TO78M 4665020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : 78M_scaffold10_1
Annotathon code: TO78M_4665020
Sample :
  • GPS :-30,146783N -43,2916E
  •  : Rio de Janiero-Buenos Aires station 78 MESO -
  • (-MESOm, 5°C, 0.2-3 microns)
Authors
Team : BioCell2014
Username : bordigoniducrot
Annotated on : 2015-03-20 11:59:10
  • BORDIGONI Alexia
  • DUCROT Maeva

Synopsis

  • Taxonomy: Archaea (NCBI info)
    Rank: superkingdom - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 2157
    Kingdom: Archaea - Phylum: - Class: - Order:
    Archaea;

Genomic Sequence

>78M_scaffold10_1 TO78M_4665020 Genomic DNA
TTGAACCGTATCCGTTTGTTACAAAATCATCTAATGGAAAATTTCTGATTGATGTAGATTCTAACAAATATATTGATTATTGGATGGGTCATTGGAGCCT
TATTTTAGGGCATTCACCCAAAAATGTGCTTCATGATGTAAGAATACAACTCAACAGTGGTTGGATGCATGGAACATTAAGTAAAAATACAATAAAATTG
TCAGAAAAAATTTCAAAAGCTGTTCCAGTTGCTGAAAAAATTAGATACGCAACAACTGGTACAGAGGCTACTATGTATGCTGTCAGACTTGCTAGAACTG
CAACTAGGAAAAAAGTAATAGCTAAGATTGATGGTGGTTGGCATGGTTATACCACCGATTTACTGAAAACAGTAAACTGGCCATTCCAAAAATCTGAAAG
TAAAGGTATCGCTGATGAGAAACATATAGTTTCATTGCCGTATAATGACTTGGAAAATTCAATCAGGATTCTGAAGGCAGTAAGAAATAATTTAGCTGCA
GTTATCATTGAACCTGTTCTTGGTGGTGGTGGATGTATTCCAGCCACAAGAGAATATTTAACTGGCATTGAAGAATTTTGTCATAAAAATAATTCATTAT
TTATTCTAGATGAGATTGTGACTGGTTTTAGATTCAGATATGGCTGCTTGTATGACACAATGAAACTTGATCCTGACATAGTAACTCTTGGAAAAATTGT
CGGTGGTGGATTCCCAATTGGTGTTATTTGTGGAAAGGATGAATTTATGAATTATGCAGATACGTCCAAATTCCTGAAACCAAATCGCGCATATATTGGC
GGTGGAACATTCTCTGCAAATCCTCTTACAATGATAGCTGGTGATTCAACACTGCGTATGATTAAAAACAAAGGCAATGCACTTTATGAAAGGTTAAACA
TGCTCGGCTCTAAAACTAGAAAAATGCTAGATAAAAAATTCGCTGGTGAT

Translation

[3 - 950/950]   direct strand
>TO78M_4665020 Translation [3-950   direct strand]
EPYPFVTKSSNGKFLIDVDSNKYIDYWMGHWSLILGHSPKNVLHDVRIQLNSGWMHGTLSKNTIKLSEKISKAVPVAEKIRYATTGTEATMYAVRLARTA
TRKKVIAKIDGGWHGYTTDLLKTVNWPFQKSESKGIADEKHIVSLPYNDLENSIRILKAVRNNLAAVIIEPVLGGGGCIPATREYLTGIEEFCHKNNSLF
ILDEIVTGFRFRYGCLYDTMKLDPDIVTLGKIVGGGFPIGVICGKDEFMNYADTSKFLKPNRAYIGGGTFSANPLTMIAGDSTLRMIKNKGNALYERLNM
LGSKTRKMLDKKFAGD

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Afin de réaliser notre annotation de séquence, nous avons choisi l’ORF 1 cadre 3 du brin direct de la séquence d’ADN.  Cet ORF de coordonnées 3 – 950 est de 948 nucléotides soit 316 acides aminés.


Cet ORF est codant car d’après les résultats du blastp, il présente beaucoup d’homologues dans la banque de données NR (>5000) dont les e-values s’étendent de 0.0 à 5e-45 mais également dans la banque de données SP (919) pour lesquels les e-values varient de 2e-142 à 7.3. Notre ORF semble coder pour une protéine partielle car il est incomplet en 5’ et en 3’.


Nous n’avons pas pu déterminer le symbole du gène codant notre protéine car nous avons trouvé différents symboles dans les fiches des Blastp. La position précise de la méthionine d’initiation et du codon stop ne peuvent être définis car les 3’ et 5’ de notre ORF sont tronqués d’après l’alignement au format CLUSTAL et au format GBLOCKS. En revanche, nous pouvons supposer qu’il manque 66 à 150 nucléotides en 5’ et 315 à 360 en 3’ de notre ORF.  


D’après nos résultats de Blastp (NR et SP) et d’INTERPRO notre ORF semblerait coder pour une protéine de la famille des transférases (activité transférase GO 0016740) de type aminotransférase (ou aminomutase ou transaminase). Ces protéines sont impliquées dans de nombreux processus biologiques, métaboliques et notamment la synthèse de nouveaux acides aminés. De manière générale, elles  interviennent dans des processus de biosynthèse (GO 0009058).


Au vu de nos arbres phylogénétiques nous ne pouvons conclure sur l’ordre, la classe et ou le phylum d’appartenance de notre ORF. Tout ce que nous pouvons dire c’est que notre ORF appartient vraisemblablement au règne des Archae.



ORF finding

PROTOCOLE:


a) brin direct


site : SMS  outils: ORF finder paramètres: intiation (any- codon) cadre (1, 2 and 3)  brin (direct) min:(60) code génétique (standard)


b) brin indirect


site : SMS,  outils: ORF finder paramètres: intiation (any- codon) cadre (1, 2 and 3)  brin (indirect) min(60 aa) code génétique (standard)



ANALYSE DES RÉSULTATS:



a) brin direct

_________________________________________________________________________________________________________________________

        |    Taille     |  Taille  |  Brin   | position  |  position  |  ORF complet  |  ORF complet  | nombre de hits   |

        | (nucléotides) |   (aa)   |         | de début  |   de fin   |     en 5'     |     en 3'     |blast NR EV<1E-10 |

________|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF 1 |     948       |    316   |  direct |     3     |     950    |      non      |      non      |      >10 000     |

frame 3 |               |          |         |           |            |               |               |                  |

________|_______________|__________|_________|___________|____________|_______________|_______________|__________________|


Par curiosité nous avons effectué un Blastp contre la banque de données NR tronqué à 10 000. Et nous avons obtenu 10 000 résultats. Pour la suite de nos analyses nous nous concentrons sur le Blastp à 5 000 comme il nous l'a été demandé.



b) indirect

_________________________________________________________________________________________________________________________

        |    Taille     |  Taille  |  Brin   | position  |  position  |  ORF complet  |  ORF complet  | nombre de hits   |

        | (nucléotides) |   (aa)   |         | de début  |   de fin   |     en 5'     |     en 3'     |blast NR EV<1E-10 |

________|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF 1 |      240      |    80    |indirect |    106    |     345    |      oui      |      oui      |        2         |

frame 1 |               |          |         |           |            |               |               |                  |

________|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF 1 |      234      |   78     |indirect |    371    |    604     |      oui      |      oui      |        2         |

frame 2 |               |          |         |           |            |               |               |                  |

________|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF 2 |      216      |   72     | indirect|    605    |    820     |      oui      |      oui      |        0         |

frame 2 |               |          |         |           |            |               |               |                  |

________|_______________|__________|_________|___________|____________|_______________|_______________|__________________|



La séquence d'ADN étudié présente 4 ORFs : un ORF sur le brin direct et trois ORF sur le brin indirect.


L'ORF 1 frame 3, est le seul ORF trouvé par ORF finder sur le brin direct. Il se situe dans le troisième cadre ouvert de lecture. C'est un ORF codant car le Blastp contre la banque de données NR nous renvoie de nombreux homologues, plus de 5 000 dont les premières e-value sont relativement très bonnes : 0.0. Et 919 contre SWISSPROT dont les e-values sont plutôt bonnes soit 2e-142. Cet ORF n'est pas complet en 5', le premier nucléotide se trouve en position 3 de la séquence d'ADN, il se peut que le triplet précédent comportant les nucléotides 1 et 2 ne soit pas un codon stop. En effet, nous pouvons constater que le nucléotide 1 est un G et que le nucléotide 2 est un A, d'après le code génétique, les triplets de type -GA (avec "-" pouvant être A, T, G ou C) peut donner soit le codon TGA qui est un codon stop, soit les codons CGA (arginine), AGA (arginine) ou GGA (glycine). L'ORF 1 cadre 3, n'est pas complet non plus en 3'. Notre séquence d'ADN à une longueur de 950 nucléotides, et le nucléotide 950 est compris dans notre ORF. Le triplet comprenant le nucléotide 950 est GAT. Ce triplet n'est pas un codon stop mais code pour l'acide aspartique. Notre séquence se prolonge donc en 3'. Cet ORF de 948 nucléotides code pour une protéine de 316 acides aminés.


L'ORF 1 frame 1, est l'unique ORF trouvé par ORF finder dans le cadre de lecture 1 du brin indirect. Il  est complet en 5' et la séquence protéine correspondante ne commence pas par une méthionine mais par une isoleucine. Il est également complet en 3' puisqu'il se termine par un codon stop TAG. Cet ORF est plutôt court (240 nucléotides soit 80 acides aminés) et ne présente pas d'homologue dans le Blastp contre la banque de données NR (2). De plus les e-value du Blast sont élevées 3 et 9,2. Nous éliminons donc cet ORF pour poursuivre l'étude, même s'il est possible que cet ORF soit codant pour une protéine qui ne possède pas encore d'homologues connus dans la banque de données NR. Il s'agirait d'un ORFan.


L'ORF 1 et l'ORF 2 frame 2 se trouvent dans le cadre de lecture 2 sur le brin indirect de notre séquence d'ADN. Ces deux ORF sont complets en 5' et en 3'. L'ORF 1 cadre 2 est complet en 5' et la séquence protéique correspondante ne commence pas par une méthionine mais par une glutamine. Il est complet en 3' son codon stop est TAA. En ce qui concerne L'ORF 2 cadre 2, il est complet en 5' et sa séquence protéine correspondante ne commence pas par une méthionine mais par une proline. Il est également complet en 3' puisqu'il se termine par un codon stop TGA. Ils sont tous deux relativement court (234 et 216 nucléotides soit respectivement 78 et 72 acides aminés). Ces ORF ne présentent pas d'homologues dans le Blastp contre la banque de données NR.  l'ORF 1 en a 2 dont les e-values sont élevées 3,6 et 4,5 et l'ORF 2 n'en a aucun. Nous éliminons donc ces ORF pour poursuivre l'étude, même s'il est possible que ces ORFs soient codants pour une protéine qui ne possède pas encore d'homologues connus dans la banque de donnée NR. Il s'agirait d'ORFans. Nous avons également remarqué que les ORF 1 et 2 cadre 2 semblerait être en continuité. En effet, l'ORF 1 cadre 2 se termine au nucléotide 604 et l'ORF 2 cadre 2 commence à la position 605. Nous pouvons supposer qu'une mutation ou une erreur de séquençage a généré un codon stop. Cependant nous ne choisissons pas ces ORFs car le nombre d'homologues dans la banque de données NR est très faible : 0 à 2.


Les ORFs 1 cadre 1, 1 cadre 2 et 2 cadre 2 sembleraient être des ORFans de par l’absence d'homologues dans le Blastp contre la banque de données NR. Les ORF 1 et 2 du cadre 2 brin indirect pourrait être analysés bout à bout mais il est peu probable d'obtenir des homologues dans le Blastp contre la banque de données NR car ce sont des ORFans.


Nous choisissons donc l'ORF 1 cadre 3 de coordonnées 3 - 950, du brin direct pour poursuivre nos analyses car il semble le plus crédible de par sa grande taille (948 nucléotides, soit 316 acides aminés), son nombre important d'homologues dans Blastp contre NR (plus de 10 000) et contre Swissprot (919 homologues). L'ORF choisi est incomplet et codant.


Nous ne pouvons pas calculer la masse moléculaire théorique du polypeptide ou du moins de la partie du polypeptide correspondant à cet ORF, en utilisant le site SMS et l'outil protein molecular weight, car la séquence nucléotidique de cet ORF est incomplète.

RÉSULTATS BRUTS:

a) brin direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 950.
GAACCGTATCCGTTTGTTACAAAATCATCTAATGGAAAATTTCTGATTGATGTAGATTCT
AACAAATATATTGATTATTGGATGGGTCATTGGAGCCTTATTTTAGGGCATTCACCCAAA
AATGTGCTTCATGATGTAAGAATACAACTCAACAGTGGTTGGATGCATGGAACATTAAGT
AAAAATACAATAAAATTGTCAGAAAAAATTTCAAAAGCTGTTCCAGTTGCTGAAAAAATT
AGATACGCAACAACTGGTACAGAGGCTACTATGTATGCTGTCAGACTTGCTAGAACTGCA
ACTAGGAAAAAAGTAATAGCTAAGATTGATGGTGGTTGGCATGGTTATACCACCGATTTA
CTGAAAACAGTAAACTGGCCATTCCAAAAATCTGAAAGTAAAGGTATCGCTGATGAGAAA
CATATAGTTTCATTGCCGTATAATGACTTGGAAAATTCAATCAGGATTCTGAAGGCAGTA
AGAAATAATTTAGCTGCAGTTATCATTGAACCTGTTCTTGGTGGTGGTGGATGTATTCCA
GCCACAAGAGAATATTTAACTGGCATTGAAGAATTTTGTCATAAAAATAATTCATTATTT
ATTCTAGATGAGATTGTGACTGGTTTTAGATTCAGATATGGCTGCTTGTATGACACAATG
AAACTTGATCCTGACATAGTAACTCTTGGAAAAATTGTCGGTGGTGGATTCCCAATTGGT
GTTATTTGTGGAAAGGATGAATTTATGAATTATGCAGATACGTCCAAATTCCTGAAACCA
AATCGCGCATATATTGGCGGTGGAACATTCTCTGCAAATCCTCTTACAATGATAGCTGGT
GATTCAACACTGCGTATGATTAAAAACAAAGGCAATGCACTTTATGAAAGGTTAAACATG
CTCGGCTCTAAAACTAGAAAAATGCTAGATAAAAAATTCGCTGGTGAT

>Translation of ORF number 1 in reading frame 3 on the direct strand.
EPYPFVTKSSNGKFLIDVDSNKYIDYWMGHWSLILGHSPKNVLHDVRIQLNSGWMHGTLS
KNTIKLSEKISKAVPVAEKIRYATTGTEATMYAVRLARTATRKKVIAKIDGGWHGYTTDL
LKTVNWPFQKSESKGIADEKHIVSLPYNDLENSIRILKAVRNNLAAVIIEPVLGGGGCIP
ATREYLTGIEEFCHKNNSLFILDEIVTGFRFRYGCLYDTMKLDPDIVTLGKIVGGGFPIG
VICGKDEFMNYADTSKFLKPNRAYIGGGTFSANPLTMIAGDSTLRMIKNKGNALYERLNM
LGSKTRKMLDKKFAGD

-------------------------------------------------------------------------------------------------

b) brin indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 106 to base 345.
ATCACCAGCTATCATTGTAAGAGGATTTGCAGAGAATGTTCCACCGCCAATATATGCGCG
ATTTGGTTTCAGGAATTTGGACGTATCTGCATAATTCATAAATTCATCCTTTCCACAAAT
AACACCAATTGGGAATCCACCACCGACAATTTTTCCAAGAGTTACTATGTCAGGATCAAG
TTTCATTGTGTCATACAAGCAGCCATATCTGAATCTAAAACCAGTCACAATCTCATCTAG


>Translation of ORF number 1 in reading frame 1 on the reverse strand.
ITSYHCKRICRECSTANICAIWFQEFGRICIIHKFILSTNNTNWESTTDNFSKSYYVRIK
FHCVIQAAISESKTSHNLI*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 371 to base 604.
CAAAATTCTTCAATGCCAGTTAAATATTCTCTTGTGGCTGGAATACATCCACCACCACCA
AGAACAGGTTCAATGATAACTGCAGCTAAATTATTTCTTACTGCCTTCAGAATCCTGATT
GAATTTTCCAAGTCATTATACGGCAATGAAACTATATGTTTCTCATCAGCGATACCTTTA
CTTTCAGATTTTTGGAATGGCCAGTTTACTGTTTTCAGTAAATCGGTGGTATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
QNSSMPVKYSLVAGIHPPPPRTGSMITAAKLFLTAFRILIEFSKSLYGNETICFSSAIPL
LSDFWNGQFTVFSKSVV*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 605 to base 820.
CCATGCCAACCACCATCAATCTTAGCTATTACTTTTTTCCTAGTTGCAGTTCTAGCAAGT
CTGACAGCATACATAGTAGCCTCTGTACCAGTTGTTGCGTATCTAATTTTTTCAGCAACT
GGAACAGCTTTTGAAATTTTTTCTGACAATTTTATTGTATTTTTACTTAATGTTCCATGC
ATCCAACCACTGTTGAGTTGTATTCTTACATCATGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
PCQPPSILAITFFLVAVLASLTAYIVASVPVVAYLIFSATGTAFEIFSDNFIVFLLNVPC
IQPLLSCILTS*

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:


a) site : Phylogeny.fr , outils : PhyML, MUSCLE,TreeDyn, paramètres par défaut


b) site : Phylogeny.fr , outils : PhyML, Gblocks,TreeDyn paramètres par défaut  


ANALYSE DES RÉSULTATS:


a et b) MUSCLE FORMAT CLUSTAL ET GBLOCKS


Nous n'observons pas deux groupes distincts correspondant au groupe d'étude (Crenarchaeota) et au groupe extérieur (Euryarchaeota & Thaumarchaeota).


