Crocosphaera watsonii]     255   1e-77 
ref|WP_028957801.1|  glycolate oxidase subunit GlcD [Sulfitoba...    255   1e-77 
gb|KAJ32688.1|  glycolate oxidase subunit GlcD [Agrobacterium ...    251   1e-77 
ref|WP_009344635.1|  FAD-binding protein [Raphidiopsis brookii]      256   1e-77 
gb|KEJ94209.1|  glycolate oxidase subunit GlcD [Sulfitobacter ...    255   1e-77 
ref|WP_026756953.1|  glycolate oxidase subunit GlcD [Sediminim...    255   1e-77 
ref|WP_010511054.1|  FAD-binding protein [SAR324 cluster bacte...    255   1e-77 
ref|WP_015159955.1|  glycolate oxidase, subunit GlcD [Chamaesi...    255   1e-77 
ref|WP_018688644.1|  FAD-binding protein [Ahrensia kielensis]        255   1e-77 
ref|WP_008561781.1|  FAD-binding protein [Ruegeria sp. R11]          255   1e-77 
ref|WP_017316781.1|  FAD-binding protein [Mastigocladopsis rep...    255   1e-77 
ref|WP_020959677.1|  FAD-binding protein [Geobacillus sp. JF8]       255   1e-77 
ref|WP_015190598.1|  glycolate oxidase, subunit GlcD [Gloeocap...    255   1e-77 
gb|KFE36766.1|  glycolate dehydrogenase, subunit GlcD [Thiocla...    254   1e-77 
ref|WP_017973556.1|  FAD-binding protein [Actinopolyspora halo...    255   2e-77 
ref|WP_028092504.1|  glycolate oxidase subunit GlcD [Donghicol...    255   2e-77 
gb|KEO60950.1|  FAD-binding protein [Thioclava sp. DT23-4]           254   2e-77 
ref|WP_019156071.1|  FAD-binding protein [Bacillus massiliosen...    255   2e-77 
ref|WP_026622396.1|  glycolate oxidase subunit GlcD [Sinorhizo...    255   2e-77 
gb|ABI29770.1|  GlcD [uncultured marine bacterium]                   249   2e-77 
ref|WP_025063741.1|  glycolate oxidase subunit GlcD [Sulfitoba...    254   2e-77 
ref|WP_024091267.1|  FAD-binding protein [Leisingera methyloha...    254   2e-77 
gb|ABI29457.1|  GlcD [uncultured marine bacterium]                   249   2e-77 
dbj|GAK70154.1|  glycolate oxidase subunit GlcD [Rhizobium rub...    254   2e-77 
ref|WP_018133105.1|  hypothetical protein [Alicyclobacillus po...    254   2e-77 
ref|WP_009810641.1|  FAD-binding protein [Roseobacter sp. MED193]    254   2e-77 
gb|ABI29513.1|  GlcD [uncultured marine bacterium]                   249   2e-77 
ref|WP_013949420.1|  MULTISPECIES: FAD-binding protein [Hyphom...    254   2e-77 
ref|WP_024708221.1|  glycolate oxidase subunit GlcD [Martelell...    254   2e-77 
ref|WP_007206967.1|  FAD-binding protein [Loktanella vestfolde...    254   3e-77 
gb|ABI29694.1|  GlcD [uncultured marine bacterium]                   248   3e-77 
ref|WP_023071018.1|  hypothetical protein [Leptolyngbya sp. He...    254   3e-77 
ref|WP_006530885.1|  glycolate oxidase, subunit GlcD [Gloeocap...    254   3e-77 
gb|ABI29320.1|  GlcD [uncultured marine bacterium]                   248   3e-77 
ref|WP_012626050.1|  FAD-binding protein [Cyanothece sp. PCC 7...    254   3e-77 
ref|WP_015134009.1|  glycolate oxidase subunit GlcD [Leptolyng...    254   3e-77 
gb|ABI29293.1|  GlcD [uncultured marine bacterium]                   248   3e-77 
gb|ABI29347.1|  GlcD [uncultured marine bacterium]                   248   3e-77 
ref|WP_013057555.1|  FAD-binding protein [Bacillus megaterium]       254   4e-77 
gb|ETW12897.1|  FAD linked oxidase domain-containing protein [...    254   4e-77 
ref|WP_028029257.1|  glycolate oxidase subunit GlcD [Catelliba...    254   4e-77 
ref|WP_023172717.1|  glycolate oxidase subunit GlcD [Gloeobact...    254   4e-77 
ref|WP_033099723.1|  glycolate oxidase subunit GlcD [bacterium...    253   4e-77 
ref|WP_007796169.1|  FAD-binding protein [Pelagibaca bermudensis]    254   4e-77 
ref|WP_005862729.1|  FAD-binding protein [Sagittula stellata]        254   4e-77 
ref|WP_008183114.1|  FAD-binding protein [Rhodobacteraceae bac...    254   4e-77 
ref|WP_028784950.1|  glycolate oxidase subunit GlcD [Thalassob...    254   4e-77 
ref|WP_006276097.1|  FAD-binding protein [Cylindrospermopsis r...    254   4e-77 
gb|ADC44815.1|  glycolate oxidase D-subunit [uncultured bacter...    248   5e-77 
ref|WP_015128976.1|  glycolate oxidase subunit GlcD [Calothrix...    254   5e-77 
ref|WP_014690044.1|  FAD-binding protein [Actinoplanes sp. SE5...    254   5e-77 
ref|WP_020056020.1|  FAD-binding protein [alpha proteobacteriu...    253   5e-77 
gb|EGD02622.1|  glycolate oxidase subunit GlcD [Burkholderia s...    243   5e-77 
ref|WP_025054999.1|  glycolate oxidase subunit GlcD [Sulfitoba...    253   5e-77 
ref|WP_026581205.1|  glycolate oxidase subunit GlcD [Bacillus ...    253   5e-77 
ref|WP_027235469.1|  glycolate oxidase subunit GlcD [Phaeobact...    253   5e-77 
ref|WP_020044604.1|  hypothetical protein [alpha proteobacteri...    253   5e-77 
ref|WP_027244851.1|  glycolate oxidase subunit GlcD [Phaeobact...    253   6e-77 
ref|WP_022573573.1|  FAD/FMN-dependent dehydrogenase [Rhodobac...    253   6e-77 
ref|WP_026116349.1|  glycolate oxidase subunit GlcD [Nocardiop...    253   6e-77 
gb|ADC44820.1|  glycolate oxidase D-subunit [uncultured bacter...    248   6e-77 
ref|WP_013676846.1|  FAD-binding protein [Pseudonocardia dioxa...    253   6e-77 
gb|ADC44816.1|  glycolate oxidase D-subunit [uncultured bacter...    248   6e-77 
gb|ETX27763.1|  FAD-binding protein [Roseivivax isoporae LMG 2...    253   6e-77 
ref|WP_011247018.1|  FAD-binding protein [Bacillus clausii]          253   6e-77 
ref|WP_027171418.1|  glycolate oxidase subunit GlcD [Methyloba...    253   8e-77 
ref|WP_010873482.1|  FAD-binding protein [Synechocystis sp. PC...    253   8e-77 
gb|ABI29575.1|  GlcD [uncultured marine bacterium]                   247   8e-77 
ref|WP_013083677.1|  FAD-binding protein [Bacillus megaterium]       253   8e-77 
gb|AHK00526.1|  glycolate dehydrogenase [Agrobacterium tumefac...    253   8e-77 
gb|ADC44811.1|  glycolate oxidase D-subunit [uncultured bacter...    247   9e-77 
ref|WP_026100380.1|  glycolate oxidase subunit GlcD [Microchae...    253   9e-77 
ref|WP_008555431.1|  FAD-binding protein [Rhodobacterales bact...    253   9e-77 
ref|WP_025592568.1|  glycolate oxidase subunit GlcD [Agrobacte...    253   9e-77 
ref|WP_016764604.1|  FAD-binding protein [Bacillus megaterium]       253   1e-76 
ref|WP_019564251.1|  FAD-binding protein [Agrobacterium sp. 10...    253   1e-76 
ref|WP_028663275.1|  glycolate oxidase subunit GlcD [Saccharom...    253   1e-76 
ref|WP_009628255.1|  glycolate oxidase, subunit GlcD [Pseudana...    253   1e-76 
ref|WP_028924813.1|  glycolate oxidase subunit GlcD [Pseudonoc...    253   1e-76 
ref|WP_004432243.1|  FAD-binding protein [Agrobacterium tumefa...    253   1e-76 
gb|ABI29625.1|  GlcD [uncultured marine bacterium]                   247   1e-76 
ref|WP_006238198.1|  FAD-binding protein [Saccharomonospora xi...    253   1e-76 
ref|WP_025051572.1|  glycolate oxidase subunit GlcD [Sulfitoba...    253   1e-76 
gb|KAJ04358.1|  glycolate oxidase subunit GlcD [Sulfitobacter ...    253   1e-76 
ref|WP_007026493.1|  FAD-binding protein [Saccharomonospora pa...    253   1e-76 
ref|WP_013635539.1|  FAD-binding protein [Agrobacterium sp. H1...    252   1e-76 
ref|WP_026119311.1|  glycolate oxidase subunit GlcD [Nocardiop...    252   1e-76 
ref|WP_013322559.1|  FAD-binding protein [Cyanothece sp. PCC 7...    253   1e-76 
gb|ADC44814.1|  glycolate oxidase D-subunit [uncultured bacter...    246   2e-76 
ref|WP_027892860.1|  glycolate oxidase subunit GlcD [Meiotherm...    252   2e-76 
ref|WP_028721113.1|  glycolate oxidase subunit GlcD [Paracoccu...    252   2e-76 
gb|ABI29525.1|  GlcD [uncultured marine bacterium]                   246   2e-76 
gb|AIM15197.1|  glycolate oxidase subunit GlcD [Geobacillus st...    253   2e-76 
gb|ADC44818.1|  glycolate oxidase D-subunit [uncultured bacter...    246   2e-76 
ref|WP_025751291.1|  glycolate oxidase subunit GlcD [Bacillus ...    252   2e-76 
ref|WP_006170792.1|  FAD-binding protein [Synechococcus sp. WH...    253   2e-76 
gb|ABI29492.1|  GlcD [uncultured marine bacterium]                   246   2e-76 
gb|KGM89885.1|  FAD/FMN-containing dehydrogenase [Roseovarius ...    252   2e-76 
gb|ABI29383.1|  GlcD [uncultured marine bacterium]                   246   2e-76 
ref|WP_014881127.1|  FAD-binding protein [Phaeobacter gallaeci...    252   2e-76 
ref|WP_009806646.1|  FAD-binding protein [Oceanicola batsensis]      251   2e-76 
gb|ADC44612.1|  glycolate oxidase D-subunit [uncultured bacter...    246   2e-76 
ref|WP_014989407.1|  FAD-binding protein [Sinorhizobium meliloti]    252   2e-76 
ref|WP_003494031.1|  FAD-binding protein [Agrobacterium tumefa...    251   2e-76 
ref|WP_018045901.1|  FAD-binding protein [Methylobacterium sp....    251   3e-76 
ref|WP_028409028.1|  glycolate oxidase subunit GlcD [Bacillus ...    251   3e-76 
ref|WP_019906296.1|  FAD-binding protein [Methylobacterium sp....    251   3e-76 
ref|WP_017747452.1|  FAD-binding protein [Scytonema hofmanni]        252   3e-76 
ref|WP_027257415.1|  glycolate oxidase subunit GlcD [Leisinger...    251   3e-76 
ref|WP_018633207.1|  hypothetical protein [Meganema perideroedes]    251   3e-76 
gb|KGJ17081.1|  glycolate oxidase subunit GlcD [Paracoccus sp....    251   3e-76 
ref|WP_008281386.1|  FAD-binding protein [Roseovarius sp. TM1035]    251   3e-76 
ref|WP_012641672.1|  FAD-binding protein [Thermomicrobium roseum]    251   4e-76 
ref|WP_014459572.1|  FAD-binding protein [Bacillus megaterium]       251   4e-76 
gb|AHY47546.1|  FAD/FMN-containing dehydrogenase [Rubrobacter ...    251   4e-76 
gb|ADC44819.1|  glycolate oxidase D-subunit [uncultured bacter...    246   4e-76 
gb|ADC44821.1|  glycolate oxidase D-subunit [uncultured bacter...    246   4e-76 
ref|WP_024095964.1|  FAD/FMN-containing dehydrogenase [Phaeoba...    251   4e-76 
ref|WP_027262146.1|  glycolate oxidase subunit GlcD [Leisinger...    251   4e-76 
ref|WP_014875853.1|  FAD-binding protein [Phaeobacter gallaeci...    251   4e-76 
ref|WP_013960063.1|  FAD-binding protein [Roseobacter litoralis]     251   4e-76 
ref|WP_019855288.1|  FAD-binding protein [Actinopolyspora mort...    251   4e-76 
gb|ABI29747.1|  GlcD [uncultured marine bacterium]                   245   5e-76 
ref|WP_008228882.1|  FAD-binding protein [Roseobacter sp. GAI101]    251   5e-76 
emb|CDN91731.1|  Glycolate oxidase subunit GlcD [Agrobacterium...    251   5e-76 
ref|WP_020010514.1|  MULTISPECIES: FAD-binding protein [Agroba...    251   5e-76 
ref|WP_010531662.1|  FAD-binding protein [Lentibacillus jeotgali]    251   5e-76 
ref|WP_012871468.1|  FAD-binding protein [Sphaerobacter thermo...    251   5e-76 
ref|WP_026453476.1|  glycolate oxidase subunit GlcD [Actinopol...    251   5e-76 
gb|KGF73005.1|  glycolate oxidase subunit GlcD [Synechococcus ...    251   5e-76 
ref|WP_027946675.1|  glycolate oxidase subunit GlcD [Amycolato...    251   6e-76 
ref|WP_011566947.1|  FAD-binding protein [Roseobacter denitrif...    251   6e-76 
ref|WP_028412895.1|  glycolate oxidase subunit GlcD [Bacillus ...    251   6e-76 
gb|ABI29772.1|  GlcD [uncultured marine bacterium]                   245   6e-76 
ref|WP_020056925.1|  FAD-binding protein [alpha proteobacteriu...    250   7e-76 
ref|WP_003503201.1|  FAD-binding protein [Agrobacterium tumefa...    250   7e-76 
ref|WP_015169851.1|  glycolate oxidase subunit GlcD [Synechoco...    251   7e-76 
ref|WP_014431545.1|  FAD-binding protein [Caldilinea aerophila]      250   7e-76 
ref|WP_012179557.1|  FAD-binding protein [Dinoroseobacter shibae]    250   8e-76 
ref|WP_004440167.1|  FAD-binding protein [Rhizobium sp. IRBG74]      250   8e-76 
ref|WP_028058143.1|  glycolate oxidase subunit GlcD [Solirubro...    250   8e-76 
gb|ADC44611.1|  glycolate oxidase D-subunit [uncultured bacter...    245   8e-76 
ref|WP_009816642.1|  FAD-binding protein [Roseovarius sp. 217]       250   8e-76 
ref|WP_028084211.1|  glycolate oxidase subunit GlcD [Dolichosp...    251   8e-76 
ref|WP_024124643.1|  glycolate oxidase FAD-binding subunit Glc...    250   9e-76 
ref|WP_021101159.1|  Glycolate dehydrogenase, subunit GlcD [Th...    250   9e-76 
gb|ADC44610.1|  glycolate oxidase D-subunit [uncultured bacter...    244   1e-75 
ref|WP_026677024.1|  glycolate oxidase subunit GlcD [Bacillus ...    250   1e-75 
gb|AHM04002.1|  Glycolate dehydrogenase, subunit GlcD [Roseiba...    250   1e-75 
ref|WP_004432819.1|  glycolate oxidase subunit [Agrobacterium ...    250   1e-75 
ref|WP_004999651.1|  glycolate oxidase, subunit GlcD [Nitrococ...    239   1e-75 
gb|ADC44613.1|  glycolate oxidase D-subunit [uncultured bacter...    244   1e-75 
ref|WP_015138998.1|  glycolate oxidase subunit GlcD [Nostoc sp...    250   1e-75 
ref|WP_027881482.1|  glycolate oxidase subunit GlcD [Meiotherm...    250   1e-75 
ref|WP_027404492.1|  glycolate oxidase subunit GlcD [Aphanizom...    250   1e-75 
ref|WP_020577572.1|  hypothetical protein [Actinopolymorpha alba]    250   1e-75 
ref|WP_013420795.1|  FAD-binding protein [Rhodomicrobium vanni...    250   1e-75 
ref|WP_015219122.1|  glycolate oxidase subunit GlcD [Cyanobact...    250   1e-75 
ref|WP_010971051.1|  FAD-binding protein [Agrobacterium fabrum]      249   1e-75 
ref|WP_018065523.1|  FAD-binding protein [Martelella mediterra...    249   1e-75 
ref|WP_012321245.1|  MULTISPECIES: FAD-binding protein [Methyl...    249   1e-75 
gb|KGG75994.1|  glycolate oxidase subunit GlcD [Tolypothrix bo...    250   2e-75 
ref|WP_010239564.1|  FAD-binding protein [Pseudonocardia sp. P1]     249   2e-75 
gb|KAI96196.1|  glycolate oxidase subunit GlcD [Rhodomicrobium...    249   2e-75 
ref|WP_007565362.1|  FAD-binding protein [Methylobacterium sp....    249   2e-75 
ref|WP_031234401.1|  glycolate oxidase subunit GlcD [Agrobacte...    249   2e-75 
ref|WP_012161666.1|  FAD-binding protein [Acaryochloris marina]      249   2e-75 
ref|WP_006313135.1|  FAD-binding protein [Agrobacterium sp. AT...    249   2e-75 
ref|WP_008035898.1|  FAD-binding protein [Rhodobacterales bact...    249   2e-75 
ref|WP_015783352.1|  FAD-binding protein [Cyanothece sp. PCC 8...    249   2e-75 
ref|WP_026797910.1|  glycolate oxidase subunit GlcD [Planktoth...    249   2e-75 
gb|ADC44813.1|  glycolate oxidase D-subunit [uncultured bacter...    244   2e-75 
ref|WP_002721343.1|  FAD-binding protein [Rhodobacter sphaeroi...    249   2e-75 
ref|WP_030175874.1|  glycolate oxidase subunit GlcD [Spirillos...    249   2e-75 
ref|WP_009333542.1|  FAD-binding protein [Bacillus sp. 2_A_57_...    249   2e-75 
ref|WP_012594180.1|  FAD-binding protein [Cyanothece sp. PCC 8...    249   2e-75 
ref|WP_019382481.1|  FAD-binding protein [Bacillus oceanisedim...    249   2e-75 
ref|WP_026786426.1|  glycolate oxidase subunit GlcD [Planktoth...    249   2e-75 
ref|WP_028091198.1|  glycolate oxidase subunit GlcD [Dolichosp...    249   2e-75 
ref|WP_024828845.1|  glycolate oxidase subunit GlcD [Methyloba...    249   2e-75 
ref|WP_011841822.1|  FAD-binding protein [Rhodobacter sphaeroi...    249   3e-75 
ref|WP_027255490.1|  glycolate oxidase subunit GlcD [Planktoth...    249   3e-75 
ref|WP_011338664.1|  FAD-binding protein [Rhodobacter sphaeroi...    249   3e-75 
gb|KEI66105.1|  GlcD [Planktothrix agardhii NIVA-CYA 126/8]          249   3e-75 
gb|KGE82867.1|  glycolate oxidase subunit GlcD [Rhizobium sp. ...    249   3e-75 
ref|WP_010477242.1|  FAD-binding protein [Acaryochloris sp. CC...    249   3e-75 
ref|WP_015921407.1|  FAD-binding protein [Rhodobacter sphaeroi...    249   3e-75 
ref|WP_009563066.1|  Glycolate dehydrogenase , subunit GlcD [R...    249   3e-75 
gb|EPR12398.1|  FAD-binding protein [Agrobacterium radiobacter...    249   3e-75 
ref|WP_012412357.1|  FAD-binding protein [Nostoc punctiforme]        249   3e-75 
ref|WP_026960746.1|  glycolate oxidase subunit GlcD [Alicyclob...    248   3e-75 
ref|WP_020373004.1|  FAD-binding protein [Sulfobacillus thermo...    248   4e-75 
ref|WP_027929281.1|  glycolate oxidase subunit GlcD [Amycolato...    249   4e-75 
ref|WP_020721214.1|  hypothetical protein [Acidobacteriaceae b...    248   4e-75 
ref|WP_028963637.1|  glycolate oxidase subunit GlcD [Sulfobaci...    248   4e-75 
ref|WP_026794190.1|  MULTISPECIES: glycolate oxidase subunit G...    249   4e-75 
ref|WP_009632697.1|  glycolate oxidase, subunit GlcD [Synechoc...    249   4e-75 
ref|WP_015147312.1|  glycolate oxidase subunit GlcD [Oscillato...    249   4e-75 
gb|AIQ92744.1|  FAD linked oxidase domain-containing protein [...    248   4e-75 
ref|WP_026411940.1|  glycolate oxidase subunit GlcD [Actinomad...    248   4e-75 
gb|EWG11362.1|  FAD linked oxidase [Bacillus firmus DS1]             249   4e-75 
ref|WP_005851041.1|  FAD-binding protein [Sulfitobacter sp. EE...    248   4e-75 
ref|WP_027249170.1|  glycolate oxidase subunit GlcD [Planktoth...    249   5e-75 
ref|WP_011421919.1|  FAD-binding protein [Anaeromyxobacter deh...    248   5e-75 
gb|KFC24965.1|  glycolate oxidase subunit GlcD [Sulfitobacter ...    248   5e-75 
ref|WP_015200787.1|  glycolate oxidase subunit GlcD [Calothrix...    248   6e-75 
ref|WP_009152163.1|  FAD-binding protein [Saccharomonospora ma...    248   6e-75 
ref|WP_002716808.1|  MULTISPECIES: FAD-binding protein [Afipia]      248   6e-75 
ref|WP_025909670.1|  glycolate oxidase subunit GlcD [Bacillus ...    248   6e-75 
ref|WP_019240734.1|  FAD-binding protein [Bacillus massilioano...    248   6e-75 
gb|KFI32352.1|  glycolate oxidase subunit GlcD [Haematobacter ...    248   6e-75 
ref|WP_008230859.1|  FAD-binding protein [Roseobacter sp. CCS2]      248   6e-75 
ref|WP_012097723.1|  FAD-binding protein [Anaeromyxobacter sp....    248   6e-75 
ref|WP_013190846.1|  FAD-binding protein [Trichormus azollae]        248   7e-75 
gb|KGJ15594.1|  glycolate oxidase subunit GlcD [Paracoccus sp....    248   7e-75 
ref|WP_030529927.1|  glycolate oxidase subunit GlcD [Prauserel...    248   7e-75 
ref|WP_015208875.1|  glycolate oxidase, subunit GlcD [Cylindro...    248   8e-75 
emb|CCF22274.1|  Putative glycolate oxidase subunit GlcD; FAD-...    248   9e-75 
ref|WP_015201248.1|  glycolate oxidase subunit GlcD [Crinalium...    248   9e-75 
ref|WP_017295058.1|  FAD-binding protein [Geminocystis herdmanii]    248   1e-74 
ref|WP_015214741.1|  glycolate oxidase, subunit GlcD [Anabaena...    248   1e-74 
ref|WP_012634109.1|  FAD-binding protein [Anaeromyxobacter deh...    248   1e-74 
ref|WP_017713958.1|  FAD-binding protein [Prochlorothrix holla...    248   1e-74 
ref|WP_010999393.1|  FAD-binding protein [Nostoc sp. PCC 7120]       246   1e-74 
ref|WP_010685181.1|  FAD linked oxidase domain-containing prot...    247   2e-74 
gb|ADC44812.1|  glycolate oxidase D-subunit [uncultured bacter...    241   2e-74 
gb|KEP69781.1|  glycolate oxidase subunit GlcD [Thioclava sp. ...    247   2e-74 
ref|WP_013676841.1|  FAD-binding protein [Pseudonocardia dioxa...    247   2e-74 
ref|WP_024876507.1|  glycolate oxidase subunit GlcD [Saccharom...    247   2e-74 
gb|EWT04608.1|  glycolate oxidase subunit GlcD [Intrasporangiu...    247   2e-74 
ref|WP_019606882.1|  FAD-binding protein [Nocardiopsis sp. CNS...    247   2e-74 
ref|WP_015156136.1|  glycolate oxidase subunit GlcD [Chroococc...    247   2e-74 
gb|EYD77315.1|  Glycolate dehydrogenase, subunit GlcD [Rubelli...    246   2e-74 
ref|WP_016483192.1|  FAD/FMN-containing dehydrogenases [Chthon...    247   2e-74 
gb|AIE74016.1|  Glycolate dehydrogenase, subunit GlcD [Synecho...    248   2e-74 
ref|WP_007505557.1|  FAD-binding protein [Caldalkalibacillus t...    247   2e-74 
ref|WP_015142428.1|  glycolate oxidase subunit GlcD [Pleurocap...    247   2e-74 
ref|WP_012452793.1|  FAD-binding protein [Methylobacterium pop...    246   2e-74 
ref|WP_018705340.1|  FAD-binding protein [Bacillus fordii]           246   2e-74 
ref|WP_015821375.1|  FAD-binding protein [Methylobacterium ext...    246   2e-74 
ref|WP_006511652.1|  glycolate oxidase, subunit GlcD [Xenococc...    247   2e-74 
ref|WP_026105946.1|  glycolate oxidase subunit GlcD [Methyloba...    246   2e-74 
ref|WP_020094019.1|  FAD-binding protein [Methylobacterium sp....    246   2e-74 
ref|WP_009825855.1|  FAD-binding protein [Sulfitobacter sp. NA...    246   3e-74 
gb|ABI29287.1|  GlcD [uncultured marine bacterium]                   241   3e-74 
gb|ABI29314.1|  GlcD [uncultured marine bacterium]                   241   3e-74 
ref|WP_008205260.1|  FAD-binding protein [Roseobacter sp. SK20...    246   3e-74 
gb|AIJ23944.1|  D-lactate dehydrogenase (cytochrome) [Amycolat...    246   3e-74 
ref|WP_012605885.1|  FAD-binding protein [Methylobacterium ext...    246   3e-74 
ref|WP_006978277.1|  FAD-binding protein [Chthoniobacter flavus]     246   3e-74 
ref|WP_027322615.1|  glycolate oxidase subunit GlcD [Bacillus ...    246   3e-74 
ref|WP_012252632.1|  FAD-binding protein [Methylobacterium ext...    246   3e-74 
ref|WP_012950759.1|  FAD-binding protein [Geodermatophilus obs...    246   3e-74 
ref|WP_026153169.1|  glycolate oxidase subunit GlcD [Amycolato...    246   4e-74 
gb|ABI29557.1|  GlcD [uncultured marine bacterium]                   240   4e-74 
ref|WP_015080776.1|  glycolate oxidase subunit GlcD [Anabaena ...    246   4e-74 
ref|WP_028397617.1|  glycolate oxidase subunit GlcD [Bacillus ...    246   4e-74 
ref|WP_019414755.1|  FAD-binding protein [Paenisporosarcina sp...    246   4e-74 
ref|WP_003605382.1|  FAD-binding protein [Methylobacterium ext...    246   4e-74 