Précédemment nous avions remarqué que notre ORF était incomplet en 3' et en 5', cela est confirmé par les résultats de l'alignement multiple sous format CLUSTAL et GBLOCKS. Notre protéine semble tronquée de 22 (min) à  50 (max) acides aminés en 5' (<_>). Le minimum correspond à la séquence la plus courte en Nter Arc Cre The 11 et le maximum correspond à la séquence la plus longue en N ter soit Arc Cre The 10, 6 et 7. Nous ne pouvons donc pas déterminer de méthionine d'initiation sur notre ORF. En effet, l'alignement entre les séquences homologues commence 49 acides aminés avant que l'ORF ne s'aligne à son tour avec elles. Il manque donc entre 66 et 150 nucléotides en 5' à notre ORF. Cependant nous pouvons supposer que la méthionine d'initiation se trouve entre l'acide aminé 0 et 49 de l'alignement car toutes les séquences homologues sélectionnées commencent par une méthionine.


En 3' il semble manquer entre 105 acides aminés minimum et 120 acides aminés maximum (<_>). Le minimum correspond à la séquence la plus courte en Cter soit ici Arc Eur Hal 1 et Arc Eur Met 4 et la maximum correspond à la séquence la plus longue soit Arc Cre The 10. En effet, l'alignement se prolonge en Cter entre toutes les séquences homologue jusqu'à la position 484 environ mais pas avec l'ORF qui s'arrête à la position 380. Il manquerait donc entre 315 et 360 nucléotides en 3' de notre ORF.


a) MUSCLE FORMAT CLUSTAL


Sur la totalité de l'alignement nous observons 32 positions où l'acide aminé est conservé (*), 34 positions où l'acide aminé est substituable (:)c'est-à-dire que les caractéristiques de ces acides aminés sont comparables, et 18 positions (.) qui sont des substitutions dont les scores dans les matrices de substitutions sont moins bons que pour les acides aminés strictement substituables (:).


Il y a peu d'indel lorsque l'ORF est aligné aux autres séquences. En revanche, l'ORF ne s'aligne pas avec les Nter et Cter des séquences homologues sélectionnées ce qui concorde avec les résultats d'ORF finder qui nous indique que l'ORF choisit est incomplet en 5' et en 3'.


La séquence Arc Eur Hal 1 a probablement une région insérée car aucune des séquences homologue ne possède cette région. Cela crée un grand gap des positions 401 à 424 (<_________________>).


b) GBLOCKS


Nous observons de grands blocs de conservations. Ils sont séparés les uns des autres de peu d'acides aminés (4 à 20 AA). Ces blocs recouvrent 238 acides aminés ce qui représente 47% de conservation ce qui nous montre qu'il y a bien une homologie entre les séquences sélectionnées.



Nous ne pouvons pas déterminer la position précise de la méthionine et nous n'avons pas non plus le codon stop donc nous ne pouvons pas apporter plus de précisions sur le statut de notre ORF (début et fin),  ni sur le poids théorique de la protéine codée par l'ORF choisi.


RÉSULTATS BRUTS:


a) MUSCLE format CLUSTAL

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment

                <===============================================>   
A.Cre           -------------------MAKSKDHKSILDKAKKYLVGGVNSPVRSFIYVGGEPIVIES
A.E.Hal_1       --------------------MNHEQSRALYDRALSVLSGGVNSSVRATR---PYPFFVEK
A.C.The_11      ---------------------------MLWDRARAIFPGGVNSPARALRHL-QSPLIAER
A.C.The_14      --------------------------MDIWERAKAVFPGGVNSPARALKHL-ARPLVALG
A.C.The_9       ---------------------MAESSRELFEEAKKIFPGGVNSPVRAAVK--PYPFFVKY
A.C.The_8       ---------------------MLGMSKELYEEASKFLVGGVDSPVRAAVR--PYPFFVKE
A.C.The_12      --------------GHMDVLASGEKSRMLFERTKELFPGGVNSPVRAAVK--PYPFYVKR
A.C.The_13      ----------------------MDRSLELFQIAKNLFPGGVNSPIRAAVK--PYPFYVKK
A.C.The_1       ------------------------MSSDLWNKAQAVFAGGVNSPVRAAVK--PFPFYTRS
A.C.The_2       ---------------MDKGRCTILNSEELWAQARQLFAGGVNSPVRAAVK--PFPFYVER
A.C.The_5       ----------------MAKRGVTVLSSELWKNALELFPGGVNSPVRAAVK--PFPFYTKE
A.C.The_3       ------------------------MSENLWKKALELFAGGVNSPVRAAVK--PYPFYVEK
A.C.The_4       ------------------------MSEKYWNIASHYFAGGVNSPVRAAVK--PYPFYVER
A.E.The_1       -----------------------MSSKELFELAAKLFPMGVNSPVRYFK---DYPFYVKE
A.E.Met_6       -----------------------MKSEDLFKDAKNYLPGGVDSPVRAIK---PYPFFALK
A.E.Met_7       -----------------MYTIKTEKSEKLYNEAKKCLVGGVNSPVRAFK---PYPFFVKS
A.E.Met_3       --------------------MTSERSKSLYEKSSALLPGGVSSPVRAFK---PYPRFIKS
A.E.Met_4       -----------------------MKSSELFDIAKTLIPGGVSSPVRAIK---PYPFYTKR
A.E.Met_2       ----------MIRSHVSADTMNLNSSRSLYERAKRLMPGGVSSPVRAIR---PYPFYVKR
A.E.Met_1       ------------------MEGENTKSKQLYEQAKKIISGGVSSPVRAIQ---PYPFYTES
A.E.Met_5       --------------------MKLDTSRALFEEALQVMPGGVSSPVRAAK---PFPFYTKS
A.C.The_10      MVQLEEKLEEWWARLASEYEKRTPRSRELFERARRVLPGGTTYHIRFFK---PYPVFIEH
A.C.The_6       MVLDKELLYRRIAEYEEKYLLMTPMSRELFERARRVLPGGVVYATRFME---PYPVYISR
A.C.The_7       MSNLSGRVQELIDKYTKIYMEGTSKSRELFERARKVLPGGTTYQIRHFS---PYPVYITR
A.C.can_1       ------------MNLIEKYISKTRKSKELFERAKSHFAGGINHNARFYK---PYPIFVNK
A.T.Nit_3       -------MNDYYGNYIRRYEAKTGKSRRLYSRSEKLFPGGISHNIRYFE---PYPFFVNA
A.T.Cen_1       ------------MDLEREYRAKTGGSARIFARSKKYHVGGVSHNIRFYE---PYPFVTRS
A.T.Nit_2       ----------MVLDYIKNYKKKTHKSSILFSKSSKFHVNGVSHNIRYYA---PYPFVVKS
A.T.Nit_1       ---------MLLSSYLSEYKKKTKRSAKIFAKSSKLHVNGVSHNIRFYE---PYPFVVKS
A.C.Mar_3       --------MNLLLDYIKEYKKKTPTSAKLFAKSAKLHVNGVSHNIRFYE---PYPFVVKK
A.C.Mar_4       --------MNLLLDYIKEYKKKTPTSAKLFAKSAKLHINGVSHNIRFYE---PYPFVVKK
A.C.Mar_2       ----------MRMEDTKTYRLKTGKSAKLFEKSKKYHVDGVHHNIRFFE---PYPFVTKS
A.C.Mar_1       ----------MIKNDLKLYTKNTKKSAKLFQKSKKLHINGVHHNIRFFE---PYPFITKS
T.o.ORF_nu      ------------------------------------------------E---PYPFVTKS
                                                                      *     
               
A.Cre           GKGSKIKDIEGREYIDYICSWGAIIHGHA-NEYIENRIIEAVKRGNNFGLTTEFEVELAE
A.E.Hal_1       GDGGHVIDADGNRYIDFVMGYGPLLLGHSLPEQVQSAIQRHAAEGPMYGAPTEVEVELAE
A.C.The_11      GEGAYLYT-DRGKLVDFCMGFGPLILGHR-PKPVLDAVKAWLERGWLYAMLTEPEVELGE
A.C.The_14      ADGPYLYT-DRGRLVDFCSAFGAIILGHN-NPRVREAVERQLRSGWIYALLTEQEVALAE
A.C.The_9       AKGAYVYTEEGNRLIDYVLGYGPLILGHA-NDYVLNKIKEGLNNGWLFGAPNKNEINLGK
A.C.The_8       GVGPYIITEDNEKLVDYVLGYGPLILGHA-NEAVKRRVIEQIERGWLYGTPTRVELELAK
A.C.The_12      GEGAYLYTVDGARIVDLVLAYGPLILGHK-HPRVLEAVEEALARGWLYGAPGEAEVLLAE
A.C.The_13      ASGATLVTVDGVELIDYVLGYGPLILGHM-HPKVLEAVEEQLNRGWLYGTPHELEIELAK
A.C.The_1       AKGAYLVTEDSRRLIDFVLGYGPLILGHA-HPKVIEAVKDQLERGWLYGTPSRAEVELAS
A.C.The_2       GKGAYIYTVEGNKFIDYVLGYGPLILGHS-PESVKRKIIEQLEKGWLFGTPSKLEIELAK
A.C.The_5       GRGAFLITEDGRKLIDFVLGYGPLILGHS-PPRVKEKVIEQIEKGWLYGTPSRAEVELAR
A.C.The_3       SEGAFLYTIDGQRLIDYVLGYGPLILGHA-HPYVKKKIIEQIEKGWLYGTPSKKEIELAE
A.C.The_4       AEGAYLYTADNKQLIDYVLGYGPLILGHA-NQYVTKKIIEQVNKGWLYGTPSPIEIELAR
A.E.The_1       GKGSTILDVDGNKYIDYCLGYGPLILGHS-DPDVTRAVIEQAEKGLLFGEPSENEIKLAE
A.E.Met_6       AEGPRLFDVDGNSYLDYCLAYGPLVLGHA-YPPVMETVSKQLSNGSAYGVPTENEIKLAK
A.E.Met_7       ANGCHLIDEDDNTYIDYCLAYGPMVLGHA-NQEVLYKVREQMDLGTAYGVPAKKEIELAK
A.E.Met_3       GKGSRIIDVDDNEYIDYCMAFGPLILGHS-NDVISSAVAEQLSKGTLFGAPSELEIEFAE
A.E.Met_4       ANGSRIYTEDGDELIDCCMGYGPLLLGHC-HPVVKAAIEEQATNGWLYGTPTEKEIELAK
A.E.Met_2       AEGPYLWDEDGNSFIDYCLAYGPMILGHR-NPEVMRKVEEQIERGWLYGTPTALEVELAE
A.E.Met_1       AQGSRIKDVDGNEYIDFCMGYGPNLLGHA-HPEIKQAIAEQLDNGWLYGTPLENEVKLAE
A.E.Met_5       AKGCRLTDADGNGYIDFCMGYGPLILGHQ-PAPVKDAIGKQLDEGWLYGTPCELEVRYAR
A.C.The_10      GLGPRVWDVDGNEYTDYWMGHGALILGHC-PDLLEEAVRKALKASSHLGYENPYALEYAE
A.C.The_6       AKGSKVVDVDGNGYDDYWMGHGTHILGHS-PSFIVEAVNRVSMNGTHLGFENPYAVEYAE
A.C.The_7       AGGARVWDVDGNEYVDYWMGHGTHILGHS-PDFVVKAVNDAAYEGTHLGYPNTLEVEYAE
A.C.can_1       AKGNRIYDVDRNEYIDFWMGHASLILGHS-PDFIMNEIKEQIYNGTIYGVPSEDAILLAE
A.T.Nit_3       ARGKSLSDVDGNRYTDYWMGHWALILGHS-PAPVASALARQVKNGTLYGVVNDVSVELAE
A.T.Cen_1       ASGKHLVDVDGNKYVDYWMGHWSLILGHA-PAPVRSAVEGQLRRGWIHGTVNEQTMNLSE
A.T.Nit_2       ATGKNLVDVDGNKYVDYWMGHWSLILGHA-PTKVKESLRKQIEKGWMYGTVNEQTILLSE
A.T.Nit_1       SNGTNLVDVDDNKYTDYWMGHWSLILGHG-QKNVKESLKKQIEKSWMYGTVNEQTVKLSE
A.C.Mar_3       SLGKNLVDVDGNKYTDYWMGHWALILGHG-PKSVRKNLQKQIERSWMYGTVNEQTILLSE
A.C.Mar_4       SAGKNLVDVDGNKYTDYWMGHWALILGHG-PNSVKKNLQKQIEKSWMYGTVNEQTILLSE
A.C.Mar_2       ANRKFLIDVDSNKYVDYWMGHWSLILGHT-QKKIASQIKKQLSYDWMHGTLNKNSIELSE
A.C.Mar_1       SKGKFLIDIDSNKYVDYWMGHWSLILGHS-PKNIVNSAKKQLNNGWMHGTASKNSIELSE
T.o.ORF_nu      SNGKFLIDVDSNKYIDYWMGHWSLILGHS-PKNVLHDVRIQLNSGWMHGTLSKNTIKLSE
                .    :   :     *   .  . : **     :          .   .      :  . 

A.Cre           RICNMVKSIEKIRFVNSGTEATMSAIRLARAYTNRDLIIKFEGCYHGHSDHFLSKAGSGL
A.E.Hal_1       FVTRHVPSVEMLRFVNSGTEATVSAVRLARGYTGRDKIVVMQSGYHGAQESTLV---EGE
A.C.The_11      TIIRHVPSVKKIRFVSTGTEATMNAVRLARGYTKRDVIIKFEGNFHGSHDYVLVKAGSGA
A.C.The_14      KIRSHMPSIRKIRFVNTGTEATMNAIRLARGYTKRDVIIKFDGNFHGSHDYVLVKAGSGA
A.C.The_9       KIISYVKPGGKIRYVNSGTEATMTAIRLARGYTNRKYLVKFDGCYHGSHDSVLVQAGSAA
A.C.The_8       KVVSYVMPGGKVRFVNSGTEATMTAIRLARGFTGRNKIMKFDGCYHGAHDYVLVQAGSAA
A.C.The_12      KILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAA
A.C.The_13      KIVSHYPSIDMVRFVNSGTEATMTAIRLARGFTKKNKIIKFDGCYHGAHDSVLVKAGSAV
A.C.The_1       MITKHVPSAQKVRFVNSGTEATMTALRLSRGFTGRSKILKFDGNYHGAHDYVLIDAGSAA
A.C.The_2       KISSHIPSAQKIRFVNSGTEATMAAIRLARGYSKRSKILKFSGNYHGAHDYTLVEAGSAA
A.C.The_5       KITSHMHSIEKIRFVNSGTEATMNAIRLARGFTKREKIIKFDGNYHGAHDYVLASAGSAA
A.C.The_3       KIRSHIPSAEKIRFVNSGTEATMLAIRLARGYTKREKILKFDGNYHGAHDYALINAGSAV
A.C.The_4       KISHHLPSAQKIRFVNSGTEATMLALRLARAYTGREKIIKFHGNYHGAHDYLLLDAGSAF
A.E.The_1       MIKETSKNIEMMRFTNSGTEATMHAIRLARAITGRKLIVKMEGGFHGAHDYSLIKSGSGT
A.E.Met_6       EVVKRVPCADMVRFVNSGTEATMSAIRLARAVTGKNKILKFEGAYHGAHDYVLVKSGSGA
A.E.Met_7       EVINRIPCAEMVRFVNSGTEATMSAIRLARGITGKNKIIKFDGAYHGAHDYVLVKSGSGA
A.E.Met_3       SVCRHFPSIEMLRPVSTGTEATMHAIRLARGYTGKKKIIKMEGGFHGAHDSVLVKAGSGA
A.E.Met_4       IIACDHPSIDMCRFVSSGSEATMAAIRLARGYTNKKDIIKVEGGFHGAHDGVLIQAGSGA
A.E.Met_2       RIISHYPSIEMIRFVSTGTEATMAALRIARGFTGKDKIVKIEGGFHGAHDSVLVKAGSGA
A.E.Met_1       KVTDAYPSMDMLRFVSSGSEATMSAIRTARGYTGKNKILKIEGGFHGTHDSVLVKAGSGA
A.E.Met_5       KIRNYYPGMQMMRFVSTGGEATMSAIRAARGYTGRDKVVKIEGGFHGAHDGVLVKAGSGA
A.C.The_10      LLVQVLPGVEQVRFTNSGTEANMYAVRLARAYTGRKYIIKLEGAWHGGYDALHV---GVT
A.C.The_6       LLTKIIPSVEMVRFCNSGTEANMYAVRLARAYTKRRYVIKIEGGWHGGLDQLHT---AVT
A.C.The_7       LLTKVVPNVDMVRFSNSGTEANMYAVRLARAYTGHRYVVKMEGGWHGGYDGLHV---GIN
A.C.can_1       MIKKCVKSVEKIRFCNSGAEATMYAIRLARAFTKKRYVLKVRGGWHGYNTPLSR----NV
A.T.Nit_3       AIQKLMPRAEMMRFSSTGSEATMYAVRLARAKTGRRVIAKAIGGWHGFNTTLMQ---TVN
A.T.Cen_1       IIRGAVSVAEKTRYVTSGTEAVMYAARLARAHTGRKIIAKADGGWHGYASGLLK---SVN
A.T.Nit_2       LISKAVPVAEKIRYVTSGTEATMYSVRLARSVTGKKIIAKIDGGWHGYTSDLLK---SVN
A.T.Nit_1       MISKAVPVAEKIRYVTSGTEATMYAVRLARSVTEKKIIAKIDGGWHGYTSDLLK---SVN
A.C.Mar_3       LISKAVPVAEKIRYVTSGTEATMYAVRLARSMTGKKVIAKIDGGWHGYTSDLLK---SVN
A.C.Mar_4       LISKVVPVAEKIRYVTSGTEATMYAVRLARSVTGKKIIAKIDGGWHGYTSDLLK---SVN
A.C.Mar_2       KISKAVPVAEKIRYASTGTEATMYAVRLARTITKRKTIAKIDGGWHGYTTDLLK---TVN
A.C.Mar_1       KISKVVPVAEKIRYASTGTEATMYAIRLARTATKRKIIAKIDGGWHGYTTDLLK---TIN
T.o.ORF_nu      KISKAVPVAEKIRYATTGTEATMYAVRLARTATRKKVIAKIDGGWHGYTTDLLK---TVN
                 :          *  .:* ** : : * :*  : .  :    . :**             

A.Cre           ATYDIPLSPGVPKGVVENTLTLPYNDEEKIEKAFEKAGNKIACVIIEPVAGNMGVVLPNL
A.E.Hal_1       GDHTAPSSPGIPESFAEHTLTVPFNDEEAAHEVFEEHGDDIAAVLTEPILGNYGIVHPVE
A.C.The_11      ATWGIPTSAGIPADVAKLTVVVPYNDVEAFRKAIREVGDRLAAVIVEPVAGNYGLIIPDI
A.C.The_14      ATWGIPTSAGIPADVVKLTVVVPYNDVEAFVRAVREVGDRLAAVIAEPVAGNYGLIIPDK
A.C.The_9       TEFGVPNTLGVPNDVAKLTLVAKYNDLNSLENIFRNYGDEIAAVIVEPVIGNMGVIKPNK
A.C.The_8       SEYGVPNSRGVPPQVAALTVVAKYNDLESADRAAKAAGDDLAAIIVEPVIGNMGVIPPDR
A.C.The_12      AHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRR
A.C.The_13      SHFGVPGSAGVPEEVSKLTLVVPFNDVEAVEKVAKENQDDLAAIIVEPVMGNAGVIPPKE
A.C.The_1       SEFGVPFSQGIPTEVSSTVLVCPYNDLTCVETVLKR--EEIAGVIVEPVMGNMGVIPPEK
A.C.The_2       TEYNVTTSDGIPMEIMKTIEICEFNDLDCVDKKLRN--EDIAAALLEPIMGNAGVILPEK
A.C.The_5       TEFSVPDSDGIPKDVLKTVIVCPYNQLECVEKHLKN--EDVAAVIVEPIMGNMGVIPANQ
A.C.The_3       SEFNVIISSGIPTSIINTVIVCKYNDLDCVEKHLRT--EEIAGVIVEPVMGNMGVILPEQ
A.C.The_4       TEFNVNVYNGIPKSIVNTIRICEYNDAECVEKLSKS--EDIAGVIVEPVMGNMGVILPDK
A.E.The_1       LTFGSPSSPGIPDEVAQTVIVGKYNDENNIKEIFQKYGDKIAAVITEPIMGNAGVILPKQ
A.E.Met_6       A--GLPDSPGVPEETTKNTLLAPFNDAEAITSLVKKEKDDLAAIILEPVMGNVGCIPPKR
A.E.Met_7       LTHGSPNSPGIPADTTKNTILLPFNNRELMEKTIYEQKDEIACIIVEPVMGNVGCILPND
A.E.Met_3       LTHSVPNSAGIPEESTRNTILVPFNDLNAIEEAFKSNRGEIAAVITEPVMGNTGPILPKK
A.E.Met_4       LTMGVPDSAGVIPDVVSHTMQVPYNDIESLEEILSKN-KDIAAFILEPVMGNVGPVLPEK
A.E.Met_2       TTIGVPDSKGVPADTAKNTVLVPYNDIQAMEAALRE--DDVAAVIMEPVLGNIGPVLPMD
A.E.Met_1       TTLGKPNSKGVPEEVTKHTLQAPFNDIESMTELIEKNRDDMAAVIMEPVMGNIGPILPKE
A.E.Met_5       ATMGVPDSLGVPKDFTKHTLQVPFNDIRAMEAALESNKDQVACVIMEPVMCNMGPILPKE
A.C.The_10      PPYEGPESLGLPEESIKYTLVAPFNDAGAVERLVKRY--EVAAIWVEPVLGAGGGIEPEP
A.C.The_6       PPFTGPESAGLPEDFTKYTISVPFNDLDAMERALKSY--DVAAIIMEPVPGAGGCIEPLD
A.C.The_7       PPFEGPESLGLPAEHIKYTLVVPFNDLNALERVLKDF--DVAAVIMEPVLGSGGCIEPQP
A.C.can_1       WE---TESLGILEEETKYTLPFTFNSIESFTKTFKLCKEDLACVILEPVLGAGGGIPATK
A.T.Nit_3       FPFEAEEGPGLVQDEGQYVESVPFNDLEASLKVLETIKDDLACVIIEPVLGGAGCVPPAK
A.T.Cen_1       WPYDVPESGGLVDE--EHSISIPYNDLEGSLDVLGRAGDDLACVIIEPLLGGGGCIPADE
A.T.Nit_2       WPFTESESSGVVNE--EKIVSIPYNNLEKSLSILKKHSKDLAGVIIEPVLGGGGCIPAES
A.T.Nit_1       WPFSESESSGIVNE--EKIVSIPYNDLENSLKILKKHSKDLAGVIIEPVLGGGGCIPATQ
A.C.Mar_3       WPFSESESSGMVNE--EQIVSIPYNDLENSLSILRKYSKDLAGVIIEPVLGGGGCIPAES
A.C.Mar_4       WPFSESESSGIVNE--EQIVSIPYNDLEKSLPILKKYSKDLAGVIIEPVLGGGGCIPAES
A.C.Mar_2       WPFRKSESSGLTDE--KHIISLPYNNLEKSVKILKMKKNDLAAVIIEPVLGGGGCIPATR
A.C.Mar_1       WPFQKSESGGLVDE--KHIVSLPYNDLENSLSILKSKSNDLAAVIIEPILGGGGCIPATK
T.o.ORF_nu      WPFQKSESKGIADE--KHIVSLPYNDLENSIRILKAVRNNLAAVIIEPVLGGGGCIPATR
                         *:            :*.              :*    **:    * : .  

A.Cre           NFLRKIRKLCDEYGSLLIFDEVITGFRV-SLGGAQELFGIYPDLTCLGKIIGGGLP-VGA
A.E.Hal_1       GYHDTLRELCDDHGSLLIFDEVITGFRVGGLQCAQGAFDIDPDITTFGKIVGGGFP-VGA
A.C.The_11      DFLKTLREETERVGALLIFDEVITGFRL-GLSGAQGRFGVIPDITTLGKIIGGGFP-IGA
A.C.The_14      EFLKALREETERTGAVLIFDEVITGFRL-GLSGAQGHFGVRPDLTTLGKVLGGGFP-IGA
A.C.The_9       DFLQGLRKITKDYGSLLIFDEVITGFRL-SMGGAQKYFNIDADIVTLGKIIGGGFP-VGA
A.C.The_8       EFLRGLREIADRYGSLLIFDEVITGFRL-SMGGAQQYFGVKADIVTLGKIIGGGFP-IGA
A.C.The_12      EFLAALQRLSRESGALLILDEVVTGFRL-GLEGAQGYFNIEGDIIVLGKIIGGGFP-VGA
A.C.The_13      GFLKELRRIADETGALLIFDEVITGYRL-GLGGAQAKFGVVPDLTTLGKIVGGGFP-VGV
A.C.The_1       DFLPGLRKLTREYGSVLIFDEVITGFRL-GLGGAQSYFGVTPDLTTLGKIIGGGFP-IGA
A.C.The_2       GFLSGLRELTKSYNSLLIFDEVITGFRI-DIGGAQSYYQIYPDITTLGKIIGGGFP-IGA
A.C.The_5       SFLEGLRELTRTYNTLLIFDEVITGFRV-GLEGAQGYYTVYPDLTTLGKIIGGGFP-IGA
A.C.The_3       DFLNGLRELTKTYNSVLIFDEVITGFRL-GLSGAQGYFKVIPDLTTLGKIIGGGLP-IGA
A.C.The_4       DFLERLREITLTYNSVLIFDEVITGFRL-GLGGAQGTFNVTPDLTTLGKIIGGGLP-IGA
A.E.The_1       GFLEFLRDITQKHGSLLIFDEVITGYRF-AFSPFQDIMRIDPDITTMGKIIGGGLP-IGL
A.E.Met_6       EFLEFLREITAENGIILIFDEVITGFRI-AKGGAQEYFDVTPDLVTMGKILGGGFP-MGA
A.E.Met_7       DYLKFLREITEENNIILIFDEVITGFRL-SKGGAQEYFGVVPDLVTLGKILGGGFP-IGA
A.E.Met_3       DYLKGLREVTITNDSLLIFDEVITGFRL-SLGGAQEYYNVKPDITTLGKIIGGGLP-IGV
A.E.Met_4       DYLKEVRKITAENDVLLIMDEVICGYRV-GIGGAQVMYDIKPDITTLGKIAGGGLP-MGI
A.E.Met_2       GYLEGVRRITEEHDALLIFDEVITGFRL-ALGGAQSYYRVRADITTLGKIIGGGFP-IGA
A.E.Met_1       NYLKEVRKVTEENDVVLIFDEVITGFRL-AMGGAQEYYNVTPDMTTLGKIVGGGMP-VGV
A.E.Met_5       GYLRAVRNLTKEHGVVLIFDEVVTGFRV-GMFGAQGYFGVEPDMTTLGKIAGGGLP-IGI
A.C.The_10      GYLRELRRIADEAGALLVFDEVITGFRL-ALGGAQEYYNVKADIVVLGKIVGGGMPGAGA
A.C.The_6       GYLKGVRDLADRYGALLIFDEVITGFRL-ALGGAQEYFGVYPDITVLGKIVGGGYPGAGA
A.C.The_7       GYLKGVRELVDRYGALLIFDEVITGFRL-ALGGGQELFNTKADIVTLGKIVGGGYPGAGA
A.C.can_1       DFLSVVREETEKVGAILIFDEIITGFRL-GLGGAQEYYKIDVDLLTYGKIIGGGFP-IGA
A.T.Nit_3       GYLEGLQEFCKKNGALFILDEIVTGFRL-SLHGAQGTYGLEPDLFTLGKICGGGMP-IGV
A.T.Cen_1       DYLRGIQEFVHSRGALLVLDEIVTGFRF-RFGCAYAAAGLDPDIVALGKIVGGGFP-IGV
A.T.Nit_2       DYLKGIQEFCKKNNSLFILDEIVTGFRF-RYGCLYPTMKLDPDIVTLGKIVGGGMA-IGA
A.T.Nit_1       EYLKGIQEFVHKNNSLFILDEIVTGFRF-RYGCLYPTMKLNPDIVTLGKIVGGGMA-IGV
A.C.Mar_3       DYLKGVQEFCKKNNSLFILDEIVTGFRF-RYGCLYPTMKLDPDIVTLGKIVGGGMA-IGV
A.C.Mar_4       DYLKGVQEFCKKNNSLFILDEIVTGFRF-RFGCLYPTMKLDPDIVTLGKIVGGGMA-IGV
A.C.Mar_2       EYLLCIQEFCHKNNILFILDEIVTGFRF-RFGCLYNTMKLDPDLVTLGKIVGGGFP-IGV
A.C.Mar_1       NYLSGIEEFCHKNNSLFILDEIVTGFRF-RFGCVYNTMNLDPDIVTLGKIVGGGFP-IGV
T.o.ORF_nu      EYLTGIEEFCHKNNSLFILDEIVTGFRF-RYGCLYDTMKLDPDIVTLGKIVGGGFP-IGV
                 :   :       . ::::**:: *:*.              *:   **: *** .  * 

A.Cre           YGGKKEIMDLIS------PSGPVY-QAGTLAGNPIVMVAGLAALELLT---KETYESLEK
A.E.Hal_1       IGGKSEIIEQFT------PAGDVF-QSGTFSGHPVTMAAGLETLRYA-AE-HDVYDHVNE
A.C.The_11      FGGRQEVMDLVA------PSGPVY-NAGTFNAHPVSMVAGLATLREL-ER-GYPYEVADR
A.C.The_14      FGGGEEIMDLLA------PQGPVY-NAGTYNAHPVSIAAGLAVLEEL-ET-GRPYEVANK
A.C.The_9       VVSKSEIMDYIT------PEGKVF-NAGTFNAHPITMIAGLYTLEFM-EK-NNVIDKASN
A.C.The_8       VTARSEIMDLLS------PRGPVF-NAGTFNANPVTMSAGLATIETI-EA-TDALSKASK
A.C.The_12      VAGSREVMSLLT------PQGKVF-NAGTFNAHPITMAAGLATLKAL-EE-EPVYSVSRE
A.C.The_13      VGGKREIMEYLT------PSGPVF-NAGTFNAHPVTMAAGLATINEL-ER-GYVYEVANS
A.C.The_1       VCGRKEIMDQLT------PSGRVF-NAGTFNANPISMTAGIATIQEL-EK-KEVYTVSER
A.C.The_2       VAGKAEIIDNFT------PAGRVF-NAGTFNANPISMIAGIATIEEL-EK-EYPYNIANK
A.C.The_5       FGGKREIMENLT------PSGKVF-NAGTFNANPISMVAGIATIEEL-EK-GKAYEIANK
A.C.The_3       VTGKKEIMSNLT------PEGKVF-NAGTFNANPLTMAAGIATIEVL-ET-TNAYDIANK
A.C.The_4       VAGKKEIIDMLT------PAGKVF-NAGTFNANPLTMTAGLATIEVL-ER-ENVHEVANR
A.E.The_1       FGGSEEIMKNIS------PSGNVY-EAGTFSGNPMSMAAGYAAMEKL--S-KQDYSILKK
A.E.Met_6       FAGKKEFMERIA------PQGDVY-QAGTFNGNPISITAGLETMKHL--D-EKFYQESET
A.E.Met_7       IAGKKELMENFS------PNGAIY-QAGTFNGNPVSITAGIETLKCL--N-DSFYTETTK
A.E.Met_3       FGASSEIMSSIS------PVGPVY-QAGTFAGNPLSMSAGIAAIKCL-EK-IN-YSDLNS
A.E.Met_4       FAGRKEIMELVA------PAGPVY-QAGTFSGNPLSVSAGIAALRYIHEN-SGLYDKLDG
A.E.Met_2       VGGRREIMENVA------PQGGIY-QAGTFNGSPVSMAAGLATLDIL-ER--GVLDRINE
A.E.Met_1       FGGKREIMDMVA------PNGNVY-QAGTFSGNPATLSAGIATMDVL-EN-ENVHDTLNK
A.E.Met_5       FGGKKEIMEKVA------PQGGVY-QAGTFNGNPLSLTAGMATVDYL-DK-QRAHIKLNE
A.C.The_10      IASRAEVMELLDQLKRPKGRERSF-HGGTFTGNPVTILTGYHTVKHLADN-RGVYAEFNS
A.C.The_6       FGGRREYMELLDHIKYPDPRARSF-HGGTFTGNLITITAGYTMIRYLYEN-RHLYERFNN
A.C.The_7       IASRSEIMELLDQVKRPSARSRSF-HGGTFTGNRVTLTAGYTLINYLSQH-RSLYEGFNN
A.C.can_1       VAGKSEILNLAD---PNRKNGVCKIGGGTFSANPVSMKAGYLTLKYLYENKDSIYDKINT
A.T.Nit_3       VCGDKDIMSLADPVSIREKEARCAIGGGTFSANPATMVAGLATLDFLRKNERKVYGKVDR
A.T.Cen_1       ICGKDEVMEISN-TISHAKSDRAYIGGGTFSANPATMTAGAAALGELKKRKGTIYPRINS
A.T.Nit_2       MCGKKEIMEFAD-TTGKKKSERSYVGGGTFSANPASMTTGYATLSILKNG-KSIYSKINS
A.T.Nit_1       MCGKKEIMEQAD-TTGKKKSERSYVGGGTFSANPASMTAGFATLNLLKSK-KSTYSKINS
A.C.Mar_3       MCGKKEIMEFAD-TTGKKKSERSYVGGGTFSANPASMVAGYSTLNHLKSK-KSVYTKIND
A.C.Mar_4       MCGKKEIMEFAD-TTDKKKSERSYVGGGTFSANPASMVAGHATLNHLKSK-KAIYSKIND
A.C.Mar_2       ICGKNELMKYAS-TSIFSKTERAYIGGGTFSANPLTMMAGSTMLTIIKNKGNLLYNKLNS
A.C.Mar_1       ICGKNEFMNYAN-TSTFSKSNRAYVGGGTFSANPLTMIAGNSTLTTIKNKGNKLYTKLNS
T.o.ORF_nu      ICGKDEFMNYAD-TSKFLKPNRAYIGGGTFSANPLTMIAGDSTLRMIKNKGNALYERLNM
                  .  : :.                 .**  .    : :*   :                