ref|WP_017380269.1|  FAD-binding protein [Paenisporosarcina sp...    246   4e-74 
gb|KFB84112.1|  glycolate oxidase subunit GlcD [Calothrix sp. ...    246   4e-74 
ref|WP_021623561.1|  putative glycolate oxidase, subunit GlcD ...    246   4e-74 
ref|WP_006903742.1|  FAD-binding protein [Thermaerobacter subt...    246   4e-74 
gb|ADC44800.1|  glycolate oxidase D-subunit [uncultured bacter...    240   5e-74 
ref|WP_015178224.1|  glycolate oxidase, subunit GlcD [Oscillat...    246   5e-74 
ref|WP_027241831.1|  glycolate oxidase subunit GlcD [Phaeobact...    246   5e-74 
gb|ABI29249.1|  GlcD [uncultured marine bacterium]                   240   5e-74 
ref|WP_020710784.1|  hypothetical protein [Acidobacteriaceae b...    246   5e-74 
ref|WP_026405551.1|  glycolate oxidase subunit GlcD [Actinomad...    246   6e-74 
ref|WP_006197864.1|  FAD-binding protein [Nodularia spumigena]       246   6e-74 
ref|WP_017598687.1|  FAD-binding protein [Nocardiopsis lucente...    246   6e-74 
gb|KFI28708.1|  glycolate oxidase subunit GlcD [Haematobacter ...    245   6e-74 
ref|WP_009505463.1|  FAD-binding protein [Citreicella sp. 357]       245   8e-74 
ref|WP_011057464.1|  FAD-binding protein [Thermosynechococcus ...    245   8e-74 
ref|WP_007256958.1|  FAD-binding protein [Oceanicola granulosus]     245   8e-74 
ref|WP_022798309.1|  FAD-binding protein [Thermus islandicus]        244   8e-74 
ref|WP_017320451.1|  FAD-binding protein [cyanobacterium PCC 7...    245   1e-73 
ref|WP_024545218.1|  glycolate oxidase subunit GlcD [Synechoco...    245   1e-73 
ref|WP_019509088.1|  FAD-binding protein [Pleurocapsa sp. PCC ...    245   1e-73 
ref|WP_023431020.1|  Glycolate dehydrogenase, subunit GlcD [Lu...    244   1e-73 
tpg|DAA33848.1|  TPA: CG3835-like [Bos taurus]                       240   2e-73 
ref|WP_016950104.1|  FAD-binding protein [Anabaena sp. PCC 7108]     244   2e-73 
ref|WP_013491677.1|  FAD-binding protein [Intrasporangium calvum]    244   2e-73 
ref|WP_006631678.1|  FAD-binding protein [Microcoleus vaginatus]     244   2e-73 
ref|WP_017571718.1|  FAD-binding protein [Nocardiopsis halotol...    244   2e-73 
ref|WP_019818572.1|  FAD-binding protein [Saccharomonospora sa...    244   2e-73 
ref|WP_002776117.1|  FAD-binding protein [Microcystis aeruginosa]    244   3e-73 
ref|WP_015117157.1|  glycolate oxidase subunit GlcD [Rivularia...    244   3e-73 
ref|WP_015166563.1|  glycolate oxidase subunit GlcD [Pseudanab...    244   3e-73 
ref|WP_011613429.1|  FAD-binding protein [Trichodesmium erythr...    244   3e-73 
ref|WP_015191809.1|  glycolate oxidase, subunit GlcD [Stanieri...    244   3e-73 
ref|WP_011682829.1|  FAD-binding protein [Candidatus Solibacte...    243   4e-73 
ref|WP_012526952.1|  FAD-binding protein [Anaeromyxobacter sp. K]    244   4e-73 
ref|WP_008179542.1|  FAD-binding protein [Moorea producens]          243   4e-73 
ref|WP_012853594.1|  FAD-binding protein [Thermomonospora curv...    243   4e-73 
ref|WP_017719204.1|  FAD-binding protein [Oscillatoria sp. PCC...    243   5e-73 
gb|ADC44609.1|  glycolate oxidase D-subunit [uncultured bacter...    238   5e-73 
ref|WP_015108716.1|  FAD/FMN-dependent dehydrogenase [Cyanobiu...    243   6e-73 
ref|WP_020148513.1|  hypothetical protein [Verrucomicrobia bac...    243   6e-73 
ref|WP_017565516.1|  FAD-binding protein [Nocardiopsis synnema...    243   7e-73 
ref|WP_012308444.1|  FAD-binding protein [Synechococcus sp. PC...    243   7e-73 
ref|WP_013151734.1|  FAD-binding protein [Nocardiopsis dassonv...    243   7e-73 
ref|WP_016514734.1|  putative FAD-linked oxidoreductase [Micro...    243   8e-73 
ref|WP_004157868.1|  FAD-binding protein [Microcystis aeruginosa]    243   8e-73 
ref|WP_015182419.1|  glycolate oxidase subunit GlcD [Microcole...    243   9e-73 
ref|WP_023362565.1|  putative FAD linked oxidase [Actinoplanes...    242   1e-72 
gb|KGJ07732.1|  glycolate oxidase subunit GlcD [Paracoccus sph...    242   1e-72 
ref|WP_009711301.1|  FAD-binding protein [Desmospora sp. 8437]       242   1e-72 
ref|WP_026732620.1|  glycolate oxidase subunit GlcD [Fischerel...    242   1e-72 
gb|KGJ20156.1|  glycolate oxidase subunit GlcD [Paracoccus sp....    242   1e-72 
ref|WP_009457275.1|  MULTISPECIES: FAD-binding protein [Fische...    242   1e-72 
gb|KGJ21982.1|  glycolate oxidase subunit GlcD [Paracoccus sp....    242   1e-72 
ref|WP_002780822.1|  glycolate oxidase, subunit GlcD [Microcys...    242   2e-72 
ref|WP_002770318.1|  FAD-binding protein [Microcystis aeruginosa]    242   2e-72 
ref|WP_020517231.1|  FAD-binding protein [Actinoplanes globisp...    241   2e-72 
ref|WP_017306183.1|  FAD-binding protein [Spirulina subsalsa]        242   2e-72 
ref|WP_013068574.1|  FAD-binding protein [Rhodobacter capsulatus]    241   2e-72 
ref|WP_002787075.1|  FAD-binding protein [Microcystis aeruginosa]    242   2e-72 
ref|WP_006592061.1|  FAD-binding protein [Kineosphaera limosa]       242   2e-72 
ref|WP_002736423.1|  glycolate oxidase, subunit GlcD [Microcys...    241   2e-72 
ref|WP_011143062.1|  FAD-binding protein [Gloeobacter violaceus]     241   2e-72 
ref|WP_015115638.1|  glycolate oxidase subunit GlcD [Nostoc sp...    241   2e-72 
ref|WP_002796022.1|  FAD-binding protein [Microcystis aeruginosa]    241   2e-72 
ref|XP_006683312.1|  hypothetical protein BATDEDRAFT_93076 [Ba...    241   3e-72 
ref|WP_002801076.1|  FAD-binding protein [Microcystis aeruginosa]    241   3e-72 
ref|WP_026365221.1|  glycolate oxidase subunit GlcD [Promicrom...    241   3e-72 
ref|WP_011319291.1|  FAD-binding protein [Anabaena variabilis]       241   3e-72 
ref|WP_015955185.1|  FAD-binding protein [Cyanothece sp. PCC 7...    241   3e-72 
ref|WP_031500440.1|  glycolate oxidase subunit GlcD [Bryobacte...    241   4e-72 
gb|ADC44727.1|  glycolate oxidase D-subunit [uncultured bacter...    235   4e-72 
emb|CDN17153.1|  Glycolate dehydrogenase , subunit GlcD [Riche...    241   4e-72 
ref|WP_029637816.1|  glycolate oxidase subunit GlcD [ [[Scyton...    241   4e-72 
ref|WP_010138823.1|  FAD-binding protein [Oceanicola sp. S124]       241   5e-72 
ref|WP_020186131.1|  hypothetical protein [Methylopila sp. 73B]      240   5e-72 
ref|WP_027838855.1|  glycolate oxidase subunit GlcD [Mastigoco...    241   5e-72 
ref|WP_020180329.1|  FAD-binding protein [Methylopila sp. M107]      240   6e-72 
ref|WP_026370327.1|  glycolate oxidase subunit GlcD [bacterium...    240   6e-72 
ref|WP_016865793.1|  FAD-binding protein [Fischerella muscicola]     241   6e-72 
gb|ADC44737.1|  glycolate oxidase D-subunit [uncultured bacter...    235   6e-72 
gb|EQB36934.1|  FAD-binding protein [Virgibacillus sp. CM-4]         240   6e-72 
ref|WP_031335415.1|  glycolate oxidase subunit GlcD [Virgibaci...    240   7e-72 
ref|WP_024970872.1|  glycolate oxidase subunit GlcD [Microcyst...    240   7e-72 
gb|ADC44736.1|  glycolate oxidase D-subunit [uncultured bacter...    234   7e-72 
ref|WP_023918660.1|  FAD-binding protein [Rhodobacter capsulatus]    240   7e-72 
ref|WP_030450776.1|  glycolate oxidase subunit GlcD [Herbidosp...    239   7e-72 
ref|WP_008199735.1|  FAD-binding protein [Microcystis sp. T1-4]      240   8e-72 
gb|ADC44740.1|  glycolate oxidase D-subunit [uncultured bacter...    234   8e-72 
gb|ADC44732.1|  glycolate oxidase D-subunit [uncultured bacter...    234   8e-72 
ref|WP_014909222.1|  FAD-binding protein [Nocardiopsis alba]         240   8e-72 
gb|ADC44739.1|  glycolate oxidase D-subunit [uncultured bacter...    234   9e-72 
ref|WP_016872628.1|  FAD-binding protein [Chlorogloeopsis frit...    240   9e-72 
gb|ADC44753.1|  glycolate oxidase D-subunit [uncultured bacter...    234   9e-72 
gb|ADC44749.1|  glycolate oxidase D-subunit [uncultured bacter...    234   9e-72 
gb|ADC44745.1|  glycolate oxidase D-subunit [uncultured bacter...    234   9e-72 
ref|WP_017617660.1|  FAD-binding protein [Nocardiopsis gilva]        240   9e-72 
gb|ADC44738.1|  glycolate oxidase D-subunit [uncultured bacter...    234   1e-71 
gb|ADC44733.1|  glycolate oxidase D-subunit [uncultured bacter...    234   1e-71 
ref|WP_027953951.1|  glycolate oxidase subunit GlcD [Halobacil...    239   1e-71 
ref|WP_013495820.1|  FAD-binding protein [Thermaerobacter mari...    240   1e-71 
gb|ADC44751.1|  glycolate oxidase D-subunit [uncultured bacter...    234   1e-71 
ref|WP_023912058.1|  FAD-binding protein [Rhodobacter capsulatus]    239   1e-71 
gb|ADC44725.1|  glycolate oxidase D-subunit [uncultured bacter...    234   1e-71 
ref|WP_002760051.1|  FAD-binding protein [Microcystis aeruginosa]    239   1e-71 
ref|WP_030506434.1|  glycolate oxidase subunit GlcD [Microbisp...    239   1e-71 
gb|ABI29589.1|  GlcD [uncultured marine bacterium]                   234   2e-71 
ref|WP_013131393.1|  FAD-binding protein [Thermobispora bispora]     239   2e-71 
ref|WP_019633961.1|  FAD-binding protein [Actinomadura atramen...    239   2e-71 
gb|ADC44724.1|  glycolate oxidase D-subunit [uncultured bacter...    234   2e-71 
ref|WP_026180895.1|  glycolate oxidase subunit GlcD [Demetria ...    239   2e-71 
gb|ETK35879.1|  FAD-binding protein [Microbispora sp. ATCC PTA...    239   2e-71 
ref|WP_023924656.1|  FAD-binding protein [Rhodobacter capsulatus]    239   2e-71 
ref|WP_009830128.1|  FAD-binding protein [Rhodobacteraceae bac...    239   2e-71 
gb|ADC44785.1|  glycolate oxidase D-subunit [uncultured bacter...    233   2e-71 
gb|AGU11165.1|  FAD linked oxidase, C-terminal domain [uncultu...    239   2e-71 
ref|WP_020541792.1|  FAD-binding protein [Nonomuraea coxensis]       239   2e-71 
ref|WP_016859102.1|  FAD-binding protein [Fischerella muscicola]     239   2e-71 
gb|KEF42605.1|  glycolate oxidase subunit GlcD [Cyanobium sp. ...    239   3e-71 
ref|WP_007354785.1|  MULTISPECIES: FAD-binding protein [Kampto...    239   3e-71 
gb|ADC44728.1|  glycolate oxidase D-subunit [uncultured bacter...    233   3e-71 
gb|KFC73351.1|  Glycolate oxidase, subunit GlcD [Bosea sp. LC85]     238   3e-71 
ref|WP_026204961.1|  glycolate oxidase subunit GlcD [Actinomyc...    238   3e-71 
gb|ADC44686.1|  glycolate oxidase D-subunit [uncultured bacter...    233   3e-71 
ref|WP_015598987.1|  FAD-binding protein [Hyphomicrobium denit...    238   4e-71 
ref|WP_009882964.1|  FAD-binding protein [Brevibacterium linens]     238   4e-71 
ref|WP_004162156.1|  FAD-binding protein [Microcystis aeruginosa]    238   4e-71 
gb|ADC44784.1|  glycolate oxidase D-subunit [uncultured bacter...    233   4e-71 
ref|WP_002747534.1|  glycolate oxidase, subunit GlcD [Microcys...    238   4e-71 
gb|ADC44700.1|  glycolate oxidase D-subunit [uncultured bacter...    233   5e-71 
emb|CAO89264.1|  unnamed protein product [Microcystis aerugino...    238   5e-71 
gb|ADC44684.1|  glycolate oxidase D-subunit [uncultured bacter...    232   5e-71 
gb|ADC44680.1|  glycolate oxidase D-subunit [uncultured bacter...    232   5e-71 
gb|ADC44695.1|  glycolate oxidase D-subunit [uncultured bacter...    232   5e-71 
gb|ADC44691.1|  glycolate oxidase D-subunit [uncultured bacter...    232   5e-71 
gb|ADC44681.1|  glycolate oxidase D-subunit [uncultured bacter...    232   5e-71 
gb|ADC44690.1|  glycolate oxidase D-subunit [uncultured bacter...    232   5e-71 
gb|ABI29319.1|  GlcD [uncultured marine bacterium]                   232   5e-71 
ref|WP_026857489.1|  glycolate oxidase subunit GlcD [Geodermat...    238   5e-71 
gb|ADC44689.1|  glycolate oxidase D-subunit [uncultured bacter...    232   6e-71 
gb|KEZ50292.1|  glycolate oxidase subunit GlcD [Bacillus indic...    238   6e-71 
ref|WP_019488875.1|  FAD-binding protein [Calothrix sp. PCC 7103]    238   6e-71 
gb|KEZ54449.1|  glycolate oxidase subunit GlcD [Bacillus cibi]       238   7e-71 
gb|ADC44776.1|  glycolate oxidase D-subunit [uncultured bacter...    232   7e-71 
gb|ADC44726.1|  glycolate oxidase D-subunit [uncultured bacter...    232   8e-71 
gb|ADC44786.1|  glycolate oxidase D-subunit [uncultured bacter...    232   8e-71 
gb|ADC44779.1|  glycolate oxidase D-subunit [uncultured bacter...    232   9e-71 
ref|WP_027863120.1|  glycolate oxidase subunit GlcD [Marmorico...    237   9e-71 
gb|ADC44676.1|  glycolate oxidase D-subunit [uncultured bacter...    232   9e-71 
ref|WP_018655074.1|  FAD-binding protein [Actinomadura flavalba]     237   9e-71 
gb|ADC44775.1|  glycolate oxidase D-subunit [uncultured bacter...    232   9e-71 
gb|ADC44781.1|  glycolate oxidase D-subunit [uncultured bacter...    232   1e-70 
gb|ADC44774.1|  glycolate oxidase D-subunit [uncultured bacter...    232   1e-70 
gb|ADC44750.1|  glycolate oxidase D-subunit [uncultured bacter...    231   1e-70 
gb|ADC44748.1|  glycolate oxidase D-subunit [uncultured bacter...    231   1e-70 
gb|ADC44771.1|  glycolate oxidase D-subunit [uncultured bacter...    231   1e-70 
gb|ADC44687.1|  glycolate oxidase D-subunit [uncultured bacter...    231   1e-70 
gb|ADC44799.1|  glycolate oxidase D-subunit [uncultured bacter...    231   1e-70 
gb|ADC44746.1|  glycolate oxidase D-subunit [uncultured bacter...    231   2e-70 
gb|ADC44696.1|  glycolate oxidase D-subunit [uncultured bacter...    231   2e-70 
gb|ADC44735.1|  glycolate oxidase D-subunit [uncultured bacter...    231   2e-70 
gb|ADC44675.1|  glycolate oxidase D-subunit [uncultured bacter...    231   2e-70 
gb|ADC44723.1|  glycolate oxidase D-subunit [uncultured bacter...    231   2e-70 
gb|ADC44698.1|  glycolate oxidase D-subunit [uncultured bacter...    231   2e-70 
gb|ABI29257.1|  GlcD [uncultured marine bacterium]                   231   2e-70 
gb|ADC44699.1|  glycolate oxidase D-subunit [uncultured bacter...    231   3e-70 
gb|ADC44730.1|  glycolate oxidase D-subunit [uncultured bacter...    230   3e-70 
ref|WP_006561355.1|  FAD-binding protein [Oscillochloris trich...    236   3e-70 
gb|ADC44783.1|  glycolate oxidase D-subunit [uncultured bacter...    230   3e-70 
gb|ADC44693.1|  glycolate oxidase D-subunit [uncultured bacter...    230   3e-70 
gb|ADC44679.1|  glycolate oxidase D-subunit [uncultured bacter...    230   5e-70 
ref|WP_017662683.1|  FAD-binding protein [Geitlerinema sp. PCC...    236   5e-70 
gb|ADC44782.1|  glycolate oxidase D-subunit [uncultured bacter...    230   5e-70 
ref|WP_009784623.1|  FAD-binding protein [Lyngbya sp. PCC 8106]      235   5e-70 
gb|ADC44674.1|  glycolate oxidase D-subunit [uncultured bacter...    229   6e-70 
ref|WP_017546327.1|  FAD-binding protein [Nocardiopsis prasina]      235   6e-70 
gb|ADC44752.1|  glycolate oxidase D-subunit [uncultured bacter...    229   7e-70 
ref|WP_026336247.1|  glycolate oxidase subunit GlcD [Acidobact...    235   8e-70 
gb|ADC44692.1|  glycolate oxidase D-subunit [uncultured bacter...    229   8e-70 
gb|ADC44777.1|  glycolate oxidase D-subunit [uncultured bacter...    229   9e-70 
ref|WP_011453815.1|  FAD-binding protein [Jannaschia sp. CCS1]       234   9e-70 
ref|WP_030449005.1|  glycolate oxidase subunit GlcD [Actinocat...    234   1e-69 
ref|WP_013216536.1|  FAD-binding protein [Hyphomicrobium denit...    234   1e-69 
gb|ADC44677.1|  glycolate oxidase D-subunit [uncultured bacter...    229   1e-69 
gb|ADC44729.1|  glycolate oxidase D-subunit [uncultured bacter...    229   1e-69 
ref|WP_031162891.1|  glycolate oxidase subunit GlcD [Streptosp...    234   2e-69 
gb|ADI18097.1|  fad/fmn-containing dehydrogenases [uncultured ...    233   2e-69 
ref|WP_013985210.1|  FAD-binding protein [Sulfobacillus acidop...    234   2e-69 
gb|ADC44678.1|  glycolate oxidase D-subunit [uncultured bacter...    228   2e-69 
ref|WP_006043554.1|  FAD-binding protein [Synechococcus sp. WH...    234   2e-69 
ref|WP_008361319.1|  FAD-binding protein [Nocardioidaceae bact...    234   2e-69 
ref|WP_024934616.1|  glycolate oxidase subunit GlcD [Actinomad...    233   3e-69 
ref|WP_020180005.1|  hypothetical protein [Methylopila sp. M107]     233   3e-69 
gb|ADC44694.1|  glycolate oxidase D-subunit [uncultured bacter...    228   3e-69 
ref|WP_006454897.1|  FAD-binding protein [Synechococcus sp. PC...    233   4e-69 
ref|WP_026877840.1|  glycolate oxidase subunit GlcD [Jiangella...    233   5e-69 
ref|WP_018398791.1|  FAD-binding protein [filamentous cyanobac...    233   5e-69 
ref|WP_028647203.1|  glycolate oxidase subunit GlcD [Nocardiop...    233   5e-69 
ref|WP_006853435.1|  FAD-binding protein [Synechococcus sp. WH...    233   7e-69 
ref|WP_030442404.1|  glycolate oxidase subunit GlcD [Actinopla...    232   7e-69 
ref|WP_006909104.1|  FAD-binding protein [Cyanobium sp. PCC 7001]    232   8e-69 
ref|WP_015794560.1|  FAD-binding protein [Catenulispora acidip...    233   8e-69 
gb|KGA04013.1|  putative oxidase [actinobacterium acAcidi]           231   1e-68 
ref|WP_030484290.1|  glycolate oxidase subunit GlcD [Marmorico...    231   3e-68 
ref|WP_026127141.1|  glycolate oxidase subunit GlcD [Nocardiop...    231   3e-68 
ref|WP_013076558.1|  FAD-binding protein [Kyrpidia tusciae]          231   3e-68 
gb|ADC44734.1|  glycolate oxidase D-subunit [uncultured bacter...    225   4e-68 
ref|WP_011933718.1|  FAD-binding protein [Synechococcus sp. WH...    231   4e-68 
ref|WP_012888987.1|  FAD-binding protein [Streptosporangium ro...    230   5e-68 
ref|WP_026115613.1|  glycolate oxidase subunit GlcD [Nocardiop...    230   7e-68 
ref|WP_026103267.1|  glycolate oxidase subunit GlcD [Pseudanab...    230   8e-68 
ref|WP_007335612.1|  glycolate oxidase subunit GlcD [Rhodopire...    229   1e-67 
ref|WP_026847050.1|  glycolate oxidase subunit GlcD [Geodermat...    229   1e-67 
ref|WP_015622503.1|  D-lactate dehydrogenase (cytochrome) [Act...    229   2e-67 
ref|WP_026118227.1|  glycolate oxidase subunit GlcD [Nocardiop...    229   2e-67 
ref|WP_020524648.1|  FAD-binding protein [Catelliglobosispora ...    228   3e-67 
ref|WP_030904045.1|  glycolate oxidase subunit GlcD [Streptosp...    228   3e-67 
ref|WP_028637281.1|  glycolate oxidase subunit GlcD [Nocardioi...    228   4e-67 
ref|WP_010147590.1|  FAD-binding protein [Serinicoccus profundi]     228   4e-67 
ref|WP_007331567.1|  FAD-binding protein [Rhodopirellula baltica]    228   5e-67 
ref|WP_007326179.1|  FAD-binding protein [Rhodopirellula baltica]    228   5e-67 
ref|WP_014743104.1|  FAD-binding protein [Modestobacter marinus]     228   6e-67 
ref|WP_011619972.1|  FAD-binding protein [Synechococcus sp. CC...    228   6e-67 
ref|WP_011123543.1|  FAD-binding protein [Rhodopirellula baltica]    227   6e-67 
ref|WP_026123603.1|  glycolate oxidase subunit GlcD [Nocardiop...    227   9e-67 
ref|WP_008709348.1|  glycolate oxidase subunit GlcD [Rhodopire...    225   1e-66 
ref|WP_008656815.1|  glycolate oxidase subunit GlcD [Rhodopire...    226   1e-66 
ref|WP_006623002.1|  MULTISPECIES: FAD-binding protein [Arthro...    226   1e-66 
ref|WP_022608296.1|  glycolate oxidase, subunit GlcD [Rubidiba...    227   1e-66 
ref|WP_007098579.1|  FAD-binding protein [Synechococcus sp. RS...    226   2e-66 
ref|WP_012682089.1|  FAD-binding protein [Gemmatimonas auranti...    226   2e-66 
gb|KGG25239.1|  Glycolate dehydrogenase [Prochlorococcus sp. M...    225   3e-66 
ref|WP_006620312.1|  glycolate oxidase GlcD [Arthrospira plate...    225   4e-66 
gb|KGG29260.1|  Glycolate dehydrogenase [Prochlorococcus sp. M...    225   4e-66 
ref|WP_015227889.1|  glycolate oxidase subunit GlcD [Dactyloco...    225   4e-66 
ref|WP_011825363.1|  FAD-binding protein [Prochlorococcus mari...    225   4e-66 
ref|WP_013335649.1|  glycolate oxidase [Vulcanisaeta distributa]     224   5e-66 
ref|WP_022920716.1|  FAD-binding protein [Ornithinimicrobium p...    224   8e-66 
ref|WP_011130664.1|  FAD-binding protein [Prochlorococcus mari...    224   9e-66 
ref|WP_011936064.1|  FAD-binding protein [Synechococcus sp. RC...    224   1e-65 
ref|WP_002647954.1|  FAD-binding protein [Planctomyces maris]        224   2e-65 
ref|WP_013604568.1|  glycolate oxidase [Vulcanisaeta moutnovskia]    223   2e-65 
ref|WP_012911580.1|  FAD-binding protein [Pirellula staleyi]         223   2e-65 
ref|WP_013110938.1|  FAD-binding protein [Planctomyces limnoph...    223   3e-65 
ref|WP_011128668.1|  FAD-binding protein [Synechococcus sp. WH...    223   4e-65 
ref|WP_010581834.1|  FAD-binding protein [Schlesneria paludicola]    222   5e-65 
gb|KGH46105.1|  glycolate oxidase subunit GlcD [Modestobacter ...    222   6e-65 
ref|WP_017557059.1|  FAD-binding protein [Nocardiopsis baichen...    222   7e-65 
ref|WP_017536713.1|  FAD-binding protein [Nocardiopsis halophila]    222   8e-65 
ref|WP_015745702.1|  FAD-binding protein [Candidatus Methylomi...    222   8e-65 
ref|WP_029626184.1|  glycolate oxidase subunit GlcD [Synechoco...    221   1e-64 
ref|WP_028131135.1|  glycolate oxidase subunit GlcD [Serinicoc...    221   2e-64 
ref|WP_029553063.1|  glycolate oxidase subunit GlcD [Synechoco...    220   4e-64 
ref|WP_026723524.1|  glycolate oxidase subunit GlcD [Fischerel...    220   4e-64 
gb|AII42712.1|  FAD-binding protein [Synechococcus sp. KORDI-100]    219   7e-64 
ref|WP_028951420.1|  glycolate oxidase subunit GlcD [Synechoco...    219   1e-63 
ref|WP_017313629.1|  FAD-binding protein [Fischerella sp. PCC ...    219   1e-63 
ref|WP_006169745.1|  putative glycolate oxidase subunit GlcD [...    214   1e-63 
gb|EPN67030.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    208   1e-63 