A.Cre           KASYLEKGIYDIAEEN-GIDIKINRCGSMFSLFFTNKPVK--------------------
A.E.Hal_1       LGDRLRAGLQDILEDQ-APEYTVVGRDSMFKVIFTRDGPDSFDGHCEAGCRQRESCPRFD
A.C.The_11      AAEKMARGLEDLAGRY-GFDVVVKRISSMFQLYFKRGDVK--------------------
A.C.The_14      AAERMARGIEDVAGRY-GFDVVVKQISSMFQLYFKRGDVK--------------------
A.C.The_9       SAKILNELLLDY-----GIEYTINRVESMMQIFFTDKEIN--------------------
A.C.The_8       AAKEIAEYAEAAF----NGAASVNRVESMFQLFFTQRSVV--------------------
A.C.The_12      AAKALEEAASEVLDRT-GLPYTINRVESMMQLFIGVEEVS--------------------
A.C.The_13      AAEKVAKALEQEAVA--KFGGVVHRVASMFQWFPGVEEVN--------------------
A.C.The_1       AARVLAEEIDRAI----KMDHVVNRVYNFFQFFLGVKDVR--------------------
A.C.The_2       ASKTLVEELERLL----KIKHTINHIGSMFQVFFGIDKVR--------------------
A.C.The_5       AVKEISEELDKA-----PLDHVVNSVKSMFQIFFGVKSVE--------------------
A.C.The_3       ASKEIAEELDNSLSKK-NFKYTINRIQSMFQFFIGISKVT--------------------
A.C.The_4       AVNVILEELVNALDKKIPNNFVINHIGSMFQVFFGVKKVS--------------------
A.E.The_1       RTQKLVSGIDDILDRK-HITHTIKYYGTMFQVFF-ADHVN--------------------
A.E.Met_6       SGLKMRRGLENILEDA-SLNYQVAGLSSMFQIYFTQSEVW--------------------
A.E.Met_7       KATILSNHLRDLSDKY-NIETKVYNIASIFQVYFNKNEVL--------------------
A.E.Met_3       LGELMRTSLDKVASEL-NIPHVVQGIGSMFQIFLTSKPVE--------------------
A.E.Met_4       FTKEIEDYLPE------RYRNSFVRLGSMFKLYFRDSPPS--------------------
A.E.Met_2       MGSYLRKGISDIVEDL-KLDYSVSGVASMFKVFF-GPLPR--------------------
A.E.Met_1       KGDEIRSCLSDIISDA-GLDYEVSGISSMFKVFFGKAPT---------------------
A.E.Met_5       SGEALRQALTELLKRM-KLDYSVSGMASMFQVFFGPKPE---------------------
A.C.The_10      LWDSVRRRIQEECESR-DNICWATGTGSIVGIHFTRKRPR--------------------
A.C.The_6       MWRDVARRLDRICEEN-NRICWITNVGSMIGIHFTSRKPRDIG-----------------
A.C.The_7       LWNWAREGLNRACEDH-GRLCWVTGVGSMLGIHFTRDRPV--------------------
A.C.can_1       LGNIARKSIDKILHEA-NINSQTTGIGSIVLTHFLNEEVDIVN-----------------
A.T.Nit_3       LGEMARKGLAKIFADA-GIPCRVTGINSIFLTHFVKEGTKDVE-----------------
A.T.Cen_1       MGDDARDKLSKIF----GNRVSVTGRGSLFMTHFVQDGAGRVS-----------------
A.T.Nit_2       LGEYARKELSKSF----DGKVIVTGKGSLFMTHFTKNRMGQIK-----------------
A.T.Nit_1       LGEYARKEINKVF----DGKVTITGKGSLFMTHFLKDGITKVT-----------------
A.C.Mar_3       LGEHARKELTKVF----DGKVAVTGKGSLFMTHFLQNGITEIK-----------------
A.C.Mar_4       LGKFARKEIGKAF----DGKVAVTGKGSLFMTHFLKDGITEIS-----------------
A.C.Mar_2       FGIETRKMLDKKF----GGSVITTGIGSLFLTHFLNDSIYKIN-----------------
A.C.Mar_1       FGSEARKMLDKKF----GGRVITTGTGSLFLTHFLTPSISEIK-----------------
T.o.ORF_nu      LGSKTRKMLDKKF----AGD----------------------------------------
                                    <=======================================
                                                           <________________                                              

A.Cre           ----NFNDAKNT--KYELYKKIFWIML-KEGVLLPPSPFESIFLTTSHSDDDLENTLEAF
A.E.Hal_1       YCPKTGHDVTQA--ETERWERLFWPAMKDQGVFLTANQFESQFICDAHTGEDIENALEAY
A.C.The_11      ----TPQDVRES--NEKLYLKLHEIAL-SHGVYLTPSQYEVNFTSSMHTDEVVNEALQAL
A.C.The_14      ----TPDDVRRS--DERLYLKLHEIAL-RHGLYLAPSQYEVNFTTSAHTQEVVEWALGSL
A.C.The_9       ----NADDARMA--NKELYTKFHESLI-NKGVFIPPSQFETMFTSYEHNEDIINYTAEKI
A.C.The_8       ----SPDDARAS--DREKYAKFHELMR-KYGVFVPPSQFESQFTSAVHDDEVILTTEEAL
A.C.The_12      ----NAAQARKA--DKKFYVKLHEEML-RRGVFIAPSNLEAVFTGLPHQGEALEIAVEGL
A.C.The_13      ----NYADALKA--NKEISLRLHEELL-KRGVFIAPSLFEAWFTSAAHGEDVVNKTLEAL
A.C.The_1       ----NANDARKA--KRDLYVKVHESLL-KEGVFIPPSQFEALFTSGAHDDDVVNESARVF
A.C.The_2       ----NYSDAKRA--NKEYYIKFHERLL-KERVFIPPSQYETIFTSAAHEDDVVNDTIDKL
A.C.The_5       ----NADDARKA--NKEKYIEFQKALL-DRGVFFPPSQFESVFTSSAHTEEVVNETLDKI
A.C.The_3       ----NADDARLA--NKDLYVKIHEKLL-KLGVFIPPSQFETIFTSSSHSDEIVNLTIEAI
A.C.The_4       ----NATEAKLA--NKEMYQKFHNLLL-QRGVFIPPSQFETIFTSYAHKDVVVNTTLEIL
A.E.The_1       ----NYDDALKA--RKEVYFKLFKALS-KNGVYLPPSQYETNFVSFAHSDSDIDATLAAF
A.E.Met_6       ----DYAQAKTA--DTEKFNTYFQTLL-ANGVFIPPSQFECCFLSQAHSPEDIQITLEAM
A.E.Met_7       ----NYDIAKES--NTELFNKYFFGLL-NNGVFIAPSQFECCFTSIAHKEEDLTNTMNAM
A.E.Met_3       ----NYADALTC--DSAGFMKLFQGLL-DEGIYVPPSQYETSFVSTAHTSSDISRTADAF
A.E.Met_4       ----NYVEAKQS--DTEKFGKFWKGML-KEGIFLPPSQFETNFVSAAHTTGDIEKISEAY
A.E.Met_2       ----NYSEALRC--DKEGYLRFFWRML-EAGIFLTPSQYETDFISASHDKEIIDKTLEAF
A.E.Met_1       ----NYQETLKC--DKSGYFDFFKRML-NDGIFLPPSQFETNFLSYAHSDSDIQKLLNAY
A.E.Met_5       ----NYQQALRC--NKALYDKFWSHML-ENGVFLPPSQFETCFLSTAHERGDVEDTLRAF
A.C.The_10      ----TAREALEERWSNKVYEVMHMYMR-LNGILYMTEHMAHLLPSMAHSRRDADRFIEVF
A.C.The_6       ----EAYRLRLC--S-EIYKALHLYMR-INRILYLSEKMPHLMPSMVHTEEQANRFVDVF
A.C.The_7       ----NARVAYTDRINEDLYHLTHLYMR-TRGILYMTEHMPHLLPSMIHTREHANTLVEEF
A.C.can_1       ----SYEDALKC--DKELQHLYYLYLMTEHNIFFLPGHIGTI--SNAHTDTDIQKLTSAT
A.T.Nit_3       ----NATDVATS--DRGKLVKYHMALMAEHGVFFLPTKMGAM--SYAHDEADVKKLLSAT
A.T.Cen_1       ----NAADAAAC--DVELLHRYHLDMITRDGIFFLPGKLGAI--SAAHSKADLKTMYSAS
A.T.Nit_2       ----NSADAAQC--DTKKLQKYHFQMISKDKIFFLPGKLGAI--SNAHSKEDIKKMILAS
A.T.Nit_1       ----NSADVAKC--DSQMLAKYHFKMIAHDGIFFLPGKLGAI--SDAHSKEDIKKMIKAS
A.C.Mar_3       ----NSTDAAKC--NGALLSKYHFKMISHDGIFFLLGKLGAI--SDAHSKSDIKNMVKAS
A.C.Mar_4       ----NSTQAAKC--DETLLSKYHFKMISHDGIFFLPGKLGAI--SDAHSKSDIKNMVKAS
A.C.Mar_2       ----NATDAAKC--NTKKLHDYHFHMIANDGIFFLPGKLGAY--SDAHTKSDINAIAKST
A.C.Mar_1       ----NATHAAKC--DIKKLHDYHFHMIANDKIFFLPGKLGAF--SDIHTKSDITNIAKST
T.o.ORF_nu      ------------------------------------------------------------
                ============================================================                                                            
                ___>


A.Cre           HSAFHSIPHE---------
A.E.Hal_1       KEAI---------------
A.C.The_11      ELAFRKLKLVGSS------
A.C.The_14      EKSFRELKSAL--------
A.C.The_9       KEVIKGM------------
A.C.The_8       RKAASELK-----------
A.C.The_12      RSSLKTVLGS---------
A.C.The_13      SEALKVIS-----------
A.C.The_1       KKVLEDLT-----------
A.C.The_2       AKVIGELS-----------
A.C.The_5       RKVLSEMR-----------
A.C.The_3       HKVVSEI------------
A.C.The_4       RKVVQEL------------
A.E.The_1       EKAVAEMD-----------
A.E.Met_6       EKGIKAAEK----------
A.E.Met_7       DKAFKSLK-----------
A.E.Met_3       FKVMSEVLR----------
A.E.Met_4       CKCL---------------
A.E.Met_2       KLFLKG-------------
A.E.Met_1       ESNLKQS------------
A.E.Met_5       IKSCGALK-----------
A.C.The_10      ASFLDEIYRLVKKGALSTF
A.C.The_6       RGFVEDIYRSR--------
A.C.The_7       KGLLSEIVHK---------
A.C.can_1       LDFALNIKHILRTIS----
A.T.Nit_3       EKIASSGLLK---------
A.T.Cen_1       ERFAEGL------------
A.T.Nit_2       EESES--------------
A.T.Nit_1       EDFRF--------------
A.C.Mar_3       EEFTC--------------
A.C.Mar_4       EEFTC--------------
A.C.Mar_2       DKFLTKFKK----------
A.C.Mar_1       DKFLTRFKK----------
T.o.ORF_nu      -------------------
                ==================>                   

b) Gblocks

Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 34
Alignment assumed to be: Protein
New number of positions: 238 (selected positions are underlined in blue)

                 <==============================================>
                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  -------------------MAKSKDHKSILDKAKKYLVGGVNSPVRSFIYVGGEPIVIES
Arc_Eur_Hal_1_[  --------------------MNHEQSRALYDRALSVLSGGVNSSVRATR---PYPFFVEK
Arc_Cre_The_11   ---------------------------MLWDRARAIFPGGVNSPARALRHL-QSPLIAER
Arc_Cre_The_14   --------------------------MDIWERAKAVFPGGVNSPARALKHL-ARPLVALG
Arc_Cre_The_9_[  ---------------------MAESSRELFEEAKKIFPGGVNSPVRAAVK--PYPFFVKY
Arc_Cre_The_8_[  ---------------------MLGMSKELYEEASKFLVGGVDSPVRAAVR--PYPFFVKE
Arc_Cre_The_12   --------------GHMDVLASGEKSRMLFERTKELFPGGVNSPVRAAVK--PYPFYVKR
Arc_Cre_The_13   ----------------------MDRSLELFQIAKNLFPGGVNSPIRAAVK--PYPFYVKK
Arc_Cre_The_1_[  ------------------------MSSDLWNKAQAVFAGGVNSPVRAAVK--PFPFYTRS
Arc_Cre_The_2_[  ---------------MDKGRCTILNSEELWAQARQLFAGGVNSPVRAAVK--PFPFYVER
Arc_Cre_The_5_[  ----------------MAKRGVTVLSSELWKNALELFPGGVNSPVRAAVK--PFPFYTKE
Arc_Cre_The_3_[  ------------------------MSENLWKKALELFAGGVNSPVRAAVK--PYPFYVEK
Arc_Cre_The_4_[  ------------------------MSEKYWNIASHYFAGGVNSPVRAAVK--PYPFYVER
Arc_Eur_The_1_[  -----------------------MSSKELFELAAKLFPMGVNSPVRYFK---DYPFYVKE
Arc_Eur_Met_6_[  -----------------------MKSEDLFKDAKNYLPGGVDSPVRAIK---PYPFFALK
Arc_Eur_Met_7_[  -----------------MYTIKTEKSEKLYNEAKKCLVGGVNSPVRAFK---PYPFFVKS
Arc_Eur_Met_3_[  --------------------MTSERSKSLYEKSSALLPGGVSSPVRAFK---PYPRFIKS
Arc_Eur_Met_4_[  -----------------------MKSSELFDIAKTLIPGGVSSPVRAIK---PYPFYTKR
Arc_Eur_Met_2_[  ----------MIRSHVSADTMNLNSSRSLYERAKRLMPGGVSSPVRAIR---PYPFYVKR
Arc_Eur_Met_1_[  ------------------MEGENTKSKQLYEQAKKIISGGVSSPVRAIQ---PYPFYTES
Arc_Eur_Met_5_[  --------------------MKLDTSRALFEEALQVMPGGVSSPVRAAK---PFPFYTKS
Arc_Cre_The_10   MVQLEEKLEEWWARLASEYEKRTPRSRELFERARRVLPGGTTYHIRFFK---PYPVFIEH
Arc_Cre_The_6_[  MVLDKELLYRRIAEYEEKYLLMTPMSRELFERARRVLPGGVVYATRFME---PYPVYISR
Arc_Cre_The_7_[  MSNLSGRVQELIDKYTKIYMEGTSKSRELFERARKVLPGGTTYQIRHFS---PYPVYITR
Arc_Cre_can_1_[  ------------MNLIEKYISKTRKSKELFERAKSHFAGGINHNARFYK---PYPIFVNK
Arc_Tha_Nit_3_[  -------MNDYYGNYIRRYEAKTGKSRRLYSRSEKLFPGGISHNIRYFE---PYPFFVNA
Arc_Tha_Cen_1_[  ------------MDLEREYRAKTGGSARIFARSKKYHVGGVSHNIRFYE---PYPFVTRS
Arc_Tha_Nit_2_[  ----------MVLDYIKNYKKKTHKSSILFSKSSKFHVNGVSHNIRYYA---PYPFVVKS
Arc_Tha_Nit_1_[  ---------MLLSSYLSEYKKKTKRSAKIFAKSSKLHVNGVSHNIRFYE---PYPFVVKS
Arc_Cre_Mar_3_[  --------MNLLLDYIKEYKKKTPTSAKLFAKSAKLHVNGVSHNIRFYE---PYPFVVKK
Arc_Cre_Mar_4_[  --------MNLLLDYIKEYKKKTPTSAKLFAKSAKLHINGVSHNIRFYE---PYPFVVKK
Arc_Cre_Mar_2_[  ----------MRMEDTKTYRLKTGKSAKLFEKSKKYHVDGVHHNIRFFE---PYPFVTKS
Arc_Cre_Mar_1_[  ----------MIKNDLKLYTKNTKKSAKLFQKSKKLHINGVHHNIRFFE---PYPFITKS
Translation_of   ------------------------------------------------E---PYPFVTKS
                                                                     ########


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  GKGSKIKDIEGREYIDYICSWGAIIHGHA-NEYIENRIIEAVKRGNNFGLTTEFEVELAE
Arc_Eur_Hal_1_[  GDGGHVIDADGNRYIDFVMGYGPLLLGHSLPEQVQSAIQRHAAEGPMYGAPTEVEVELAE
Arc_Cre_The_11   GEGAYLYT-DRGKLVDFCMGFGPLILGHR-PKPVLDAVKAWLERGWLYAMLTEPEVELGE
Arc_Cre_The_14   ADGPYLYT-DRGRLVDFCSAFGAIILGHN-NPRVREAVERQLRSGWIYALLTEQEVALAE
Arc_Cre_The_9_[  AKGAYVYTEEGNRLIDYVLGYGPLILGHA-NDYVLNKIKEGLNNGWLFGAPNKNEINLGK
Arc_Cre_The_8_[  GVGPYIITEDNEKLVDYVLGYGPLILGHA-NEAVKRRVIEQIERGWLYGTPTRVELELAK
Arc_Cre_The_12   GEGAYLYTVDGARIVDLVLAYGPLILGHK-HPRVLEAVEEALARGWLYGAPGEAEVLLAE
Arc_Cre_The_13   ASGATLVTVDGVELIDYVLGYGPLILGHM-HPKVLEAVEEQLNRGWLYGTPHELEIELAK
Arc_Cre_The_1_[  AKGAYLVTEDSRRLIDFVLGYGPLILGHA-HPKVIEAVKDQLERGWLYGTPSRAEVELAS
Arc_Cre_The_2_[  GKGAYIYTVEGNKFIDYVLGYGPLILGHS-PESVKRKIIEQLEKGWLFGTPSKLEIELAK
Arc_Cre_The_5_[  GRGAFLITEDGRKLIDFVLGYGPLILGHS-PPRVKEKVIEQIEKGWLYGTPSRAEVELAR
Arc_Cre_The_3_[  SEGAFLYTIDGQRLIDYVLGYGPLILGHA-HPYVKKKIIEQIEKGWLYGTPSKKEIELAE
Arc_Cre_The_4_[  AEGAYLYTADNKQLIDYVLGYGPLILGHA-NQYVTKKIIEQVNKGWLYGTPSPIEIELAR
Arc_Eur_The_1_[  GKGSTILDVDGNKYIDYCLGYGPLILGHS-DPDVTRAVIEQAEKGLLFGEPSENEIKLAE
Arc_Eur_Met_6_[  AEGPRLFDVDGNSYLDYCLAYGPLVLGHA-YPPVMETVSKQLSNGSAYGVPTENEIKLAK
Arc_Eur_Met_7_[  ANGCHLIDEDDNTYIDYCLAYGPMVLGHA-NQEVLYKVREQMDLGTAYGVPAKKEIELAK
Arc_Eur_Met_3_[  GKGSRIIDVDDNEYIDYCMAFGPLILGHS-NDVISSAVAEQLSKGTLFGAPSELEIEFAE
Arc_Eur_Met_4_[  ANGSRIYTEDGDELIDCCMGYGPLLLGHC-HPVVKAAIEEQATNGWLYGTPTEKEIELAK
Arc_Eur_Met_2_[  AEGPYLWDEDGNSFIDYCLAYGPMILGHR-NPEVMRKVEEQIERGWLYGTPTALEVELAE
Arc_Eur_Met_1_[  AQGSRIKDVDGNEYIDFCMGYGPNLLGHA-HPEIKQAIAEQLDNGWLYGTPLENEVKLAE
Arc_Eur_Met_5_[  AKGCRLTDADGNGYIDFCMGYGPLILGHQ-PAPVKDAIGKQLDEGWLYGTPCELEVRYAR
Arc_Cre_The_10   GLGPRVWDVDGNEYTDYWMGHGALILGHC-PDLLEEAVRKALKASSHLGYENPYALEYAE
Arc_Cre_The_6_[  AKGSKVVDVDGNGYDDYWMGHGTHILGHS-PSFIVEAVNRVSMNGTHLGFENPYAVEYAE
Arc_Cre_The_7_[  AGGARVWDVDGNEYVDYWMGHGTHILGHS-PDFVVKAVNDAAYEGTHLGYPNTLEVEYAE
Arc_Cre_can_1_[  AKGNRIYDVDRNEYIDFWMGHASLILGHS-PDFIMNEIKEQIYNGTIYGVPSEDAILLAE
Arc_Tha_Nit_3_[  ARGKSLSDVDGNRYTDYWMGHWALILGHS-PAPVASALARQVKNGTLYGVVNDVSVELAE
Arc_Tha_Cen_1_[  ASGKHLVDVDGNKYVDYWMGHWSLILGHA-PAPVRSAVEGQLRRGWIHGTVNEQTMNLSE
Arc_Tha_Nit_2_[  ATGKNLVDVDGNKYVDYWMGHWSLILGHA-PTKVKESLRKQIEKGWMYGTVNEQTILLSE
Arc_Tha_Nit_1_[  SNGTNLVDVDDNKYTDYWMGHWSLILGHG-QKNVKESLKKQIEKSWMYGTVNEQTVKLSE
Arc_Cre_Mar_3_[  SLGKNLVDVDGNKYTDYWMGHWALILGHG-PKSVRKNLQKQIERSWMYGTVNEQTILLSE
Arc_Cre_Mar_4_[  SAGKNLVDVDGNKYTDYWMGHWALILGHG-PNSVKKNLQKQIEKSWMYGTVNEQTILLSE
Arc_Cre_Mar_2_[  ANRKFLIDVDSNKYVDYWMGHWSLILGHT-QKKIASQIKKQLSYDWMHGTLNKNSIELSE
Arc_Cre_Mar_1_[  SKGKFLIDIDSNKYVDYWMGHWSLILGHS-PKNIVNSAKKQLNNGWMHGTASKNSIELSE
Translation_of   SNGKFLIDVDSNKYIDYWMGHWSLILGHS-PKNVLHDVRIQLNSGWMHGTLSKNTIKLSE
                 ######## ###################     ###########################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  RICNMVKSIEKIRFVNSGTEATMSAIRLARAYTNRDLIIKFEGCYHGHSDHFLSKAGSGL
Arc_Eur_Hal_1_[  FVTRHVPSVEMLRFVNSGTEATVSAVRLARGYTGRDKIVVMQSGYHGAQESTLV---EGE
Arc_Cre_The_11   TIIRHVPSVKKIRFVSTGTEATMNAVRLARGYTKRDVIIKFEGNFHGSHDYVLVKAGSGA
Arc_Cre_The_14   KIRSHMPSIRKIRFVNTGTEATMNAIRLARGYTKRDVIIKFDGNFHGSHDYVLVKAGSGA
Arc_Cre_The_9_[  KIISYVKPGGKIRYVNSGTEATMTAIRLARGYTNRKYLVKFDGCYHGSHDSVLVQAGSAA
Arc_Cre_The_8_[  KVVSYVMPGGKVRFVNSGTEATMTAIRLARGFTGRNKIMKFDGCYHGAHDYVLVQAGSAA
Arc_Cre_The_12   KILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAA
Arc_Cre_The_13   KIVSHYPSIDMVRFVNSGTEATMTAIRLARGFTKKNKIIKFDGCYHGAHDSVLVKAGSAV
Arc_Cre_The_1_[  MITKHVPSAQKVRFVNSGTEATMTALRLSRGFTGRSKILKFDGNYHGAHDYVLIDAGSAA
Arc_Cre_The_2_[  KISSHIPSAQKIRFVNSGTEATMAAIRLARGYSKRSKILKFSGNYHGAHDYTLVEAGSAA
Arc_Cre_The_5_[  KITSHMHSIEKIRFVNSGTEATMNAIRLARGFTKREKIIKFDGNYHGAHDYVLASAGSAA
Arc_Cre_The_3_[  KIRSHIPSAEKIRFVNSGTEATMLAIRLARGYTKREKILKFDGNYHGAHDYALINAGSAV
Arc_Cre_The_4_[  KISHHLPSAQKIRFVNSGTEATMLALRLARAYTGREKIIKFHGNYHGAHDYLLLDAGSAF
Arc_Eur_The_1_[  MIKETSKNIEMMRFTNSGTEATMHAIRLARAITGRKLIVKMEGGFHGAHDYSLIKSGSGT
Arc_Eur_Met_6_[  EVVKRVPCADMVRFVNSGTEATMSAIRLARAVTGKNKILKFEGAYHGAHDYVLVKSGSGA
Arc_Eur_Met_7_[  EVINRIPCAEMVRFVNSGTEATMSAIRLARGITGKNKIIKFDGAYHGAHDYVLVKSGSGA
Arc_Eur_Met_3_[  SVCRHFPSIEMLRPVSTGTEATMHAIRLARGYTGKKKIIKMEGGFHGAHDSVLVKAGSGA
Arc_Eur_Met_4_[  IIACDHPSIDMCRFVSSGSEATMAAIRLARGYTNKKDIIKVEGGFHGAHDGVLIQAGSGA
Arc_Eur_Met_2_[  RIISHYPSIEMIRFVSTGTEATMAALRIARGFTGKDKIVKIEGGFHGAHDSVLVKAGSGA
Arc_Eur_Met_1_[  KVTDAYPSMDMLRFVSSGSEATMSAIRTARGYTGKNKILKIEGGFHGTHDSVLVKAGSGA
Arc_Eur_Met_5_[  KIRNYYPGMQMMRFVSTGGEATMSAIRAARGYTGRDKVVKIEGGFHGAHDGVLVKAGSGA
Arc_Cre_The_10   LLVQVLPGVEQVRFTNSGTEANMYAVRLARAYTGRKYIIKLEGAWHGGYDALHV---GVT
Arc_Cre_The_6_[  LLTKIIPSVEMVRFCNSGTEANMYAVRLARAYTKRRYVIKIEGGWHGGLDQLHT---AVT
Arc_Cre_The_7_[  LLTKVVPNVDMVRFSNSGTEANMYAVRLARAYTGHRYVVKMEGGWHGGYDGLHV---GIN
Arc_Cre_can_1_[  MIKKCVKSVEKIRFCNSGAEATMYAIRLARAFTKKRYVLKVRGGWHGYNTPLSR----NV
Arc_Tha_Nit_3_[  AIQKLMPRAEMMRFSSTGSEATMYAVRLARAKTGRRVIAKAIGGWHGFNTTLMQ---TVN
Arc_Tha_Cen_1_[  IIRGAVSVAEKTRYVTSGTEAVMYAARLARAHTGRKIIAKADGGWHGYASGLLK---SVN
Arc_Tha_Nit_2_[  LISKAVPVAEKIRYVTSGTEATMYSVRLARSVTGKKIIAKIDGGWHGYTSDLLK---SVN
Arc_Tha_Nit_1_[  MISKAVPVAEKIRYVTSGTEATMYAVRLARSVTEKKIIAKIDGGWHGYTSDLLK---SVN
Arc_Cre_Mar_3_[  LISKAVPVAEKIRYVTSGTEATMYAVRLARSMTGKKVIAKIDGGWHGYTSDLLK---SVN
Arc_Cre_Mar_4_[  LISKVVPVAEKIRYVTSGTEATMYAVRLARSVTGKKIIAKIDGGWHGYTSDLLK---SVN
Arc_Cre_Mar_2_[  KISKAVPVAEKIRYASTGTEATMYAVRLARTITKRKTIAKIDGGWHGYTTDLLK---TVN
Arc_Cre_Mar_1_[  KISKVVPVAEKIRYASTGTEATMYAIRLARTATKRKIIAKIDGGWHGYTTDLLK---TIN
Translation_of   KISKAVPVAEKIRYATTGTEATMYAVRLARTATRKKVIAKIDGGWHGYTTDLLK---TVN
                 #####################################################       


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  ATYDIPLSPGVPKGVVENTLTLPYNDEEKIEKAFEKAGNKIACVIIEPVAGNMGVVLPNL
Arc_Eur_Hal_1_[  GDHTAPSSPGIPESFAEHTLTVPFNDEEAAHEVFEEHGDDIAAVLTEPILGNYGIVHPVE
Arc_Cre_The_11   ATWGIPTSAGIPADVAKLTVVVPYNDVEAFRKAIREVGDRLAAVIVEPVAGNYGLIIPDI
Arc_Cre_The_14   ATWGIPTSAGIPADVVKLTVVVPYNDVEAFVRAVREVGDRLAAVIAEPVAGNYGLIIPDK
Arc_Cre_The_9_[  TEFGVPNTLGVPNDVAKLTLVAKYNDLNSLENIFRNYGDEIAAVIVEPVIGNMGVIKPNK
Arc_Cre_The_8_[  SEYGVPNSRGVPPQVAALTVVAKYNDLESADRAAKAAGDDLAAIIVEPVIGNMGVIPPDR
Arc_Cre_The_12   AHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRR
Arc_Cre_The_13   SHFGVPGSAGVPEEVSKLTLVVPFNDVEAVEKVAKENQDDLAAIIVEPVMGNAGVIPPKE
Arc_Cre_The_1_[  SEFGVPFSQGIPTEVSSTVLVCPYNDLTCVETVLKR--EEIAGVIVEPVMGNMGVIPPEK
Arc_Cre_The_2_[  TEYNVTTSDGIPMEIMKTIEICEFNDLDCVDKKLRN--EDIAAALLEPIMGNAGVILPEK
Arc_Cre_The_5_[  TEFSVPDSDGIPKDVLKTVIVCPYNQLECVEKHLKN--EDVAAVIVEPIMGNMGVIPANQ
Arc_Cre_The_3_[  SEFNVIISSGIPTSIINTVIVCKYNDLDCVEKHLRT--EEIAGVIVEPVMGNMGVILPEQ
Arc_Cre_The_4_[  TEFNVNVYNGIPKSIVNTIRICEYNDAECVEKLSKS--EDIAGVIVEPVMGNMGVILPDK
Arc_Eur_The_1_[  LTFGSPSSPGIPDEVAQTVIVGKYNDENNIKEIFQKYGDKIAAVITEPIMGNAGVILPKQ
Arc_Eur_Met_6_[  A--GLPDSPGVPEETTKNTLLAPFNDAEAITSLVKKEKDDLAAIILEPVMGNVGCIPPKR
Arc_Eur_Met_7_[  LTHGSPNSPGIPADTTKNTILLPFNNRELMEKTIYEQKDEIACIIVEPVMGNVGCILPND
Arc_Eur_Met_3_[  LTHSVPNSAGIPEESTRNTILVPFNDLNAIEEAFKSNRGEIAAVITEPVMGNTGPILPKK
Arc_Eur_Met_4_[  LTMGVPDSAGVIPDVVSHTMQVPYNDIESLEEILSKN-KDIAAFILEPVMGNVGPVLPEK
Arc_Eur_Met_2_[  TTIGVPDSKGVPADTAKNTVLVPYNDIQAMEAALRE--DDVAAVIMEPVLGNIGPVLPMD
Arc_Eur_Met_1_[  TTLGKPNSKGVPEEVTKHTLQAPFNDIESMTELIEKNRDDMAAVIMEPVMGNIGPILPKE
Arc_Eur_Met_5_[  ATMGVPDSLGVPKDFTKHTLQVPFNDIRAMEAALESNKDQVACVIMEPVMCNMGPILPKE
Arc_Cre_The_10   PPYEGPESLGLPEESIKYTLVAPFNDAGAVERLVKRY--EVAAIWVEPVLGAGGGIEPEP
Arc_Cre_The_6_[  PPFTGPESAGLPEDFTKYTISVPFNDLDAMERALKSY--DVAAIIMEPVPGAGGCIEPLD
Arc_Cre_The_7_[  PPFEGPESLGLPAEHIKYTLVVPFNDLNALERVLKDF--DVAAVIMEPVLGSGGCIEPQP
Arc_Cre_can_1_[  WE---TESLGILEEETKYTLPFTFNSIESFTKTFKLCKEDLACVILEPVLGAGGGIPATK
Arc_Tha_Nit_3_[  FPFEAEEGPGLVQDEGQYVESVPFNDLEASLKVLETIKDDLACVIIEPVLGGAGCVPPAK
Arc_Tha_Cen_1_[  WPYDVPESGGLVDE--EHSISIPYNDLEGSLDVLGRAGDDLACVIIEPLLGGGGCIPADE
Arc_Tha_Nit_2_[  WPFTESESSGVVNE--EKIVSIPYNNLEKSLSILKKHSKDLAGVIIEPVLGGGGCIPAES
Arc_Tha_Nit_1_[  WPFSESESSGIVNE--EKIVSIPYNDLENSLKILKKHSKDLAGVIIEPVLGGGGCIPATQ
Arc_Cre_Mar_3_[  WPFSESESSGMVNE--EQIVSIPYNDLENSLSILRKYSKDLAGVIIEPVLGGGGCIPAES
Arc_Cre_Mar_4_[  WPFSESESSGIVNE--EQIVSIPYNDLEKSLPILKKYSKDLAGVIIEPVLGGGGCIPAES
Arc_Cre_Mar_2_[  WPFRKSESSGLTDE--KHIISLPYNNLEKSVKILKMKKNDLAAVIIEPVLGGGGCIPATR
Arc_Cre_Mar_1_[  WPFQKSESGGLVDE--KHIVSLPYNDLENSLSILKSKSNDLAAVIIEPILGGGGCIPATK
Translation_of   WPFQKSESKGIADE--KHIVSLPYNDLENSIRILKAVRNNLAAVIIEPVLGGGGCIPATR
                                 ##################     #####################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  NFLRKIRKLCDEYGSLLIFDEVITGFRV-SLGGAQELFGIYPDLTCLGKIIGGGLP-VGA
Arc_Eur_Hal_1_[  GYHDTLRELCDDHGSLLIFDEVITGFRVGGLQCAQGAFDIDPDITTFGKIVGGGFP-VGA
Arc_Cre_The_11   DFLKTLREETERVGALLIFDEVITGFRL-GLSGAQGRFGVIPDITTLGKIIGGGFP-IGA
Arc_Cre_The_14   EFLKALREETERTGAVLIFDEVITGFRL-GLSGAQGHFGVRPDLTTLGKVLGGGFP-IGA
Arc_Cre_The_9_[  DFLQGLRKITKDYGSLLIFDEVITGFRL-SMGGAQKYFNIDADIVTLGKIIGGGFP-VGA
Arc_Cre_The_8_[  EFLRGLREIADRYGSLLIFDEVITGFRL-SMGGAQQYFGVKADIVTLGKIIGGGFP-IGA
Arc_Cre_The_12   EFLAALQRLSRESGALLILDEVVTGFRL-GLEGAQGYFNIEGDIIVLGKIIGGGFP-VGA
Arc_Cre_The_13   GFLKELRRIADETGALLIFDEVITGYRL-GLGGAQAKFGVVPDLTTLGKIVGGGFP-VGV
Arc_Cre_The_1_[  DFLPGLRKLTREYGSVLIFDEVITGFRL-GLGGAQSYFGVTPDLTTLGKIIGGGFP-IGA
Arc_Cre_The_2_[  GFLSGLRELTKSYNSLLIFDEVITGFRI-DIGGAQSYYQIYPDITTLGKIIGGGFP-IGA
Arc_Cre_The_5_[  SFLEGLRELTRTYNTLLIFDEVITGFRV-GLEGAQGYYTVYPDLTTLGKIIGGGFP-IGA
Arc_Cre_The_3_[  DFLNGLRELTKTYNSVLIFDEVITGFRL-GLSGAQGYFKVIPDLTTLGKIIGGGLP-IGA
Arc_Cre_The_4_[  DFLERLREITLTYNSVLIFDEVITGFRL-GLGGAQGTFNVTPDLTTLGKIIGGGLP-IGA
Arc_Eur_The_1_[  GFLEFLRDITQKHGSLLIFDEVITGYRF-AFSPFQDIMRIDPDITTMGKIIGGGLP-IGL
Arc_Eur_Met_6_[  EFLEFLREITAENGIILIFDEVITGFRI-AKGGAQEYFDVTPDLVTMGKILGGGFP-MGA
Arc_Eur_Met_7_[  DYLKFLREITEENNIILIFDEVITGFRL-SKGGAQEYFGVVPDLVTLGKILGGGFP-IGA
Arc_Eur_Met_3_[  DYLKGLREVTITNDSLLIFDEVITGFRL-SLGGAQEYYNVKPDITTLGKIIGGGLP-IGV
Arc_Eur_Met_4_[  DYLKEVRKITAENDVLLIMDEVICGYRV-GIGGAQVMYDIKPDITTLGKIAGGGLP-MGI
Arc_Eur_Met_2_[  GYLEGVRRITEEHDALLIFDEVITGFRL-ALGGAQSYYRVRADITTLGKIIGGGFP-IGA
Arc_Eur_Met_1_[  NYLKEVRKVTEENDVVLIFDEVITGFRL-AMGGAQEYYNVTPDMTTLGKIVGGGMP-VGV
Arc_Eur_Met_5_[  GYLRAVRNLTKEHGVVLIFDEVVTGFRV-GMFGAQGYFGVEPDMTTLGKIAGGGLP-IGI
Arc_Cre_The_10   GYLRELRRIADEAGALLVFDEVITGFRL-ALGGAQEYYNVKADIVVLGKIVGGGMPGAGA
Arc_Cre_The_6_[  GYLKGVRDLADRYGALLIFDEVITGFRL-ALGGAQEYFGVYPDITVLGKIVGGGYPGAGA
Arc_Cre_The_7_[  GYLKGVRELVDRYGALLIFDEVITGFRL-ALGGGQELFNTKADIVTLGKIVGGGYPGAGA
Arc_Cre_can_1_[  DFLSVVREETEKVGAILIFDEIITGFRL-GLGGAQEYYKIDVDLLTYGKIIGGGFP-IGA
Arc_Tha_Nit_3_[  GYLEGLQEFCKKNGALFILDEIVTGFRL-SLHGAQGTYGLEPDLFTLGKICGGGMP-IGV
Arc_Tha_Cen_1_[  DYLRGIQEFVHSRGALLVLDEIVTGFRF-RFGCAYAAAGLDPDIVALGKIVGGGFP-IGV
Arc_Tha_Nit_2_[  DYLKGIQEFCKKNNSLFILDEIVTGFRF-RYGCLYPTMKLDPDIVTLGKIVGGGMA-IGA
Arc_Tha_Nit_1_[  EYLKGIQEFVHKNNSLFILDEIVTGFRF-RYGCLYPTMKLNPDIVTLGKIVGGGMA-IGV
Arc_Cre_Mar_3_[  DYLKGVQEFCKKNNSLFILDEIVTGFRF-RYGCLYPTMKLDPDIVTLGKIVGGGMA-IGV
Arc_Cre_Mar_4_[  DYLKGVQEFCKKNNSLFILDEIVTGFRF-RFGCLYPTMKLDPDIVTLGKIVGGGMA-IGV
Arc_Cre_Mar_2_[  EYLLCIQEFCHKNNILFILDEIVTGFRF-RFGCLYNTMKLDPDLVTLGKIVGGGFP-IGV
Arc_Cre_Mar_1_[  NYLSGIEEFCHKNNSLFILDEIVTGFRF-RFGCVYNTMNLDPDIVTLGKIVGGGFP-IGV
Translation_of   EYLTGIEEFCHKNNSLFILDEIVTGFRF-RYGCLYDTMKLDPDIVTLGKIVGGGFP-IGV
                 ############################   ######################### ###