ref|WP_023064051.1|  glycolate oxidase, subunit GlcD [Lyngbya ...    218   2e-63 
dbj|GAK13243.1|  LOW QUALITY PROTEIN: glycolate dehydrogenase,...    218   2e-63 
gb|EQU20859.1|  glycolate oxidase subunit glcD [Escherichia co...    207   3e-63 
ref|WP_011360468.1|  FAD-binding protein [Synechococcus sp. CC...    217   4e-63 
ref|WP_007101813.1|  FAD-binding protein [Synechococcus sp. RS...    217   4e-63 
dbj|GAK04916.1|  LOW QUALITY PROTEIN: glycolate dehydrogenase,...    217   4e-63 
gb|AII47187.1|  FAD-binding protein [Synechococcus sp. KORDI-49]     217   5e-63 
ref|WP_010050226.1|  FAD-binding protein [Gemmata obscuriglobus]     217   5e-63 
ref|WP_011958064.1|  FAD-binding protein [Roseiflexus sp. RS-1]      216   1e-62 
gb|AHF63105.1|  putative glycolate oxidase subunit GlcD [Synec...    216   1e-62 
ref|WP_026120540.1|  glycolate oxidase subunit GlcD [Nocardiop...    216   2e-62 
ref|WP_030008310.1|  glycolate oxidase subunit GlcD [Synechoco...    214   2e-62 
ref|WP_015940647.1|  FAD-binding protein [Chloroflexus aggregans]    215   3e-62 
ref|WP_011363662.1|  FAD-binding protein [Synechococcus sp. CC...    215   3e-62 
ref|WP_007913277.1|  D-lactate dehydrogenase (cytochrome) [Kte...    220   4e-62 
ref|WP_028458175.1|  glycolate oxidase subunit GlcD [Chlorofle...    214   5e-62 
ref|WP_013020211.1|  FAD-binding protein [Stackebrandtia nassa...    214   6e-62 
ref|WP_012122598.1|  FAD-binding protein [Roseiflexus castenho...    214   7e-62 
ref|WP_015442199.1|  putative oxidase [Ilumatobacter coccineus]      214   8e-62 
ref|WP_009789217.1|  FAD-binding protein [Synechococcus sp. BL...    213   1e-61 
gb|AHG90062.1|  FAD linked oxidase domain protein [Gemmatimona...    212   3e-61 
ref|WP_014347360.1|  glycolate oxidase [Pyrobaculum oguniense]       212   3e-61 
ref|WP_020475142.1|  hypothetical protein [Zavarzinella formosa]     211   6e-61 
ref|WP_011849902.1|  glycolate oxidase [Pyrobaculum calidifontis]    210   1e-60 
ref|WP_011007847.1|  glycolate oxidase [Pyrobaculum aerophilum]      210   2e-60 
gb|AII50173.1|  FAD-binding protein [Synechococcus sp. KORDI-52]     209   3e-60 
ref|WP_028308636.1|  hypothetical protein [Desulfitibacter alk...    208   6e-60 
ref|WP_011899992.1|  glycolate oxidase [Pyrobaculum arsenaticum]     208   1e-59 
gb|EPN42503.1|  glycolate oxidase subunit GlcD [Pseudomonas sy...    196   3e-59 
ref|WP_012414231.1|  putative glycolate oxidase [Elusimicrobiu...    210   4e-59 
ref|WP_006563278.1|  FAD-binding protein [Oscillochloris trich...    206   5e-59 
ref|WP_015798772.1|  FAD-binding protein [Acidimicrobium ferro...    206   8e-59 
ref|WP_018196437.1|  MULTISPECIES: hypothetical protein [Fervi...    206   9e-59 
ref|WP_011248871.1|  FAD-binding protein [Bacillus clausii]          205   9e-59 
ref|WP_013564736.1|  FAD-binding protein [Isosphaera pallida]        206   1e-58 
ref|WP_007288815.1|  FAD-binding protein [Thermosinus carboxyd...    204   2e-58 
ref|WP_011956353.1|  lactate dehydrogenase [Roseiflexus sp. RS-1]    210   2e-58 
ref|WP_012660620.1|  FAD-binding protein [Chloroflexus sp. Y-4...    204   2e-58 
ref|WP_012257031.1|  FAD-binding protein [Chloroflexus auranti...    204   2e-58 
ref|WP_012257998.1|  MULTISPECIES: FAD-binding protein [Chloro...    204   3e-58 
gb|ABI29730.1|  GlcD [uncultured marine bacterium]                   199   4e-58 
ref|WP_031459293.1|  glycolate oxidase subunit GlcD [Chlorofle...    204   5e-58 
ref|WP_014431925.1|  glycolate oxidase subunit GlcD [Caldiline...    209   5e-58 
ref|WP_014183613.1|  FAD/FMN-dependent dehydrogenase [Desulfos...    209   6e-58 
ref|WP_014345120.1|  lactate dehydrogenase [Sulfobacillus acid...    208   6e-58 
ref|WP_028308956.1|  FAD-binding protein [Desulfitibacter alka...    203   6e-58 
ref|WP_028458728.1|  glycolate oxidase subunit GlcD [Chlorofle...    203   6e-58 
ref|WP_026104961.1|  FAD-binding protein [Bacillus sp. L1(2012)]     203   7e-58 
ref|WP_026580902.1|  FAD-binding protein [Bacillus sp. J33]          203   7e-58 
ref|WP_013986513.1|  lactate dehydrogenase [Sulfobacillus acid...    208   7e-58 
gb|AHF08113.1|  FAD-binding protein [Desulfitobacterium metall...    203   8e-58 
gb|ADC44581.1|  glycolate oxidase D-subunit [uncultured bacter...    198   9e-58 
ref|WP_018922079.1|  hypothetical protein [Salsuginibacillus k...    202   9e-58 
gb|ABI29254.1|  GlcD [uncultured marine bacterium]                   197   2e-57 
gb|ABI29771.1|  GlcD [uncultured marine bacterium]                   197   2e-57 
ref|WP_009615384.1|  FAD-binding protein [Desulfosporosinus sp...    201   3e-57 
ref|WP_015940293.1|  FAD-binding protein [Chloroflexus aggregans]    201   4e-57 
gb|ABI29667.1|  GlcD [uncultured marine bacterium]                   196   4e-57 
gb|ABI29566.1|  GlcD [uncultured marine bacterium]                   196   4e-57 
gb|ABI29759.1|  GlcD [uncultured marine bacterium]                   196   5e-57 
ref|WP_012121903.1|  lactate dehydrogenase [Roseiflexus casten...    206   8e-57 
ref|WP_029521535.1|  FAD-binding protein [Persephonella sp. IF...    200   8e-57 
ref|WP_033102282.1|  FAD-binding protein [bacterium H-18]            200   1e-56 
ref|WP_014185421.1|  FAD-binding protein [Desulfosporosinus or...    200   1e-56 
ref|WP_025773627.1|  hypothetical protein [Moorella thermoacet...    199   1e-56 
gb|ENH18823.1|  FAD linked oxidase, C-terminal domain protein ...    197   1e-56 
ref|WP_029522051.1|  FAD-binding protein [Persephonella sp. KM...    199   1e-56 
ref|WP_015245003.1|  FAD-binding protein [Singulisphaera acidi...    200   1e-56 
ref|WP_011393791.1|  FAD-binding protein [Moorella thermoacetica]    199   2e-56 
gb|ABI29450.1|  GlcD [uncultured marine bacterium]                   195   2e-56 
ref|WP_031459060.1|  glycolate oxidase subunit GlcD [Chlorofle...    199   2e-56 
gb|AFL45649.1|  glycolate oxidase D-subunit [uncultured bacter...    192   2e-56 
ref|WP_014289840.1|  glycolate oxidase [Pyrobaculum sp. 1860]        199   3e-56 
gb|ADC44570.1|  glycolate oxidase D-subunit [uncultured bacter...    194   3e-56 
gb|EZQ11248.1|  FAD-linked oxidase [Candidatus Acidianus copah...    198   4e-56 
gb|AFL45653.1|  glycolate oxidase D-subunit [uncultured bacter...    192   5e-56 
gb|AHF07967.1|  FAD/FMN-dependent dehydrogenase [Desulfitobact...    197   6e-56 
gb|ABI29426.1|  GlcD [uncultured marine bacterium]                   193   8e-56 
gb|AFL45663.1|  glycolate oxidase D-subunit [uncultured bacter...    191   1e-55 
gb|AFL45661.1|  glycolate oxidase D-subunit [uncultured bacter...    191   1e-55 
gb|AFL45662.1|  glycolate oxidase D-subunit [uncultured bacter...    191   1e-55 
gb|AFL45660.1|  glycolate oxidase D-subunit [uncultured bacter...    191   1e-55 
gb|AFL45666.1|  glycolate oxidase D-subunit [uncultured bacter...    191   1e-55 
gb|AFL45651.1|  glycolate oxidase D-subunit [uncultured bacter...    191   1e-55 
emb|CBA32371.1|  Glycolate oxidase subunit glcD [Curvibacter p...    199   1e-55 
ref|WP_013824155.1|  FAD-binding protein [Desulfotomaculum kuz...    197   1e-55 
ref|WP_007358930.1|  FAD-binding protein [Opitutaceae bacteriu...    197   2e-55 
gb|KGK91672.1|  FAD-binding protein [Desulfosporosinus sp. HMP52]    196   2e-55 
gb|AFL45646.1|  glycolate oxidase D-subunit [uncultured bacter...    190   2e-55 
gb|ADC44593.1|  glycolate oxidase D-subunit [uncultured bacter...    192   2e-55 
gb|ADC44595.1|  glycolate oxidase D-subunit [uncultured bacter...    192   2e-55 
gb|ADC44592.1|  glycolate oxidase D-subunit [uncultured bacter...    192   2e-55 
gb|ABI29700.1|  GlcD [uncultured marine bacterium]                   192   2e-55 
ref|WP_003332858.1|  glycolate oxidase subunit [Bacillus azoto...    196   2e-55 
gb|AFL45645.1|  glycolate oxidase D-subunit [uncultured bacter...    190   2e-55 
gb|ADC44594.1|  glycolate oxidase D-subunit [uncultured bacter...    192   2e-55 
gb|ADC44587.1|  glycolate oxidase D-subunit [uncultured bacter...    192   2e-55 
gb|AHF93153.1|  FAD-binding protein [Opitutaceae bacterium TAV5]     196   3e-55 
ref|WP_007780178.1|  FAD-binding protein [Desulfosporosinus yo...    196   3e-55 
gb|ADC44571.1|  glycolate oxidase D-subunit [uncultured bacter...    192   3e-55 
ref|WP_009071781.1|  FAD-linked oxidase [Metallosphaera yellow...    196   3e-55 
ref|WP_010980381.1|  FAD-linked oxidase [Sulfolobus tokodaii]        196   3e-55 
gb|ABI29785.1|  GlcD [uncultured marine bacterium]                   191   4e-55 
gb|ADC44590.1|  glycolate oxidase D-subunit [uncultured bacter...    191   4e-55 
gb|AFL45767.1|  glycolate oxidase D-subunit [uncultured bacter...    189   4e-55 
gb|ADC44576.1|  glycolate oxidase D-subunit [uncultured bacter...    191   4e-55 
gb|ADC44574.1|  glycolate oxidase D-subunit [uncultured bacter...    191   4e-55 
ref|WP_014183601.1|  FAD-binding protein [Desulfosporosinus or...    196   4e-55 
gb|ABI29735.1|  GlcD [uncultured marine bacterium]                   191   5e-55 
gb|AIE85106.1|  glycolate oxidase subunit [Fimbriimonas ginsen...    196   5e-55 
gb|ABI29307.1|  GlcD [uncultured marine bacterium]                   191   5e-55 
gb|AFL45664.1|  glycolate oxidase D-subunit [uncultured bacter...    189   5e-55 
gb|ADC44591.1|  glycolate oxidase D-subunit [uncultured bacter...    191   5e-55 
gb|ADC44572.1|  glycolate oxidase D-subunit [uncultured bacter...    191   5e-55 
ref|WP_013738139.1|  FAD-linked oxidase [Metallosphaera cuprina]     195   5e-55 
ref|WP_027371517.1|  FAD-binding protein [Desulfovermiculus ha...    195   6e-55 
ref|WP_007612966.1|  MULTISPECIES: FAD-binding protein [Bacillus]    195   7e-55 
gb|KEF40000.1|  FAD/FMN-dependent dehydrogenase [Bacillus azot...    194   9e-55 
ref|WP_014826788.1|  FAD-binding protein [Desulfosporosinus ac...    194   1e-54 
ref|WP_014902684.1|  FAD-binding protein [Desulfosporosinus me...    194   1e-54 
ref|WP_007408109.1|  MULTISPECIES: FAD-binding protein [Bacillus]    194   1e-54 
ref|WP_015417962.1|  MULTISPECIES: glycolate oxidase subunit [...    194   1e-54 
ref|WP_015240340.1|  hypothetical protein [Bacillus amylolique...    194   1e-54 
ref|WP_012717156.1|  FAD-linked oxidase [Sulfolobus islandicus]      194   1e-54 
ref|WP_029097685.1|  FAD-binding protein [Brevibacillus thermo...    194   1e-54 
gb|AFL45647.1|  glycolate oxidase D-subunit [uncultured bacter...    188   1e-54 
gb|AHZ16888.1|  glycolate oxidase subunit GlcD [Bacillus amylo...    194   1e-54 
ref|WP_012712168.1|  FAD-linked oxidase [Sulfolobus islandicus]      194   1e-54 
gb|KGK82250.1|  FAD-binding protein [Desulfosporosinus sp. HMP52]    194   2e-54 
gb|AFL45644.1|  glycolate oxidase D-subunit [uncultured bacter...    187   2e-54 