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  YGGKKEIMDLIS------PSGPVY-QAGTLAGNPIVMVAGLAALELLT---KETYESLEK
Arc_Eur_Hal_1_[  IGGKSEIIEQFT------PAGDVF-QSGTFSGHPVTMAAGLETLRYA-AE-HDVYDHVNE
Arc_Cre_The_11   FGGRQEVMDLVA------PSGPVY-NAGTFNAHPVSMVAGLATLREL-ER-GYPYEVADR
Arc_Cre_The_14   FGGGEEIMDLLA------PQGPVY-NAGTYNAHPVSIAAGLAVLEEL-ET-GRPYEVANK
Arc_Cre_The_9_[  VVSKSEIMDYIT------PEGKVF-NAGTFNAHPITMIAGLYTLEFM-EK-NNVIDKASN
Arc_Cre_The_8_[  VTARSEIMDLLS------PRGPVF-NAGTFNANPVTMSAGLATIETI-EA-TDALSKASK
Arc_Cre_The_12   VAGSREVMSLLT------PQGKVF-NAGTFNAHPITMAAGLATLKAL-EE-EPVYSVSRE
Arc_Cre_The_13   VGGKREIMEYLT------PSGPVF-NAGTFNAHPVTMAAGLATINEL-ER-GYVYEVANS
Arc_Cre_The_1_[  VCGRKEIMDQLT------PSGRVF-NAGTFNANPISMTAGIATIQEL-EK-KEVYTVSER
Arc_Cre_The_2_[  VAGKAEIIDNFT------PAGRVF-NAGTFNANPISMIAGIATIEEL-EK-EYPYNIANK
Arc_Cre_The_5_[  FGGKREIMENLT------PSGKVF-NAGTFNANPISMVAGIATIEEL-EK-GKAYEIANK
Arc_Cre_The_3_[  VTGKKEIMSNLT------PEGKVF-NAGTFNANPLTMAAGIATIEVL-ET-TNAYDIANK
Arc_Cre_The_4_[  VAGKKEIIDMLT------PAGKVF-NAGTFNANPLTMTAGLATIEVL-ER-ENVHEVANR
Arc_Eur_The_1_[  FGGSEEIMKNIS------PSGNVY-EAGTFSGNPMSMAAGYAAMEKL--S-KQDYSILKK
Arc_Eur_Met_6_[  FAGKKEFMERIA------PQGDVY-QAGTFNGNPISITAGLETMKHL--D-EKFYQESET
Arc_Eur_Met_7_[  IAGKKELMENFS------PNGAIY-QAGTFNGNPVSITAGIETLKCL--N-DSFYTETTK
Arc_Eur_Met_3_[  FGASSEIMSSIS------PVGPVY-QAGTFAGNPLSMSAGIAAIKCL-EK-IN-YSDLNS
Arc_Eur_Met_4_[  FAGRKEIMELVA------PAGPVY-QAGTFSGNPLSVSAGIAALRYIHEN-SGLYDKLDG
Arc_Eur_Met_2_[  VGGRREIMENVA------PQGGIY-QAGTFNGSPVSMAAGLATLDIL-ER--GVLDRINE
Arc_Eur_Met_1_[  FGGKREIMDMVA------PNGNVY-QAGTFSGNPATLSAGIATMDVL-EN-ENVHDTLNK
Arc_Eur_Met_5_[  FGGKKEIMEKVA------PQGGVY-QAGTFNGNPLSLTAGMATVDYL-DK-QRAHIKLNE
Arc_Cre_The_10   IASRAEVMELLDQLKRPKGRERSF-HGGTFTGNPVTILTGYHTVKHLADN-RGVYAEFNS
Arc_Cre_The_6_[  FGGRREYMELLDHIKYPDPRARSF-HGGTFTGNLITITAGYTMIRYLYEN-RHLYERFNN
Arc_Cre_The_7_[  IASRSEIMELLDQVKRPSARSRSF-HGGTFTGNRVTLTAGYTLINYLSQH-RSLYEGFNN
Arc_Cre_can_1_[  VAGKSEILNLAD---PNRKNGVCKIGGGTFSANPVSMKAGYLTLKYLYENKDSIYDKINT
Arc_Tha_Nit_3_[  VCGDKDIMSLADPVSIREKEARCAIGGGTFSANPATMVAGLATLDFLRKNERKVYGKVDR
Arc_Tha_Cen_1_[  ICGKDEVMEISN-TISHAKSDRAYIGGGTFSANPATMTAGAAALGELKKRKGTIYPRINS
Arc_Tha_Nit_2_[  MCGKKEIMEFAD-TTGKKKSERSYVGGGTFSANPASMTTGYATLSILKNG-KSIYSKINS
Arc_Tha_Nit_1_[  MCGKKEIMEQAD-TTGKKKSERSYVGGGTFSANPASMTAGFATLNLLKSK-KSTYSKINS
Arc_Cre_Mar_3_[  MCGKKEIMEFAD-TTGKKKSERSYVGGGTFSANPASMVAGYSTLNHLKSK-KSVYTKIND
Arc_Cre_Mar_4_[  MCGKKEIMEFAD-TTDKKKSERSYVGGGTFSANPASMVAGHATLNHLKSK-KAIYSKIND
Arc_Cre_Mar_2_[  ICGKNELMKYAS-TSIFSKTERAYIGGGTFSANPLTMMAGSTMLTIIKNKGNLLYNKLNS
Arc_Cre_Mar_1_[  ICGKNEFMNYAN-TSTFSKSNRAYVGGGTFSANPLTMIAGNSTLTTIKNKGNKLYTKLNS
Translation_of   ICGKDEFMNYAD-TSKFLKPNRAYIGGGTFSANPLTMIAGDSTLRMIKNKGNALYERLNM
                 ########                   ####################             

                                                                <_____________
                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  KASYLEKGIYDIAEEN-GIDIKINRCGSMFSLFFTNKPVK--------------------
Arc_Eur_Hal_1_[  LGDRLRAGLQDILEDQ-APEYTVVGRDSMFKVIFTRDGPDSFDGHCEAGCRQRESCPRFD
Arc_Cre_The_11   AAEKMARGLEDLAGRY-GFDVVVKRISSMFQLYFKRGDVK--------------------
Arc_Cre_The_14   AAERMARGIEDVAGRY-GFDVVVKQISSMFQLYFKRGDVK--------------------
Arc_Cre_The_9_[  SAKILNELLLDY-----GIEYTINRVESMMQIFFTDKEIN--------------------
Arc_Cre_The_8_[  AAKEIAEYAEAAF----NGAASVNRVESMFQLFFTQRSVV--------------------
Arc_Cre_The_12   AAKALEEAASEVLDRT-GLPYTINRVESMMQLFIGVEEVS--------------------
Arc_Cre_The_13   AAEKVAKALEQEAVA--KFGGVVHRVASMFQWFPGVEEVN--------------------
Arc_Cre_The_1_[  AARVLAEEIDRAI----KMDHVVNRVYNFFQFFLGVKDVR--------------------
Arc_Cre_The_2_[  ASKTLVEELERLL----KIKHTINHIGSMFQVFFGIDKVR--------------------
Arc_Cre_The_5_[  AVKEISEELDKA-----PLDHVVNSVKSMFQIFFGVKSVE--------------------
Arc_Cre_The_3_[  ASKEIAEELDNSLSKK-NFKYTINRIQSMFQFFIGISKVT--------------------
Arc_Cre_The_4_[  AVNVILEELVNALDKKIPNNFVINHIGSMFQVFFGVKKVS--------------------
Arc_Eur_The_1_[  RTQKLVSGIDDILDRK-HITHTIKYYGTMFQVFF-ADHVN--------------------
Arc_Eur_Met_6_[  SGLKMRRGLENILEDA-SLNYQVAGLSSMFQIYFTQSEVW--------------------
Arc_Eur_Met_7_[  KATILSNHLRDLSDKY-NIETKVYNIASIFQVYFNKNEVL--------------------
Arc_Eur_Met_3_[  LGELMRTSLDKVASEL-NIPHVVQGIGSMFQIFLTSKPVE--------------------
Arc_Eur_Met_4_[  FTKEIEDYLPE------RYRNSFVRLGSMFKLYFRDSPPS--------------------
Arc_Eur_Met_2_[  MGSYLRKGISDIVEDL-KLDYSVSGVASMFKVFF-GPLPR--------------------
Arc_Eur_Met_1_[  KGDEIRSCLSDIISDA-GLDYEVSGISSMFKVFFGKAPT---------------------
Arc_Eur_Met_5_[  SGEALRQALTELLKRM-KLDYSVSGMASMFQVFFGPKPE---------------------
Arc_Cre_The_10   LWDSVRRRIQEECESR-DNICWATGTGSIVGIHFTRKRPR--------------------
Arc_Cre_The_6_[  MWRDVARRLDRICEEN-NRICWITNVGSMIGIHFTSRKPRDIG-----------------
Arc_Cre_The_7_[  LWNWAREGLNRACEDH-GRLCWVTGVGSMLGIHFTRDRPV--------------------
Arc_Cre_can_1_[  LGNIARKSIDKILHEA-NINSQTTGIGSIVLTHFLNEEVDIVN-----------------
Arc_Tha_Nit_3_[  LGEMARKGLAKIFADA-GIPCRVTGINSIFLTHFVKEGTKDVE-----------------
Arc_Tha_Cen_1_[  MGDDARDKLSKIF----GNRVSVTGRGSLFMTHFVQDGAGRVS-----------------
Arc_Tha_Nit_2_[  LGEYARKELSKSF----DGKVIVTGKGSLFMTHFTKNRMGQIK-----------------
Arc_Tha_Nit_1_[  LGEYARKEINKVF----DGKVTITGKGSLFMTHFLKDGITKVT-----------------
Arc_Cre_Mar_3_[  LGEHARKELTKVF----DGKVAVTGKGSLFMTHFLQNGITEIK-----------------
Arc_Cre_Mar_4_[  LGKFARKEIGKAF----DGKVAVTGKGSLFMTHFLKDGITEIS-----------------
Arc_Cre_Mar_2_[  FGIETRKMLDKKF----GGSVITTGIGSLFLTHFLNDSIYKIN-----------------
Arc_Cre_Mar_1_[  FGSEARKMLDKKF----GGRVITTGTGSLFLTHFLTPSISEIK-----------------
Translation_of   LGSKTRKMLDKKF----AGD----------------------------------------
                                     <======================================= 
                                       

                 ___>
                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
Arc_Cre_1_[Arch  ----NFNDAKNT--KYELYKKIFWIML-KEGVLLPPSPFESIFLTTSHSDDDLENTLEAF
Arc_Eur_Hal_1_[  YCPKTGHDVTQA--ETERWERLFWPAMKDQGVFLTANQFESQFICDAHTGEDIENALEAY
Arc_Cre_The_11   ----TPQDVRES--NEKLYLKLHEIAL-SHGVYLTPSQYEVNFTSSMHTDEVVNEALQAL
Arc_Cre_The_14   ----TPDDVRRS--DERLYLKLHEIAL-RHGLYLAPSQYEVNFTTSAHTQEVVEWALGSL
Arc_Cre_The_9_[  ----NADDARMA--NKELYTKFHESLI-NKGVFIPPSQFETMFTSYEHNEDIINYTAEKI
Arc_Cre_The_8_[  ----SPDDARAS--DREKYAKFHELMR-KYGVFVPPSQFESQFTSAVHDDEVILTTEEAL
Arc_Cre_The_12   ----NAAQARKA--DKKFYVKLHEEML-RRGVFIAPSNLEAVFTGLPHQGEALEIAVEGL
Arc_Cre_The_13   ----NYADALKA--NKEISLRLHEELL-KRGVFIAPSLFEAWFTSAAHGEDVVNKTLEAL
Arc_Cre_The_1_[  ----NANDARKA--KRDLYVKVHESLL-KEGVFIPPSQFEALFTSGAHDDDVVNESARVF
Arc_Cre_The_2_[  ----NYSDAKRA--NKEYYIKFHERLL-KERVFIPPSQYETIFTSAAHEDDVVNDTIDKL
Arc_Cre_The_5_[  ----NADDARKA--NKEKYIEFQKALL-DRGVFFPPSQFESVFTSSAHTEEVVNETLDKI
Arc_Cre_The_3_[  ----NADDARLA--NKDLYVKIHEKLL-KLGVFIPPSQFETIFTSSSHSDEIVNLTIEAI
Arc_Cre_The_4_[  ----NATEAKLA--NKEMYQKFHNLLL-QRGVFIPPSQFETIFTSYAHKDVVVNTTLEIL
Arc_Eur_The_1_[  ----NYDDALKA--RKEVYFKLFKALS-KNGVYLPPSQYETNFVSFAHSDSDIDATLAAF
Arc_Eur_Met_6_[  ----DYAQAKTA--DTEKFNTYFQTLL-ANGVFIPPSQFECCFLSQAHSPEDIQITLEAM
Arc_Eur_Met_7_[  ----NYDIAKES--NTELFNKYFFGLL-NNGVFIAPSQFECCFTSIAHKEEDLTNTMNAM
Arc_Eur_Met_3_[  ----NYADALTC--DSAGFMKLFQGLL-DEGIYVPPSQYETSFVSTAHTSSDISRTADAF
Arc_Eur_Met_4_[  ----NYVEAKQS--DTEKFGKFWKGML-KEGIFLPPSQFETNFVSAAHTTGDIEKISEAY
Arc_Eur_Met_2_[  ----NYSEALRC--DKEGYLRFFWRML-EAGIFLTPSQYETDFISASHDKEIIDKTLEAF
Arc_Eur_Met_1_[  ----NYQETLKC--DKSGYFDFFKRML-NDGIFLPPSQFETNFLSYAHSDSDIQKLLNAY
Arc_Eur_Met_5_[  ----NYQQALRC--NKALYDKFWSHML-ENGVFLPPSQFETCFLSTAHERGDVEDTLRAF
Arc_Cre_The_10   ----TAREALEERWSNKVYEVMHMYMR-LNGILYMTEHMAHLLPSMAHSRRDADRFIEVF
Arc_Cre_The_6_[  ----EAYRLRLC--S-EIYKALHLYMR-INRILYLSEKMPHLMPSMVHTEEQANRFVDVF
Arc_Cre_The_7_[  ----NARVAYTDRINEDLYHLTHLYMR-TRGILYMTEHMPHLLPSMIHTREHANTLVEEF
Arc_Cre_can_1_[  ----SYEDALKC--DKELQHLYYLYLMTEHNIFFLPGHIGTI--SNAHTDTDIQKLTSAT
Arc_Tha_Nit_3_[  ----NATDVATS--DRGKLVKYHMALMAEHGVFFLPTKMGAM--SYAHDEADVKKLLSAT
Arc_Tha_Cen_1_[  ----NAADAAAC--DVELLHRYHLDMITRDGIFFLPGKLGAI--SAAHSKADLKTMYSAS
Arc_Tha_Nit_2_[  ----NSADAAQC--DTKKLQKYHFQMISKDKIFFLPGKLGAI--SNAHSKEDIKKMILAS
Arc_Tha_Nit_1_[  ----NSADVAKC--DSQMLAKYHFKMIAHDGIFFLPGKLGAI--SDAHSKEDIKKMIKAS
Arc_Cre_Mar_3_[  ----NSTDAAKC--NGALLSKYHFKMISHDGIFFLLGKLGAI--SDAHSKSDIKNMVKAS
Arc_Cre_Mar_4_[  ----NSTQAAKC--DETLLSKYHFKMISHDGIFFLPGKLGAI--SDAHSKSDIKNMVKAS
Arc_Cre_Mar_2_[  ----NATDAAKC--NTKKLHDYHFHMIANDGIFFLPGKLGAY--SDAHTKSDINAIAKST
Arc_Cre_Mar_1_[  ----NATHAAKC--DIKKLHDYHFHMIANDKIFFLPGKLGAF--SDIHTKSDITNIAKST
Translation_of   ------------------------------------------------------------
                 ============================================================                                                            