gb|ABI29258.1|  GlcD [uncultured marine bacterium]                   189   2e-54 
ref|WP_007785211.1|  FAD-binding protein [Desulfosporosinus yo...    194   2e-54 
gb|AFL45652.1|  glycolate oxidase D-subunit [uncultured bacter...    187   3e-54 
gb|AFL45700.1|  glycolate oxidase D-subunit [uncultured bacter...    187   3e-54 
gb|AFL45650.1|  glycolate oxidase D-subunit [uncultured bacter...    187   3e-54 
ref|WP_012953161.1|  FAD-linked oxidase [Sulfolobus islandicus]      193   3e-54 
ref|WP_009989971.1|  FAD-linked oxidase [Sulfolobus solfataricus]    193   3e-54 
ref|WP_015751477.1|  FAD-binding protein [Desulfohalobium retb...    193   3e-54 
ref|WP_009059727.1|  FAD-binding protein [Methylacidiphilum fu...    193   3e-54 
ref|WP_012716557.1|  FAD-linked oxidase [Sulfolobus islandicus]      193   3e-54 
ref|WP_022720126.1|  FAD-binding protein [Rhodopseudomonas sp....    191   3e-54 
ref|WP_014822995.1|  FAD-binding protein [Solibacillus silvest...    193   4e-54 
ref|WP_014512987.1|  FAD-linked oxidase [Sulfolobus islandicus]      193   4e-54 
gb|AFL45630.1|  glycolate oxidase D-subunit [uncultured bacter...    187   5e-54 
ref|WP_014902033.1|  FAD-binding protein [Desulfosporosinus me...    192   5e-54 
ref|WP_021494418.1|  MULTISPECIES: FAD-binding protein [Bacill...    193   6e-54 
gb|ADC44575.1|  glycolate oxidase D-subunit [uncultured bacter...    188   6e-54 
gb|ADC44573.1|  glycolate oxidase D-subunit [uncultured bacter...    188   6e-54 
gb|AFL45648.1|  glycolate oxidase D-subunit [uncultured bacter...    186   7e-54 
ref|WP_012676767.1|  FAD-binding protein [Persephonella marina]      192   7e-54 
ref|WP_014418590.1|  MULTISPECIES: FAD-binding protein [Bacill...    192   8e-54 
ref|WP_029967856.1|  FAD-binding protein [Desulfonauticus sp. ...    192   8e-54 
gb|AFL45611.1|  glycolate oxidase D-subunit [uncultured bacter...    186   8e-54 
gb|ADC44588.1|  glycolate oxidase D-subunit [uncultured bacter...    187   1e-53 
ref|WP_032873749.1|  FAD-binding protein [Bacillus amyloliquef...    192   1e-53 
ref|WP_012020516.1|  FAD-linked oxidase [Metallosphaera sedula]      192   1e-53 
ref|WP_013842628.1|  FAD-binding protein [Desulfotomaculum rum...    192   1e-53 
ref|WP_014795617.1|  FAD-binding protein [Desulfitobacterium d...    192   1e-53 
ref|WP_008406031.1|  FAD-binding protein [Bacillus isronensis]       192   1e-53 
ref|WP_013514017.1|  FAD-binding protein [Desulfovibrio aespoe...    192   1e-53 
ref|WP_025853192.1|  FAD-binding protein [Bacillus amyloliquef...    192   1e-53 
ref|WP_012714267.1|  FAD-linked oxidase [Sulfolobus islandicus]      192   1e-53 
ref|WP_003152523.1|  FAD-binding protein [Bacillus amyloliquef...    192   1e-53 
ref|WP_012118139.1|  FAD-binding protein [Bacillus amyloliquef...    192   1e-53 
ref|WP_025649707.1|  FAD-binding protein [Bacillus methylotrop...    192   2e-53 
ref|WP_017418316.1|  FAD-binding protein [Bacillus amyloliquef...    191   2e-53 
gb|AFL45634.1|  glycolate oxidase D-subunit [uncultured bacter...    185   2e-53 
gb|AFL45697.1|  glycolate oxidase D-subunit [uncultured bacter...    185   2e-53 
ref|WP_015387877.1|  FAD-binding protein [Bacillus amyloliquef...    191   2e-53 
ref|WP_014305545.1|  FAD-binding protein [Bacillus amyloliquef...    191   2e-53 
ref|WP_019851373.1|  FAD-binding protein [Desulfitobacterium s...    191   2e-53 
ref|WP_031379157.1|  FAD-binding protein [Bacillus amyloliquef...    191   2e-53 
gb|AFL45633.1|  glycolate oxidase D-subunit [uncultured bacter...    185   2e-53 
ref|WP_020956174.1|  glycolate oxidase subunit [Bacillus amylo...    191   2e-53 
gb|AFL45702.1|  glycolate oxidase D-subunit [uncultured bacter...    185   2e-53 
ref|WP_024082959.1|  FAD-linked oxidase [Sulfolobus acidocalda...    191   2e-53 
gb|ABI29306.1|  GlcD [uncultured marine bacterium]                   187   2e-53 
gb|ADC44589.1|  glycolate oxidase D-subunit [uncultured bacter...    187   2e-53 
gb|AFL45699.1|  glycolate oxidase D-subunit [uncultured bacter...    185   2e-53 
ref|WP_015263454.1|  FAD/FMN-dependent dehydrogenase [Desulfit...    191   2e-53 
ref|WP_015263601.1|  FAD-binding protein [Desulfitobacterium d...    191   3e-53 
gb|AFL45701.1|  glycolate oxidase D-subunit [uncultured bacter...    184   3e-53 
gb|AAY81765.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
gb|ABI29348.1|  GlcD [uncultured marine bacterium]                   186   3e-53 
gb|AAY81760.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
gb|AAY81848.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
gb|AAY81736.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
gb|AAY81764.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
ref|WP_028951289.1|  FAD-binding protein [Sulfurihydrogenibium...    191   3e-53 
gb|AAY81844.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
gb|AAY81868.1|  putative GlcD [uncultured marine bacterium]          186   3e-53 
gb|AAY81756.1|  putative GlcD [uncultured marine bacterium]          186   4e-53 
gb|AAY81851.1|  putative GlcD [uncultured marine bacterium]          186   4e-53 
gb|AAY81768.1|  putative GlcD [uncultured marine bacterium]          186   4e-53 
gb|KGB28597.1|  FAD-binding protein [Bacillus coagulans]             191   4e-53 
ref|WP_016938644.1|  FAD-binding protein [Bacillus siamensis]        191   4e-53 
gb|AAY81842.1|  putative GlcD [uncultured marine bacterium]          186   4e-53 
ref|WP_031263565.1|  FAD-binding protein [Sporolactobacillus l...    191   4e-53 
gb|AAY81866.1|  putative GlcD [uncultured marine bacterium]          186   4e-53 
gb|AFL45609.1|  glycolate oxidase D-subunit [uncultured bacter...    184   4e-53 
ref|WP_013625666.1|  D-lactate dehydrogenase [Syntrophobotulus...    191   4e-53 
ref|WP_017798043.1|  FAD-binding protein [Oceanobacillus kimchii]    190   5e-53 
gb|AFL45607.1|  glycolate oxidase D-subunit [uncultured bacter...    184   5e-53 
gb|EST13610.1|  FAD-binding protein [Sporolactobacillus laevol...    191   5e-53 
ref|WP_014260252.1|  FAD-binding protein [Desulfovibrio africa...    190   5e-53 
gb|AFL45612.1|  glycolate oxidase D-subunit [uncultured bacter...    184   5e-53 
ref|WP_011277126.1|  FAD-linked oxidase [Sulfolobus acidocalda...    190   5e-53 
gb|AAY81762.1|  putative GlcD [uncultured marine bacterium]          186   5e-53 
ref|WP_015385383.1|  glycolate oxidase subunit [Sulfolobus aci...    190   5e-53 
ref|WP_005987517.1|  FAD/FMN-dependent dehydrogenase [Desulfov...    190   6e-53 
ref|WP_011067228.1|  FAD-binding protein [Oceanobacillus iheye...    190   6e-53 
ref|WP_026683221.1|  FAD-binding protein [Bacillus coagulans]        190   6e-53 
ref|WP_005817128.1|  FAD-binding protein [Desulfitobacterium h...    190   6e-53 
ref|WP_014097947.1|  FAD-binding protein [Bacillus coagulans]        190   6e-53 
gb|AFL45692.1|  glycolate oxidase D-subunit [uncultured bacter...    184   6e-53 
ref|WP_015050139.1|  FAD-binding protein [Thermacetogenium pha...    190   6e-53 
ref|WP_028396780.1|  FAD-binding protein [Bacillus sp. FJAT-14...    190   7e-53 
ref|WP_011344207.1|  glycolate oxidase subunit GlcD [Carboxydo...    189   7e-53 
gb|AAY81849.1|  putative GlcD [uncultured marine bacterium]          186   7e-53 
ref|WP_020198779.1|  hypothetical protein [Sulfolobales archae...    190   7e-53 
gb|KEK23569.1|  FAD-binding protein [Bacillus gaemokensis]           190   7e-53 
ref|WP_005816912.1|  putative glycolate oxidase, subunit GlcD ...    189   8e-53 
gb|AAY81735.1|  putative GlcD [uncultured marine bacterium]          185   8e-53 
ref|WP_019553400.1|  FAD-binding protein [Zymophilus raffinosi...    189   8e-53 
ref|WP_028051500.1|  FAD-binding protein [Carboxydothermus fer...    189   8e-53 
gb|AFL45695.1|  glycolate oxidase D-subunit [uncultured bacter...    183   9e-53 
gb|AAY81770.1|  putative GlcD [uncultured marine bacterium]          185   9e-53 
ref|WP_011343369.1|  FAD-binding protein [Carboxydothermus hyd...    189   9e-53 
gb|AAY81746.1|  putative GlcD [uncultured marine bacterium]          185   1e-52 
ref|WP_013824018.1|  FAD-binding protein [Desulfotomaculum kuz...    189   1e-52 
ref|WP_012673750.1|  FAD-binding protein [Sulfurihydrogenibium...    189   1e-52 
gb|AAY81839.1|  putative GlcD [uncultured marine bacterium]          185   1e-52 
ref|WP_028399394.1|  FAD-binding protein [Bacillus panaciterrae]     189   1e-52 
gb|AAY81840.1|  putative GlcD [uncultured marine bacterium]          184   1e-52 
ref|WP_013353120.1|  FAD-binding protein [Bacillus amyloliquef...    189   2e-52 
gb|AAY81858.1|  putative GlcD [uncultured marine bacterium]          184   2e-52 
gb|AAY81742.1|  putative GlcD [uncultured marine bacterium]          184   2e-52 
ref|WP_013756765.1|  FAD-binding protein [Thermodesulfobium na...    189   2e-52 
ref|WP_024535520.1|  FAD-binding protein [Sporosarcina sp. EUR...    189   2e-52 
ref|WP_010191628.1|  FAD-binding protein [Bacillus sp. m3-13]        189   2e-52 
ref|WP_027965331.1|  FAD-binding protein [Halalkalibacillus ha...    189   2e-52 
ref|WP_008429278.1|  FAD-binding protein [Planococcus donghaen...    189   2e-52 
gb|AAY81739.1|  putative GlcD [uncultured marine bacterium]          184   2e-52 
ref|WP_019721082.1|  FAD-binding protein [Bacillus coagulans]        188   2e-52 
ref|WP_029141920.1|  FAD-binding protein [Bacillus coagulans]        188   3e-52 
ref|WP_015723115.1|  FAD-binding protein [Desulfobulbus propio...    188   3e-52 
gb|EWS64395.1|  putative FAD-linked oxidoreductase [Hydrogenop...    179   3e-52 
ref|WP_014472159.1|  FAD-binding protein [Bacillus amyloliquef...    188   3e-52 
ref|WP_018706423.1|  hypothetical protein [Bacillus fordii]          188   4e-52 
ref|WP_018084332.1|  FAD-binding protein [Desulfurispora therm...    187   4e-52 
gb|AAY81750.1|  putative GlcD [uncultured marine bacterium]          184   4e-52 
gb|ABI29446.1|  GlcD [uncultured marine bacterium]                   183   4e-52 
ref|WP_014795501.1|  MULTISPECIES: FAD/FMN-dependent dehydroge...    187   4e-52 
gb|AFL45693.1|  glycolate oxidase D-subunit [uncultured bacter...    182   4e-52 
gb|KFZ41031.1|  FAD-binding protein [Thermoactinomyces sp. Gus...    187   5e-52 
gb|AFL45608.1|  glycolate oxidase D-subunit [uncultured bacter...    181   5e-52 
ref|WP_000890752.1|  MULTISPECIES: FAD-binding protein [Bacillus]    187   5e-52 
gb|AAY81741.1|  putative GlcD [uncultured marine bacterium]          183   5e-52 
ref|WP_000890751.1|  FAD-binding protein [Bacillus cereus]           187   5e-52 
ref|WP_009618298.1|  FAD-binding protein [Desulfosporosinus sp...    187   5e-52 