                        490
                 =========+=========
Arc_Cre_1_[Arch  HSAFHSIPHE---------
Arc_Eur_Hal_1_[  KEAI---------------
Arc_Cre_The_11   ELAFRKLKLVGSS------
Arc_Cre_The_14   EKSFRELKSAL--------
Arc_Cre_The_9_[  KEVIKGM------------
Arc_Cre_The_8_[  RKAASELK-----------
Arc_Cre_The_12   RSSLKTVLGS---------
Arc_Cre_The_13   SEALKVIS-----------
Arc_Cre_The_1_[  KKVLEDLT-----------
Arc_Cre_The_2_[  AKVIGELS-----------
Arc_Cre_The_5_[  RKVLSEMR-----------
Arc_Cre_The_3_[  HKVVSEI------------
Arc_Cre_The_4_[  RKVVQEL------------
Arc_Eur_The_1_[  EKAVAEMD-----------
Arc_Eur_Met_6_[  EKGIKAAEK----------
Arc_Eur_Met_7_[  DKAFKSLK-----------
Arc_Eur_Met_3_[  FKVMSEVLR----------
Arc_Eur_Met_4_[  CKCL---------------
Arc_Eur_Met_2_[  KLFLKG-------------
Arc_Eur_Met_1_[  ESNLKQS------------
Arc_Eur_Met_5_[  IKSCGALK-----------
Arc_Cre_The_10   ASFLDEIYRLVKKGALSTF
Arc_Cre_The_6_[  RGFVEDIYRSR--------
Arc_Cre_The_7_[  KGLLSEIVHK---------
Arc_Cre_can_1_[  LDFALNIKHILRTIS----
Arc_Tha_Nit_3_[  EKIASSGLLK---------
Arc_Tha_Cen_1_[  ERFAEGL------------
Arc_Tha_Nit_2_[  EESES--------------
Arc_Tha_Nit_1_[  EDFRF--------------
Arc_Cre_Mar_3_[  EEFTC--------------
Arc_Cre_Mar_4_[  EEFTC--------------
Arc_Cre_Mar_2_[  DKFLTKFKK----------
Arc_Cre_Mar_1_[  DKFLTRFKK----------
Translation_of   -------------------
                 ==================>                                    






Parameters used
Minimum Number Of Sequences For A Conserved Position: 18
Minimum Number Of Sequences For A Flanking Position: 29
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 8 selected block(s)
Flanks: [53  68]  [70  88]  [94  173]  [197  214]  [220  268]  [272  296]  [298  308]  [328  347]  

New number of positions in input.fasta-gb:  238  (47% of the original 499 positions)




Protein Domains

PROTOCOLE:

Site : EMBL-EBI ; Outil : INTERPRO ; Paramètre par défaut ; Format texte : TSV



ANALYSE DES RÉSULTATS:


Tableau de synthèse des résultats brut d'INTERPRO :




|  Code Interpro  |    Banque     |  position  |  position  |  E-value  |  Intitulé banque d'origine              |   Intitulé Interpro                           | 
|   (IPRxxxxxx)   |  d'origine    |  de début  |   de fin   |           |  (premier sur la ligne)                 |   (en fin de ligne)                           |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|                 |               |            |            |           |                                         |                                               |
|  IPR015422      |   Gene3D      |      4     |     39     |  8.4E-9   |   G3DSA:3.90.1150.10                    |   Pyridoxal phosphate-dependent transferase,  |
|                 |               |            |            |           |                                         |      major region, subdomain 2                |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|   IPR015422     |   Gene3D      |     278    |     311    |  3.8E-5   |   G3DSA:3.90.1150.10                    |   Pyridoxal phosphate-dependent transferase,  |
|                 |               |            |            |           |                                         |       major region, subdomain 2               |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|  IPR005814      |ProSitePatterns|     200    |     236    |   NEANT   |   PS00600 Aminotransferasesclas-III     |   Aminotransferase class-III                  |
|                 |               |            |            |           |   pyridoxal-phosphate attachment site   |                                               |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|                 |               |            |            |           |                                         |                                               |
|  IPR005814      | Pfam          |      8     |     310    |  1.2E-55  |PF00202 Aminotransferase class-III       |      Aminotransferase class-III               |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|   IPR005814     |    PANTHER    |      1     |     311    |  3.4E-95  |   PTHR11986                             |   Aminotransferase class-III                  |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|  IPR015424      | SUPERFAMILY   |      2     |     312    |  3.1E-78  |   SSF53383                              |   Pyridoxal phosphate-dependent transferase   |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|                 |               |            |            |           |                                         |                                               |
|  NEANT          | PANTHER       |      1     |     311    |  3.4E-95  |   PTHR11986:SF5                         |   NEANT                                       |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|
|  IPR015421      |    Gene3D     |      44    |     277    |  3.2E-58  |   G3DSA:3.40.640.10                     |   Pyridoxal phosphate-dependent transferase,  |
|                 |               |            |            |           |                                         |     major region, subdomain 1                 |
|_________________|_______________|____________|____________|___________|_________________________________________|_______________________________________________|


Tout d'abord, nous pouvons constater que tous les domaines retournés par interpro sont des domaines transferase. Cela concorde avec les résultats de Blastp qui nous ont orientés vers une protéine de type aminotransferase.


Nous pouvons éliminer les domaines retournés dont les données ne sont pas complètes notamment celui de ProSitePatterns qui ne nous informe pas sur la e-value correspondante au domaine, nous pouvons tout de même noter que ce domaine est cohérent avec les autres puisqu'il est de type transférase. Nous pouvons également éliminer celui de PANTHER :  [ Translation acdc6da4b2d0b1f54766642374b54c37 316 PANTHER PTHR11986:SF5 1 311 3.4E-95 T 07-10-2014] car il ne nous informe pas sur le code interpro ni sur le nom du domaine protéique.


En revanche, pour ce qui est de ce dernier résultat (PANTHER) retourné par interpro nous pouvons observer que les positions de début et de fin de domaine, la e-values et les intitulés de banques d'origine correspondent au deuxième domaine issu de PANTHER. Nous pouvons donc supposer que ces domaines sont les mêmes mais sans certitudes.


Nous observons que les e-values  varient de 3.8e-5 à 3.4e-95. Les deux domaines retournés par Gene3D possèdent une fonction transférase comme la fonction prédite de notre ORF d'intérêt, mais les meilleures e-value sont plus significatives, nous pouvons donc éliminer ces domaines dont les e-valeurs sont de 8.4e-9 et 3.8e-5.


Nous pouvons également éliminer le domaine retourné par Pfam car ses positions de début (8) et de fin (310) sont comprises dans les domaines restants (PANTHER, SUPERFAMILY et Gene3D (bas du tableau). Il est de ce fait moins significatif et sa e-value est plus faible que celles des domaines restants (1.2E-55).


Le dernier domaine de la liste retourné par la banque de données Gene3D est également compris dans les domaines PANTHER et SUPERFAMILY, de plus il est plutôt court et sa e-value (3.2E-58) est plus faible que celle des deux autres domaines restants.


Il nous reste donc les domaines retournés par PANTHER dont la e-value est de 3.4e-95 et celui de SUPERFAMILY dont la e-value est de 3.1e-78. Le début et la fin du domaines correspondent plus ou moins à un nucléotide près. En effet, le domaine protéique retourné par PANTHER débute à l'acide aminé 1 et se termine à l'acide aminé 311 alors que celui de SUPERFAMILY commence à l'acide aminé 2 et fini à l'acide aminé 312.


Nous choisissons le domaine protéique dont la e-value est la meilleure (3.4E-95). Soit le domaine Aminotransferase class-III retourné par PANTHER.


domaine choisi :


Translation acdc6da4b2d0b1f54766642374b54c37 316 PANTHER PTHR11986 1 311 3.4E-95 T 07-10-2014 IPR005814 Aminotransferase class-III GO:0008483|GO:0030170


Les aminotransférases ou transaminases ou aminomutases sont des enzymes qui catalysent l'interconversion d'acides aminés et oxoacids par transfert de groupes amines. Elles agissent dans de nombreux processus métaboliques et notamment dans la synthèse de nouveaux acides aminés non présents dans le milieu. Elles agissent donc dans des processus de biosynthèse.




RÉSULTATS BRUTS:

Translation	acdc6da4b2d0b1f54766642374b54c37	316	Gene3D	G3DSA:3.90.1150.10		                                                        4	39	8.4E-9	T	07-10-2014	IPR015422	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	GO:0003824|GO:0030170	
Translation	acdc6da4b2d0b1f54766642374b54c37	316	Gene3D	G3DSA:3.90.1150.10		                                                        278	311	3.8E-5	T	07-10-2014	IPR015422	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	GO:0003824|GO:0030170	
Translation	acdc6da4b2d0b1f54766642374b54c37	316	ProSitePatterns	PS00600 Aminotransferasesclas-III pyridoxal-phosphate attachment site.	        200	236	-	T	07-10-2014	IPR005814	Aminotransferase class-III	GO:0008483|GO:0030170	
Translation	acdc6da4b2d0b1f54766642374b54c37	316	Pfam	PF00202	Aminotransferase class-III	                                                8	310	1.2E-55	T	07-10-2014	IPR005814	Aminotransferase class-III	GO:0008483|GO:0030170	
Translation	acdc6da4b2d0b1f54766642374b54c37	316	PANTHER	PTHR11986		                                                                1	311	3.4E-95	T	07-10-2014	IPR005814	Aminotransferase class-III	GO:0008483|GO:0030170	
Translation	acdc6da4b2d0b1f54766642374b54c37	316	SUPERFAMILY	SSF53383		                                                        2	312	3.1E-78	T	07-10-2014	IPR015424	Pyridoxal phosphate-dependent transferase		
Translation	acdc6da4b2d0b1f54766642374b54c37	316	PANTHER	PTHR11986:SF5		                                                                1	311	3.4E-95	T	07-10-2014
Translation	acdc6da4b2d0b1f54766642374b54c37	316	Gene3D	G3DSA:3.40.640.10		                                                        44	277	3.2E-58	T	07-10-2014	IPR015421	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	GO:0003824|GO:0030170	

Phylogeny

PROTOCOLE:


a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur: Euryarchaeota & Thaumarchaeota



b) Phylogeny.fr / méthode neighbor-joining / groupe extérieur: Euryarchaeota & Thaumarchaeota



ANALYSE DES RÉSULTATS:


a) PHYML


Les branches dont les valeurs de support des nœuds sont inférieures à 0.7 sont notées " * ". Ce sont des branches qui ne sont pas robustes.


Nous avons enraciné notre arbre PhyML sur les Euryachaetota, un des phylum de notre groupe extérieur (Euryarchaeota et Thaumarchaeota). Les Thaumarchaeota se sont insérées dans des branches contenant les Crenarchaeota (groupe d'étude). Cela peut s'expliquer par des transferts horizontaux de gènes des Crenarchaeota vers les espèces de notre groupe extérieur soit les Thaumarchaeota ou encore par le fait que la place des Thaumarchaeota dans l'arbre de la vie est encore incertaine.


Nous pouvons remarquer que le groupe d'étude semble être en miroir. Il y a probablement eu une duplication d'un gène au sein de ce phylum. La branche A correspondrait à la version A du gène et la branche A' à la version A' du gène en question.


Dans la branche A nous remarquons que nous avons des Crenarchaeota Thermoprotei mais également deux Euryarchaeota qui se sont insérées dans cette branche A. Elles possèdent probablement la version A du gène en question. La duplication pré-date la séparation des Crenarchaeota et des Euryarchaeota.


Nous pouvons observer un mélange de classes entre les Crenarchaeota dans la branche A' : Thermoprotei et Marine group I. Nous supposons ici que les Marines group I sont une classe du phylum des Crenarchaeota car dans le rapport taxonomique cela n'était pas affiché ainsi. En effet, dans la colonne donnant le règne : le phylum : la classe : l'ordre d'appartenance de la séquence homologue à notre ORF, le rapport taxonomique ne nous indiquait que le règne (Archae) et le phylum (Crenarchaeota). Nous observons également que les Thaumarchaeota (groupe extérieur) sélectionnées dans le rapport taxonomique se sont insérées dans cette branche A'. La position des Thaumarchaeota dans l'arbre de la vie n'est pas définie. Nous pouvons donc penser que la duplication pré-date de la séparation entre les Crenarchaeota et les Thaumarchaeota.


Le gène étudié se serait dupliqué avant les Crenarchaeota, les Thaumarchaeota et les Euryarchaeota. En effet, nous avons également un Euryarchaeota dans la branche A'.


Nous avons supposé au vu de nos résultats de Blastp et INTERPRO que notre ORF code pour une aminotransférase, nous savons qu'il existe différentes aminotranférases : glutamate, ornithine.... Ceci peut expliquer que l'on retrouve différentes versions du gène. Afin d'obtenir un arbre entièrement miroir, il nous faudrait sélectionner chaque version du gène dans chacune des classes sélectionnées dans l'arbre. Or, ce travail est très long pour le temps qui nous est imparti et très difficile à notre niveau.


Notre ORF possède un ancêtre commun direct avec une Crenarchaeota Marine group I. Nous ne pouvons cependant pas affirmer que notre ORF appartienne à la classe des Marine group I car la robustesse de ce nœud est mauvaise 0.085. De plus, cette branche C où se trouve notre ORF n'est pas intégrée dans un groupe contenant strictement la classe Marine group I. Nous ne pouvons pas non plus conclure que notre ORF appartient au phylum des Crenarchaeota car nous avons vu précédemment que des Thaumarchaeota se sont intégrées dans la branche B de notre groupe d'étude.


À ce stade nous pouvons seulement dire que notre ORF appartient au règne des Archae.


b) NJ


Nous avons enraciné notre arbre sur les Euryarchaeota (voir a) ).


Nous avons remarqué que les branches A, B, C et D sont non résolues contrairement à ce que nous avions obtenu dans l'arbre PhyML. Il n'y a donc pas de séparation du groupe d'étude et du groupe extérieur. Notre ORF est également dans une branche non résolue (E) avec deux Marine group I contrairement à ce que nous avions dans l'arbre PhyML. Nous ne pouvons cependant pas affirmer que notre ORF appartienne à la classe des Marine group I car la branche E n'est pas intégré dans un groupe contenant strictement la classe Marine group I. Nous ne pouvons pas non plus conclure que notre ORF appartient au phylum des Crenarchaeota car nous avons vu précédemment que des Thaumarchaeota se sont intégrées dans la branche B de notre groupe d'étude.


Un nœud non résolu est connecté à plus de deux branches descendantes (branchement non binaire). Les nœuds non résolus correspondent à des situations pour lesquelles il subsiste une ambiguïté concernant l'ordre des événements évolutifs.


En dehors de ces observations, l'arbre de NJ est similaire à celui de PhyML. Nous pouvons dire que ces arbres sont congruents. Les branches des arbres NJ et PhyML représentent le nombre de substitution. L'arbre PhyML est une méthode de maximum de vraisemblance qui explore tous les arbres possibles pouvant être construits avec les séquences sélectionnées. Pour cela l'algorithme calcule la probabilité de trouver une branche à un endroit donné au sein de l'arbre (chiffres rouges). En revanche, NJ est une méthode de distance qui fait une approximation de l'arbre d'évolution minimale (celui dont la longueur totale est minimale).


Pour conclure, nous pouvons dire que notre ORF appartient au règne des Archae. Nous ne pouvons apporter plus de précisions.



RÉSULTATS BRUTS:

a) arbre PhyML

                                                                                                  --------0.5------
 
   +-----------34_Arc_Eur_Met_2_Archaea_Euryarchaeota_Methanomicrobia_Evalue8e6
   |
   |       +----------------------33_Arc_Eur_The_1_Archaea_Euryarchaeota_Thermoplasmata_Evalue1e65
 +-+ +-----+
 | | |     +-------32_Arc_Eur_Met_3_Archaea_Euryarchaeota_Methanomicrobia_Evalue3e6
 | +-+
 |   |  +--------------31_Arc_Eur_Met_4_Archaea_Euryarchaeota_Methanomicrobia_Evalue7e5
 |   |  |
 |   +--+ +-------30_Arc_Eur_Met_1_Archaea_Euryarchaeota_Methanomicrobia_Evalue3e6
 |      +-+
 |       *+-------------29_Arc_Eur_Met_5_Archaea_Euryarchaeota_Methanomicrobia_Evalue2e5
 |
 |
 |        +--------28_Arc_Cre_The_13_Archaea_Crenarchaeota_Thermoprotei_Evalue2e54
 |        |
 |        |               +----27_Arc_Cre_The_11_Archaea_Crenarchaeota_Thermoprotei_Evalue1e56
 |    +---+ +-------------+
 |    |   | |             +---------26_Arc_Cre_The_14_Archaea_Crenarchaeota_Thermoprotei_Evalue1e51
 |    |   | |
 |    |   | |     +-----------25_Arc_Cre_The_8_Archaea_Crenarchaeota_Thermoprotei_Evalue4e63_A
 |    |   +-+ +---+
 |    |   * | |   |   +---------24_Arc_Cre_The_9_Archaea_Crenarchaeota_Thermoprotei_Evalue3e61_A
 |    |     | |   +---+
 |    |     | |    *  +-------------23_Arc_Cre_The_12_Archaea_Crenarchaeota_Thermoprotei_Evalue6e56
 |    |     +-+
 |  A |      *|  +-------22_Arc_Cre_The_1_Archaea_Crenarchaeota_Thermoprotei_Evalue6e67_A
 | +--+       |  |
 | |* |       +--+   +------21_Arc_Cre_The_5_Archaea_Crenarchaeota_Thermoprotei_Evalue3e66_A
 | |  |          |   |
 | |  |          +---+ +--------20_Arc_Cre_The_2_Archaea_Crenarchaeota_Thermoprotei_Evalue5e63_A
 | |  |              | |
 | |  |              +-+  +---19_Arc_Cre_The_3_Archaea_Crenarchaeota_Thermoprotei_Evalue2e61_A
 | |  |                +--+
 | |  |                   +-------18_Arc_Cre_The_4_Archaea_Crenarchaeota_Thermoprotei_Evalue4e58_A
 | |  |
 | |  |
 | |  |        +---------17_Arc_Eur_Met_6_Archaea_Euryarchaeota_Methanobacteria_Evalue2e6
 | |  +--------+
 | |           +-------16_Arc_Eur_Met_7_Archaea_Euryarchaeota_Methanococci_Evalue2e64_A
 | |
 | |                        * +-----15_Arc_Cre_The_7_Archaea_Crenarchaeota_Thermoprotei_Evalue9e65_A
 | |                       +--+
 +-+          +------------+  +---------------14_Arc_Cre_The_10_Archaea_Crenarchaeota_Thermoprotei_Evalue5e58
   |          |            |
   |          |            +-------13_Arc_Cre_The_6_Archaea_Crenarchaeota_Thermoprotei_Evalue9e70_A
   |  +-------+
   |  |       |   +-------------------12_Arc_Cre_can_1_Archaea_Crenarchaeota_candidate_division_YNPFFA_E
   |  |       |   |
   |  |       +---+           +------------11_Arc_Tha_Nit_3_Archaea_Thaumarchaeota_Nitrososphaerales_Evalue9
   |  |           |           |
   |  |           |           |        +----------10_Arc_Tha_Cen_1_Archaea_Thaumarchaeota_Cenarchaeales_Evalue2e14
   |  |           +-----------+        |
   |  |                       |        |        *C+---9_Translation_of_ORF_number_1_in_reading_frame_3_on_the_direct_str
   |  |                       |        |         ++
   |  |                       +--------+         |+---8_Arc_Cre_Mar_1_Archaea_Crenarchaeota_Marine_Group_I_Evalue0.0_A
   |  |                                |  +------+
   |A'|                                |  |      +----7_Arc_Cre_Mar_2_Archaea_Crenarchaeota_Marine_Group_I_Evalue0.0_A
   +--+                                |  |
      |                                +--+
      |                                   |  +--6_Arc_Tha_Nit_1_Archaea_Thaumarchaeota_Nitrosopumilales_Evalue3e
      |                                   +--+
      |                                      | +--5_Arc_Tha_Nit_2_Archaea_Thaumarchaeota_Nitrosopumilales_Evalue2e
      |                                      +-+
      |                                      * | +4_Arc_Cre_Mar_4_Archaea_Crenarchaeota_Marine_Group_I_Evalue2e15
      |                                        +-+
      |                                          +-3_Arc_Cre_Mar_3_Archaea_Crenarchaeota_Marine_Group_I_Evalue2e15
      |
      |  +--------------------------2_Arc_Cre_1_Archaea_Crenarchaeota_Evalue9e48_Archaea_Crenarchae
      +--+
      *  +------------------1_Arc_Eur_Hal_1_Archaea_Euryarchaeota_Halobacteria_Evalue5e60_A