ref|WP_018123842.1|  FAD-binding protein [Desulfovibrio oxycli...    187   5e-52 
gb|AFL45632.1|  glycolate oxidase D-subunit [uncultured bacter...    181   5e-52 
ref|WP_018661363.1|  FAD-binding protein [Bacillus acidiproduc...    187   6e-52 
gb|AIH04506.1|  FAD-binding protein [Thermodesulfobacterium co...    187   6e-52 
gb|AAY81856.1|  putative GlcD [uncultured marine bacterium]          183   7e-52 
ref|WP_012033380.1|  FAD-binding protein [Pelotomaculum thermo...    187   8e-52 
ref|WP_026264069.1|  FAD-binding protein [Paenibacillus terrig...    187   8e-52 
ref|WP_028571024.1|  FAD-binding protein [Desulfonatronum lacu...    187   9e-52 
gb|AAY81737.1|  putative GlcD [uncultured marine bacterium]          182   1e-51 
ref|WP_017185947.1|  hypothetical protein [Alkalibacillus halo...    187   1e-51 
ref|WP_016088803.1|  glycolate oxidase subunit glcD [Bacillus ...    187   1e-51 
ref|WP_000890753.1|  FAD-binding protein [Bacillus cereus]           187   1e-51 
gb|EST54868.1|  FAD-binding protein [Brevibacillus panacihumi ...    187   1e-51 
ref|WP_008410271.1|  Glycolate oxidase subunit glcD [Desulfoto...    186   1e-51 
ref|WP_016716934.1|  FAD-binding protein [Bacillus cereus]           187   1e-51 
ref|WP_016117443.1|  glycolate oxidase subunit glcD [Bacillus ...    186   1e-51 
ref|WP_031305534.1|  FAD-binding protein [Brevibacillus panaci...    186   1e-51 
ref|WP_016093029.1|  glycolate oxidase subunit glcD [Bacillus ...    186   1e-51 
gb|AFL45610.1|  glycolate oxidase D-subunit [uncultured bacter...    180   1e-51 
ref|WP_025967034.1|  FAD-binding protein [Bacillus cereus]           186   1e-51 
ref|WP_027718046.1|  FAD-binding protein [Desulfovirgula therm...    186   1e-51 
ref|WP_000890754.1|  MULTISPECIES: FAD-binding protein [Bacill...    186   1e-51 
ref|WP_000890767.1|  FAD-binding protein [Bacillus cereus]           186   1e-51 
ref|WP_030024122.1|  FAD-binding protein [Bacillus thuringiensis]    186   2e-51 
gb|AIC94177.1|  glycolate oxidase subunit glcD [Bacillus lehen...    186   2e-51 
ref|WP_026038970.1|  FAD-binding protein [Sporolactobacillus v...    186   2e-51 
ref|WP_003540134.1|  MULTISPECIES: FAD-binding protein [Desulf...    186   2e-51 
ref|WP_002135079.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_022662463.1|  FAD-binding protein [Desulfovibrio longus]      186   2e-51 
ref|WP_002064350.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890732.1|  FAD-binding protein [Bacillus thuringiensis]    186   2e-51 
ref|WP_000890731.1|  FAD-binding protein [Bacillus thuringiensis]    186   2e-51 
ref|WP_000890743.1|  MULTISPECIES: FAD-binding protein [Bacill...    186   2e-51 
gb|AIE78640.1|  Glycolate dehydrogenase , subunit GlcD [Bacill...    186   2e-51 
ref|WP_001973091.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_016094509.1|  glycolate oxidase subunit glcD [Bacillus ...    186   2e-51 
ref|WP_000890729.1|  MULTISPECIES: FAD-binding protein [Bacillus]    186   2e-51 
ref|WP_010898878.1|  FAD-binding protein [Bacillus halodurans]       186   2e-51 
ref|WP_016128976.1|  glycolate oxidase subunit glcD [Bacillus ...    186   2e-51 
ref|WP_028317111.1|  FAD-binding protein [Desulfobulbus elonga...    186   2e-51 
ref|WP_029437928.1|  FAD-binding protein [Bacillus thuringiensis]    186   2e-51 
ref|WP_000890762.1|  MULTISPECIES: FAD-binding protein [Bacill...    186   2e-51 
ref|WP_000890740.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890742.1|  MULTISPECIES: FAD-binding protein [Bacill...    186   2e-51 
ref|WP_002117272.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890727.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890737.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_020616844.1|  FAD-binding protein [Paenibacillus daejeo...    186   2e-51 
ref|WP_026682781.1|  FAD-binding protein [Bacillus megaterium]       186   2e-51 
ref|WP_002158763.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_002188861.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_002168855.1|  MULTISPECIES: FAD-binding protein [Bacill...    186   2e-51 
ref|WP_000890735.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_002170946.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890733.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_002140913.1|  MULTISPECIES: FAD-binding protein [Bacill...    186   2e-51 
ref|WP_001990937.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890728.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
gb|AIM05205.1|  glycolate oxidase, subunit GlcD [Bacillus anth...    185   2e-51 
ref|WP_002086858.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_002201271.1|  FAD-binding protein [Bacillus cereus]           186   2e-51 
ref|WP_000890745.1|  FAD-binding protein [Bacillus cereus]           186   3e-51 
ref|WP_013630647.1|  FAD-binding protein [Planctomyces brasili...    186   3e-51 
ref|WP_002030532.1|  FAD-binding protein [Bacillus cereus]           186   3e-51 
ref|WP_016133936.1|  glycolate oxidase subunit glcD [Bacillus ...    186   3e-51 
ref|WP_002011598.1|  FAD-binding protein [Bacillus cereus]           186   3e-51 
ref|WP_014186519.1|  FAD/FMN-dependent dehydrogenase [Desulfos...    186   3e-51 
ref|WP_007087683.1|  glycolate oxidase subunit [Bacillus batav...    186   3e-51 
ref|WP_000890747.1|  FAD-binding protein [Bacillus cereus]           186   3e-51 
dbj|GAJ44902.1|  putative FAD linked oxidase [Geobacillus ther...    186   3e-51 
ref|WP_000890738.1|  FAD-binding protein [Bacillus cereus]           186   3e-51 
ref|WP_009672147.1|  MULTISPECIES: FAD-binding protein [Paenib...    186   3e-51 
ref|WP_000890764.1|  FAD-binding protein [Bacillus cereus]           186   3e-51 
ref|WP_015592865.1|  FAD-binding protein [Bacillus sp. 1NLA3E]       186   3e-51 
ref|WP_014901739.1|  FAD-binding protein [Desulfosporosinus me...    185   3e-51 
gb|AFL45698.1|  glycolate oxidase D-subunit [uncultured bacter...    179   3e-51 
ref|WP_010789426.1|  Glycolate dehydrogenase subunit GlcD [Bac...    185   3e-51 
ref|WP_016104233.1|  glycolate oxidase subunit glcD [Bacillus ...    185   4e-51 
ref|WP_000890750.1|  FAD-binding protein [Bacillus cereus]           185   4e-51 
ref|WP_003325166.1|  FAD-binding protein [Bacillus atrophaeus]       185   4e-51 
ref|WP_015416428.1|  Glycolate oxidase subunit glcD [Desulfovi...    185   4e-51 
ref|WP_027357618.1|  FAD-binding protein [Desulfotomaculum the...    185   4e-51 
gb|EKE02824.1|  hypothetical protein ACD_20C00328G0017 [uncult...    185   4e-51 
ref|WP_013859720.1|  FAD-binding protein [Bacillus coagulans]        185   4e-51 
ref|WP_013756210.1|  FAD-binding protein [Thermodesulfobium na...    185   5e-51 
ref|WP_007545621.1|  FAD-binding protein [Sulfurihydrogenibium...    185   5e-51 
ref|WP_016119850.1|  glycolate oxidase subunit glcD [Bacillus ...    185   5e-51 
ref|WP_014477604.1|  FAD-binding protein [Bacillus subtilis]         185   5e-51 
ref|WP_016109580.1|  glycolate oxidase subunit glcD [Bacillus ...    185   5e-51 
gb|KGK91196.1|  lactate dehydrogenase [Desulfosporosinus sp. H...    184   5e-51 
ref|WP_011984097.1|  FAD-binding protein [Bacillus cytotoxicus]      185   5e-51 
gb|EZP78473.1|  glycolate oxidase subunit GlcD [Geobacillus st...    185   5e-51 
ref|WP_000890761.1|  FAD-binding protein [Bacillus cereus]           185   6e-51 
ref|WP_014370634.1|  FAD-binding protein [Paenibacillus mucila...    185   6e-51 
ref|WP_013918217.1|  FAD-binding protein [Paenibacillus mucila...    185   6e-51 
gb|KGK87116.1|  FAD-binding protein [Desulfosporosinus sp. HMP52]    184   6e-51 
ref|WP_000890730.1|  FAD-binding protein [Bacillus anthracis]        184   6e-51 
ref|WP_014182737.1|  FAD/FMN-dependent dehydrogenase [Desulfos...    184   6e-51 
ref|WP_000890763.1|  MULTISPECIES: FAD-binding protein [Bacill...    184   7e-51 
ref|WP_000890734.1|  FAD-binding protein [Bacillus cereus]           184   7e-51 
dbj|GAF21386.1|  LOW QUALITY PROTEIN: FAD/FMN-containing dehyd...    184   7e-51 
ref|WP_004098107.1|  glycolate oxidase subunit [Acetonema longum]    184   7e-51 
ref|WP_014825312.1|  FAD/FMN-dependent dehydrogenase [Desulfos...    184   7e-51 
ref|WP_026690557.1|  FAD-binding protein [Bacillus aurantiacus]      184   8e-51 
ref|WP_007524858.1|  FAD-binding protein [Desulfovibrio sp. A2]      184   8e-51 
gb|ETW91995.1|  hypothetical protein ETSY1_45765 [Candidatus E...    177   8e-51 
ref|WP_000893070.1|  FAD-binding protein [Bacillus cereus]           184   9e-51 
ref|WP_012281569.1|  FAD-binding protein [Heliobacterium modes...    184   9e-51 
ref|WP_002149686.1|  FAD-binding protein [Bacillus cereus]           184   9e-51 
ref|WP_031388755.1|  FAD-binding protein [Desulfonatronum thio...    184   9e-51 
ref|WP_018764150.1|  FAD-binding protein [Bacillus sp. 105MF]        184   9e-51 
ref|WP_000890758.1|  MULTISPECIES: FAD-binding protein [Bacill...    184   9e-51 
ref|WP_000890756.1|  MULTISPECIES: FAD-binding protein [Bacillus]    184   9e-51 
gb|ETW97354.1|  hypothetical protein ETSY2_44795 [Candidatus E...    177   9e-51 
ref|WP_015337532.1|  glycolate oxidase subunit [Desulfovibrio ...    184   9e-51 
ref|WP_000890759.1|  FAD-binding protein [Bacillus thuringiensis]    184   9e-51 
ref|WP_000890755.1|  MULTISPECIES: FAD-binding protein [Bacillus]    184   9e-51 
ref|WP_002126134.1|  FAD-binding protein [Bacillus cereus]           184   1e-50 
ref|WP_016113905.1|  glycolate oxidase subunit glcD [Bacillus ...    184   1e-50 
ref|WP_000890744.1|  FAD-binding protein [Bacillus cereus]           184   1e-50 
ref|WP_022855268.1|  FAD-binding protein [Thermodesulfobacteri...    184   1e-50 
ref|WP_000890746.1|  FAD-binding protein [Bacillus cereus]           184   1e-50 
ref|WP_014664904.1|  FAD-binding protein [Bacillus sp. JS]           184   1e-50 
ref|WP_017152718.1|  FAD-binding protein [Bacillus sp. FJAT-13...    184   1e-50 
ref|WP_024031003.1|  glycolate oxidase subunit GlcD [Bacillus ...    184   1e-50 
ref|WP_027718663.1|  FAD-binding protein [Desulfovirgula therm...    184   1e-50 
ref|WP_017436107.1|  FAD-binding protein [Geobacillus caldoxyl...    184   1e-50 
ref|WP_004398865.1|  FAD-binding protein [Bacillus subtilis]         184   1e-50 
ref|WP_019424949.1|  FAD-binding protein [Paenibacillus sp. OS...    184   1e-50 
ref|WP_031515631.1|  FAD-binding protein [Desulfotomaculum alk...    184   1e-50 
ref|WP_000890760.1|  MULTISPECIES: FAD-binding protein [Bacill...    184   1e-50 
ref|WP_032722325.1|  FAD-binding protein [Bacillus subtilis]         184   1e-50 
ref|WP_032726357.1|  FAD-binding protein [Bacillus subtilis]         184   1e-50 
ref|WP_029318211.1|  FAD-binding protein [Bacillus subtilis]         184   1e-50 
ref|WP_016082393.1|  glycolate oxidase subunit glcD [Bacillus ...    184   1e-50 
dbj|GAK79957.1|  glycolate oxidase subunit [Bacillus subtilis ...    184   1e-50 
gb|KDE23480.1|  FAD-binding protein [Bacillus subtilis]              184   1e-50 
ref|WP_031600780.1|  hypothetical protein [Bacillus subtilis]        184   1e-50 
ref|WP_006094081.1|  FAD-binding protein [Bacillus pseudomycoi...    184   2e-50 
ref|WP_018781066.1|  FAD-binding protein [Bacillus sp. 95MFCvi...    184   2e-50 
gb|AAY81857.1|  putative GlcD [uncultured marine bacterium]          179   2e-50 
gb|KFF55786.1|  FAD-binding protein [Bacillus subtilis]              184   2e-50 
ref|WP_000890739.1|  FAD-binding protein [Bacillus cereus]           183   2e-50 
ref|WP_029764927.1|  FAD-binding protein [Gemmatimonadetes bac...    179   2e-50 
gb|AIK35960.1|  glycolate oxidase, subunit GlcD [Bacillus myco...    184   2e-50 
ref|WP_003388749.1|  glycolate oxidase subunit [Brevibacillus ...    183   2e-50 
ref|WP_000890741.1|  FAD-binding protein [Bacillus cereus]           183   2e-50 
ref|WP_021480277.1|  FAD-binding protein [Bacillus sp. EGD-AK10]     183   2e-50 
ref|WP_028841903.1|  FAD-binding protein [Thermodesulfobacteri...    183   2e-50 
gb|AFL45761.1|  glycolate oxidase D-subunit [uncultured bacter...    177   2e-50 
ref|WP_015714485.1|  FAD-binding protein [Bacillus subtilis]         183   2e-50 
ref|WP_012459982.1|  FAD-binding protein [Sulfurihydrogenibium...    183   2e-50 
gb|AFL45762.1|  glycolate oxidase D-subunit [uncultured bacter...    177   2e-50 
gb|AAY81781.1|  putative GlcD [uncultured marine bacterium]          179   3e-50 
gb|AAY81798.1|  putative GlcD [uncultured marine bacterium]          179   3e-50 
ref|WP_003890796.1|  FAD-binding protein [Mycobacterium phlei]       185   3e-50 
ref|WP_027405668.1|  FAD-binding protein [Anaerovibrio sp. RM50]     183   3e-50 
ref|WP_018132275.1|  hypothetical protein [Alicyclobacillus po...    183   3e-50 
ref|WP_028325118.1|  FAD-binding protein [Desulfatirhabdium bu...    182   3e-50 
ref|WP_015251508.1|  MULTISPECIES: hypothetical protein [Bacil...    183   3e-50 
ref|WP_012874366.1|  FAD-binding protein [Thermobaculum terrenum]    183   3e-50 
ref|WP_017696690.1|  FAD-binding protein [Bacillus subtilis]         183   3e-50 
ref|WP_024572936.1|  FAD-binding protein [Bacillus subtilis]         182   4e-50 
ref|WP_031932467.1|  FAD-binding protein [Brevibacillus borste...    182   4e-50 
ref|WP_027179907.1|  FAD-binding protein [Desulfovibrio bastinii]    182   4e-50 
gb|EHA30930.1|  hypothetical protein BSSC8_13730 [Bacillus sub...    183   4e-50 
gb|EWG13008.1|  glycolate oxidase subunit [Bacillus firmus DS1]      182   4e-50 
ref|WP_000890749.1|  FAD-binding protein [Bacillus cereus]           182   5e-50 
ref|WP_028844491.1|  FAD-binding protein [Thermodesulfovibrio ...    182   5e-50 
ref|WP_000884782.1|  FAD-binding protein [Bacillus cereus]           182   5e-50 
ref|WP_025025958.1|  FAD-binding protein [Bacillus mannanilyti...    182   5e-50 
gb|KEP27370.1|  FAD-binding protein [Bacillus sp. DW5-4]             182   5e-50 
ref|WP_003206413.1|  FAD-binding protein [Bacillus mycoides]         182   5e-50 
ref|WP_003196046.1|  FAD-binding protein [Bacillus mycoides]         182   6e-50 
ref|WP_033024678.1|  FAD-binding protein [Geobacillus sp. CAMR...    182   6e-50 
ref|WP_013401655.1|  MULTISPECIES: FAD-binding protein [Geobac...    182   6e-50 
ref|WP_012463932.1|  FAD-binding protein [Methylacidiphilum in...    182   7e-50 
gb|ABI29312.1|  GlcD [uncultured marine bacterium]                   177   7e-50 
ref|WP_011736399.1|  FAD-binding protein [Pelobacter propionicus]    182   7e-50 
ref|WP_006978337.1|  FAD-binding protein [Chthoniobacter flavus]     182   7e-50 
ref|WP_003253027.1|  FAD-binding protein [Geobacillus thermogl...    182   7e-50 
ref|WP_000890765.1|  FAD-binding protein [Bacillus cereus]           182   7e-50 
ref|WP_000884781.1|  MULTISPECIES: FAD-binding protein [Bacill...    182   8e-50 
ref|WP_007289445.1|  FAD-binding protein [Thermosinus carboxyd...    181   8e-50 
ref|WP_007084316.1|  glycolate oxidase subunit GlcD [Bacillus ...    182   9e-50 
ref|WP_024714794.1|  FAD-binding protein [Bacillus tequilensis]      181   9e-50 
ref|WP_012612981.1|  FAD-binding protein [Desulfovibrio vulgaris]    181   9e-50 
gb|KGO34837.1|  FAD-binding protein [Desulfobulbus sp. Tol-SR]       181   9e-50 
ref|WP_002203427.1|  FAD-binding protein [Bacillus cereus]           182   1e-49 
ref|WP_029764834.1|  FAD-binding protein [Gemmatimonadetes bac...    179   1e-49 
ref|WP_028581233.1|  FAD-binding protein [Desulfobulbus japoni...    181   1e-49 
ref|WP_027093750.1|  FAD-binding protein [Cohnella thermotoler...    181   1e-49 
gb|ABI29303.1|  GlcD [uncultured marine bacterium]                   177   1e-49 
ref|WP_019715316.1|  FAD-binding protein [Bacillus subtilis]         181   1e-49 
ref|WP_019259120.1|  FAD-binding protein [Bacillus subtilis]         181   1e-49 
ref|WP_016097967.1|  glycolate oxidase subunit glcD [Bacillus ...    181   1e-49 
gb|ABI29301.1|  GlcD [uncultured marine bacterium]                   177   1e-49 
ref|WP_028107484.1|  FAD-binding protein [Firmicutes bacterium...    179   1e-49 
ref|WP_029192864.1|  FAD-binding protein [Paenibacillus harenae]     181   1e-49 
ref|WP_015483540.1|  glycolate oxidase subunit [Bacillus subti...    181   1e-49 
ref|WP_021290657.1|  hypothetical protein [Virgibacillus sp. C...    181   2e-49 
ref|WP_000890757.1|  FAD-binding protein [Bacillus cereus]           181   2e-49 
ref|WP_027086322.1|  FAD-binding protein [Cohnella panacarvi]        181   2e-49 
ref|WP_014826023.1|  FAD-binding protein [Desulfosporosinus ac...    181   2e-49 
ref|WP_000888909.1|  FAD-binding protein [Bacillus thuringiensis]    181   2e-49 
ref|WP_026702508.1|  FAD-binding protein [Bacillus aidingensis]      181   2e-49 
ref|WP_008297906.1|  putative FAD-linked oxidoreductase [Bharg...    181   2e-49 
ref|WP_000890766.1|  FAD-binding protein [Bacillus cereus]           181   2e-49 
ref|WP_018924903.1|  hypothetical protein [Salsuginibacillus k...    181   2e-49 
ref|WP_028398204.1|  FAD-binding protein [Bacillus sp. FJAT-14...    181   2e-49 
ref|WP_028576052.1|  FAD-binding protein [Desulfomicrobium esc...    181   2e-49 
ref|WP_003237693.1|  hypothetical protein [Bacillus subtilis]        181   2e-49 
ref|WP_019382647.1|  FAD-binding protein [Bacillus oceanisedim...    181   2e-49 
ref|WP_014901184.1|  FAD/FMN-dependent dehydrogenase [Desulfos...    180   2e-49 
gb|AFL45763.1|  glycolate oxidase D-subunit [uncultured bacter...    174   2e-49 
ref|WP_009335074.1|  FAD-binding protein [Bacillus sp. 2_A_57_...    181   2e-49 
emb|CDQ27219.1|  putative FAD-linked oxidoreductase [Halobacil...    180   2e-49 
gb|KGI86449.1|  FAD-binding protein [Exiguobacterium mexicanum]      180   3e-49 
ref|WP_029265963.1|  FAD-binding protein [Virgibacillus sp. J18]     180   3e-49 
ref|WP_028309150.1|  hypothetical protein [Desulfitibacter alk...    180   3e-49 
gb|EWG07648.1|  FAD linked oxidase domain-containing protein [...    180   3e-49 
ref|WP_019153038.1|  FAD-binding protein [Bacillus massiliosen...    180   3e-49 
gb|KGL36093.1|  FAD-binding protein [Helicobacter sp. MIT 05-5...    175   3e-49 
ref|WP_029594685.1|  FAD-binding protein [Exiguobacterium sp. ...    180   3e-49 
ref|WP_021066131.1|  hypothetical protein [Exiguobacterium pav...    180   4e-49 
ref|WP_026074565.1|  FAD-binding protein [Brevibacillus sp. phR]     180   4e-49 
ref|WP_015384317.1|  glycolate oxidase subunit [Bacillus subti...    181   4e-49 
ref|WP_010096845.1|  FAD-binding protein [Ornithinibacillus sc...    180   4e-49 
ref|WP_027396335.1|  FAD-binding protein [Anaerovibrio lipolyt...    180   4e-49 
gb|ABI29411.1|  GlcD [uncultured marine bacterium]                   176   4e-49 
ref|WP_003542234.1|  FAD-binding protein [Desulfotomaculum nig...    180   4e-49 
ref|WP_019005086.1|  FAD-binding protein [Cohnella laeviribosi]      180   4e-49 
ref|WP_020885989.1|  FAD linked oxidase domain protein [Desulf...    179   4e-49 
gb|AFL45766.1|  glycolate oxidase D-subunit [uncultured bacter...    174   4e-49 
ref|WP_021621301.1|  putative glycolate oxidase, subunit GlcD ...    180   5e-49 
gb|AAY81861.1|  putative GlcD [uncultured marine bacterium]          175   5e-49 
gb|AAY81738.1|  putative GlcD [uncultured marine bacterium]          175   5e-49 
ref|WP_013173318.1|  FAD-binding protein [ [Bacillus selenitir...    179   5e-49 
ref|WP_025810805.1|  FAD-binding protein [Bacillus licheniformis]    179   6e-49 
ref|WP_007131501.1|  FAD-binding protein [Paenibacillus lactis]      179   6e-49 
ref|WP_026577975.1|  FAD-binding protein [Bacillus sp. SB49]         179   6e-49 
ref|WP_028405787.1|  FAD-binding protein [Bacillus sp. J13]          179   6e-49 
gb|EWH22798.1|  FAD-binding protein [Bacillus licheniformis S 16]    179   6e-49 
ref|WP_019743948.1|  FAD-binding protein [Bacillus pumilus]          179   6e-49 
ref|WP_023857785.1|  FAD-binding protein [Bacillus sp. CPSM8]        179   6e-49 
ref|WP_026580482.1|  FAD-binding protein [Bacillus sp. SB47]         179   7e-49 
ref|WP_012545342.1|  FAD-binding protein [Thermodesulfovibrio ...    179   7e-49 
ref|WP_003178667.1|  MULTISPECIES: FAD-binding protein [Bacillus]    179   7e-49 
ref|WP_027416755.1|  FAD-binding protein [Aneurinibacillus ter...    179   8e-49 
ref|WP_028842619.1|  FAD-binding protein [Thermodesulfovibrio ...    179   8e-49 
gb|KGA98996.1|  FAD-binding protein [Bacillus alcalophilus ATC...    179   8e-49 
ref|WP_010307288.1|  FAD-binding protein [Kurthia sp. JC8E]          179   8e-49 
ref|WP_009499190.1|  FAD-binding protein [Sporosarcina newyork...    179   8e-49 
ref|WP_026695318.1|  FAD-binding protein [Bacillus kribbensis]       179   9e-49 
ref|WP_007778259.1|  FAD/FMN-dependent dehydrogenase [Desulfos...    179   9e-49 
ref|WP_027176598.1|  FAD-binding protein [Desulfovibrio aminop...    179   9e-49 
ref|WP_012258000.1|  MULTISPECIES: lactate dehydrogenase [Chlo...    183   9e-49 
ref|WP_025948808.1|  FAD-binding protein [Geobacillus thermoca...    179   1e-48 
ref|WP_017381662.1|  hypothetical protein [Paenisporosarcina s...    179   1e-48 
ref|WP_006676635.1|  FAD-binding protein [Paenibacillus dendri...    179   1e-48 
gb|KFM90010.1|  glycolate oxidase, subunit GlcD [Bacillus lich...    179   1e-48 
ref|WP_033020898.1|  FAD-binding protein [Geobacillus sp. G1w1]      179   1e-48 
ref|WP_