b) arbre Neigbhor-Joning


                                                                                                  -------0.2------
 
    +-----------------34_Arc_Eur_Met_2_Archaea_Euryarchaeota_Methanomicrobia_Evalue8e6
  A |
 +--+      +------------------33_Arc_Eur_Met_5_Archaea_Euryarchaeota_Methanomicrobia_Evalue2e5
 |  |   +--+
 |  |   |  +--------------32_Arc_Eur_Met_1_Archaea_Euryarchaeota_Methanomicrobia_Evalue3e6
 |  +---+
 |      +--------------------31_Arc_Eur_Met_4_Archaea_Euryarchaeota_Methanomicrobia_Evalue7e5
 |
 |B          +-------------30_Arc_Eur_Met_7_Archaea_Euryarchaeota_Methanococci_Evalue2e64_A
 |-----------+
 |           +--------------29_Arc_Eur_Met_6_Archaea_Euryarchaeota_Methanobacteria_Evalue2e6
 |
 |
 |    +---------------28_Arc_Cre_The_13_Archaea_Crenarchaeota_Thermoprotei_Evalue2e54
 |    |
 |    |           +----------27_Arc_Cre_The_4_Archaea_Crenarchaeota_Thermoprotei_Evalue4e58_A
 |    |        +--+
 |    |      +-+  +-------26_Arc_Cre_The_3_Archaea_Crenarchaeota_Thermoprotei_Evalue2e61_A
 |   ++      | |
 |   ||      | +--------------25_Arc_Cre_The_2_Archaea_Crenarchaeota_Thermoprotei_Evalue5e63_A
 |   || +----+
 |   || |    |+-------------24_Arc_Cre_The_5_Archaea_Crenarchaeota_Thermoprotei_Evalue3e66_A
 |   || |    ++
 |   |+-+     +-------------23_Arc_Cre_The_1_Archaea_Crenarchaeota_Thermoprotei_Evalue6e67_A
 | C |  |
 |---+  | +------------------22_Arc_Cre_The_8_Archaea_Crenarchaeota_Thermoprotei_Evalue4e63_A
 |   |  | |
 |   |  +-+ +-------------------21_Arc_Cre_The_12_Archaea_Crenarchaeota_Thermoprotei_Evalue6e56
 |   |    +-+
 |   |      +------------------20_Arc_Cre_The_9_Archaea_Crenarchaeota_Thermoprotei_Evalue3e61_A
 |   |
 |   |                +-------------19_Arc_Cre_The_14_Archaea_Crenarchaeota_Thermoprotei_Evalue1e51
 |   +----------------+
 |                    +---------18_Arc_Cre_The_11_Archaea_Crenarchaeota_Thermoprotei_Evalue1e56
 |
 |
 |       +-----------------17_Arc_Eur_Met_3_Archaea_Euryarchaeota_Methanomicrobia_Evalue3e6
 |   +---+
 |  ++   +---------------------------16_Arc_Eur_The_1_Archaea_Euryarchaeota_Thermoplasmata_Evalue1e65
 |  ||
 |  |+-----------------------------------15_Arc_Cre_1_Archaea_Crenarchaeota_Evalue9e48_Archaea_Crenarchae
 |  |
 |  |                                     E  +-----14_Arc_Cre_Mar_1_Archaea_Crenarchaeota_Marine_Group_I_Evalue0.0_A
 |  |                                 +------+
 |  |                                 |      |-------13_Translation_of_ORF_number_1_in_reading_frame_3_on_the_direct_str
 |  |                                 |      |
 |  |                                 |      +---------12_Arc_Cre_Mar_2_Archaea_Crenarchaeota_Marine_Group_I_Evalue0.0_A
 |  |                              +--+
 |  |                              |  |      +----11_Arc_Tha_Nit_1_Archaea_Thaumarchaeota_Nitrosopumilales_Evalue3e
 |  |                              |  |      |
 |  |                              |  +------+   +--10_Arc_Cre_Mar_4_Archaea_Crenarchaeota_Marine_Group_I_Evalue2e15
 |  |                              |         | +-+
 +--+                     +--------+         | | +--9_Arc_Cre_Mar_3_Archaea_Crenarchaeota_Marine_Group_I_Evalue2e15
  D |                     |        |         +-+
    |                     |        |           +---8_Arc_Tha_Nit_2_Archaea_Thaumarchaeota_Nitrosopumilales_Evalue2e
    |          +----------+        |
    |          |          |        +-----------------7_Arc_Tha_Cen_1_Archaea_Thaumarchaeota_Cenarchaeales_Evalue2e14
    |          |          |
    |      +---+          |
    |      |   |          +----------------------6_Arc_Tha_Nit_3_Archaea_Thaumarchaeota_Nitrososphaerales_Evalue9
    |      |   |
    |      |   +----------------------------5_Arc_Cre_can_1_Archaea_Crenarchaeota_candidate_division_YNPFFA_E
    |+-----+
    ||     |                    +------------4_Arc_Cre_The_7_Archaea_Crenarchaeota_Thermoprotei_Evalue9e65_A
    ||     |                 +--+
    ++     +-----------------+  +--------------3_Arc_Cre_The_6_Archaea_Crenarchaeota_Thermoprotei_Evalue9e70_A
     |                       |
     |                       +--------------------2_Arc_Cre_The_10_Archaea_Crenarchaeota_Thermoprotei_Evalue5e58
     |
     +------------------------------1_Arc_Eur_Hal_1_Archaea_Euryarchaeota_Halobacteria_Evalue5e60_A

Taxonomy report

PROTOCOLE:


Site : Annotathon ; Outils : TaxReport ; "tax_report2" ; Paramètre : Exclure les séquences environnementales ("uncultured")


ANALYSE DES RÉSULTATS:


Tableau synthétique des phylum, classes et ordre du rapport taxonomique des séquences homologues au dessous de notre "seuil" à 5e-45 :



_______________________________________________________________________________________________________________________________________

|                       |                       |                   |                          |                  |                     |      

|          Règne        | phylum                | classe            | Ordre                    | gamme de e-value | nombre de résultats |

|_______________________|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|    [Archea]           | [Crenarchaeota]       |                   |                          |    0.0 - 8e-48   |           7         |

|                       |                       |___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |  [Thermoprotei]   | [Sulfolobales]           |    1e-70 - 9e-55 |          14         |

|                       |                       |                   |__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |                   | [Desulfurococcales]      | 8e-70 - 2e-45    |           9         |

|                       |                       |                   |__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |                   | [Thermoproteales]        |   9e-67 - 6e-46  |          11         |

|                       |                       |                   |__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |                   | [Acidilobales]           |    4e-63 - 3e-61 |           2         |

|                       |_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       | [Thaumarchaeota]      |[Nitrosopumilales] |                          | 3e-160- 7e-45    |          11         |

|                       |                       |___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |[Nitrososphaerales]|                          | 1e-112  - 4e-55  |           4         |

|                       |_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          | 2e-164  - 2e-47  |           3         |

|                       |_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |[Cenarchaeales]    |                          | 2e-140           |           1         |

|                       |_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       | [Euryarchaeota]       |  [Methanomicrobia]|   [Methanosarcinales]    |  3e-69 - 2e-54   |          15         |

|                       |                       |                   |__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |                   |   [Methanocellales]      |   6e-57 - 5e-51  |          1          |

|                       |                       |                   |__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |                   |  [Methanomicrobiales]    | 7e-54 - 2e-46    |           11        |

|                       |                       |                   |__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |                   |                          | 3e-63 - 1e-55    |           2         |

|                       |                       |___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |   [Thermoplasmata]|  [Thermoplasmatales]     | 1e-65 - 1e-52    |          3          |

|                       |                       |___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |   [Methanococci]  |  [Methanococcales]       | 2e-64 - 1e-55    |         19          |

|                       |                       |___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|                       |                       |   [Halobacteria]  |  [Halobacteriales]       | 5e-60 - 7e-47    |         97          |

|_______________________|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|     [Bacteria]        |                       |                   |                          |  5e-84 - 5e-45   |       ~281          |

|_______________________|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                       |                   |                          |                  |                     |

|    [Eukaryota]        |                       |                   |                          |  2e-57 - 3e-45   |       60            |

|_______________________|_______________________|___________________|__________________________|__________________|_____________________|





Nous avions énormément de phylum, classe et ordre, dans notre rapport taxonomique. Nous n'avons donc pas pu tous les représenter dans le tableau.


Nous pouvons remarquer que les trois règnes : Archée (e-value 0.0, score de 563 à 196), Bactérie (e-value 5e-84, score de 272 à 168) et Eucaryotes (e-value 2e-57, score de 202 à 169) sont représentés dans le rapport taxonomique avec des e-value significatives c'est-à-dire en-dessous de notre "seuil" soit 5e-45.


Nous nous concentrons sur le règne des Archae car il présente les meilleures e-value (les scores sont si élevés que les e-values sont arrondies à zéro) et nous pouvons également remarquer un saut significatif entre les meilleurs e-value des Archae (0.0) et celles des Bactéries (5e-84) et Eucaryotes (2e-55).


Nous avons obtenu des Thaumarchaeota qui sont des Archae découvertes récemment et dont la place dans l'arbre de la vie est incertaine. Selon la phylogénie de référence du NCBI représentée par le Taxreport trois phylum sœurs naissent sous le nœud des Archae : les Crenarchaeota, les Euryarchaeota et les Thaumarchaeota.


Au vu de l'écart de qualité de l'alignement de l'ORF entre les Crenarchaeota (score 563) et les Thaumarchaeota (score 477), nous choisissons les Crenarchaeota comme groupe d'étude et les autres Archae de notre rapport taxonomique soit les Thaumarchaeota et les Euryarchaeota comme groupe extérieur. Nous ne pouvons pas nous baser sur les e-value pour déterminer nos groupes (extérieur et étude) car les scores sont tellement élevés que les les e-value des Crenarchaeota sont arrondis à zéro ce qui rend impossible la comparaison avec les e-value des Thaumarchaeota (2e-164).



séquences choisis pour l'arbre phylogénétique :



Groupe d'étude : Crenarchaeota




>Arc_Cre_Mar_1 [Archaea Crenarchaeota Marine Group I]  E-value_0.0  Archaea;Crenarchaeota;Marine Group I; gi|675347874|gb|KFM20780.1| Glutamate-1-semialdehyde 21-aminomutase 2 protein [Marine Group I thaumarchaeote SCGC AAA799-D07]


>Arc_Cre_Mar_2 [Archaea Crenarchaeota Marine Group I]  E-value_0.0  Archaea;Crenarchaeota;Marine Group I; gi|653077347|ref|WP_027327939.1| glutamate-1-semialdehyde 2,1-aminomutase [Marine Group I thaumarchaeote SCGC AB-629-I23]


>Arc_Cre_Mar_3 [Archaea Crenarchaeota Marine Group I]  E-value_2e-156  Archaea;Crenarchaeota;Marine Group I; gi|675346555|gb|KFM19499.1| Glutamate-1-semialdehyde 21-aminomutase 2 protein [Marine Group I thaumarchaeote SCGC AAA799-P11]


>Arc_Cre_Mar_4 [Archaea Crenarchaeota Marine Group I]  E-value_2e-154  Archaea;Crenarchaeota;Marine Group I; gi|662358881|gb|KEQ56654.1| Glutamate-1-semialdehyde 21-aminomutase 2 protein [Marine Group I thaumarchaeote SCGC AAA799-N04]


>Arc_Cre_can_1 [Archaea Crenarchaeota candidate division YNPFFA]  E-value_1e-88  Archaea;Crenarchaeota;candidate division YNPFFA; gi|516977036|ref|WP_018194259.1| MULTISPECIES: hypothetical protein [candidate division YNPFFA]


>Arc_Cre_The_1 [Archaea Crenarchaeota Thermoprotei]  E-value_6e-67  Archaea;Crenarchaeota;Thermoprotei;Sulfolobales;Sulfolobaceae;Metallosphaera; gi|500271775|ref|WP_011921361.1| glutamate-1-semialdehyde 2,1-aminomutase [Metallosphaera sedula]


>Arc_Cre_The_2 [Archaea Crenarchaeota Thermoprotei]  E-value_5e-63  Archaea;Crenarchaeota;Thermoprotei;Sulfolobales;Sulfolobaceae;Sulfolobus; gi|502109843|ref|WP_012711924.1| glutamate-1-semialdehyde 2,1-aminomutase [Sulfolobus islandicus]


>Arc_Cre_The_3 [Archaea Crenarchaeota Thermoprotei]  E-value_2e-61  Archaea;Crenarchaeota;Thermoprotei;Sulfolobales;Sulfolobaceae;Sulfolobus; gi|363548517|sp|Q976H2.3|GSA_SULTO RecName: Full_Glutamate-1-semialdehyde 2,1-aminomutase; Short_GSA; AltName: Full_Glutamate-1-semialdehyde aminotransferase; Short_GSA-AT [Sulfolobus tokodaii str. 7]


>Arc_Cre_The_4 [Archaea Crenarchaeota Thermoprotei]  E-value_4e-58  Archaea;Crenarchaeota;Thermoprotei;Sulfolobales;Sulfolobaceae;Sulfolobus; gi|499596920|ref|WP_011277654.1| glutamate-1-semialdehyde 2,1-aminomutase [Sulfolobus acidocaldarius]


>Arc_Cre_The_5 [Archaea Crenarchaeota Thermoprotei]  E-value_3e-66  Archaea;Crenarchaeota;Thermoprotei;Sulfolobales;unclassified Sulfolobales; gi|583847677|gb|EWG07375.1| glutamate-1-semialdehyde aminotransferase [Sulfolobales archaeon AZ1]


>Arc_Cre_The_6 [Archaea Crenarchaeota Thermoprotei]  E-value_9e-70  Archaea;Crenarchaeota;Thermoprotei;Desulfurococcales;Desulfurococcaceae;Ignisphaera; gi|503069181|ref|WP_013304147.1| glutamate-1-semialdehyde 2,1-aminomutase [Ignisphaera aggregans]


>Arc_Cre_The_7 [Archaea Crenarchaeota Thermoprotei]  E-value_9e-65  Archaea;Crenarchaeota;Thermoprotei;Thermoproteales;Thermoproteaceae;Vulcanisaeta; gi|503369540|ref|WP_013604201.1| glutamate-1-semialdehyde 2,1-aminomutase [Vulcanisaeta moutnovskia]


>Arc_Cre_The_8 [Archaea Crenarchaeota Thermoprotei]  E-value_4e-63  Archaea;Crenarchaeota;Thermoprotei;Acidilobales;Acidilobaceae;Acidilobus; gi|503032145|ref|WP_013267121.1| glutamate-1-semialdehyde aminotransferase [Acidilobus saccharovorans]


>Arc_Cre_The_9 [Archaea Crenarchaeota Thermoprotei]  E-value_3e-61  Archaea;Crenarchaeota;Thermoprotei;Acidilobales;Caldisphaeraceae;Caldisphaera; gi|505045672|ref|WP_015232774.1| glutamate-1-semialdehyde-2,1-aminomutase [Caldisphaera lagunensis]


>Arc_Cre_The_10 [Archaea Crenarchaeota Thermoprotei]  E-value_5e-58  Archaea;Crenarchaeota;Thermoprotei;Desulfurococcales;Pyrodictiaceae;Hyperthermus; gi|500146569|ref|WP_011822572.1| glutamate-1-semialdehyde 2,1-aminomutase [Hyperthermus butylicus]


>Arc_Cre_The_11 [Archaea Crenarchaeota Thermoprotei]  E-value_1e-56  Archaea;Crenarchaeota;Thermoprotei;Thermoproteales;Thermoproteaceae;Thermoproteus; gi|503893445|ref|WP_014127439.1| glutamate-1-semialdehyde aminotransferase [Thermoproteus tenax]


>Arc_Cre_The_12 [Archaea Crenarchaeota Thermoprotei]  E-value_6e-56  Archaea;Crenarchaeota;Thermoprotei;Desulfurococcales;Desulfurococcaceae;Aeropyrum; gi|158428622|pdb|2EPJ|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Aeropyrum Pernix


>Arc_Cre_The_13 [Archaea Crenarchaeota Thermoprotei]  E-value_2e-54  Archaea;Crenarchaeota;Thermoprotei;Desulfurococcales;Desulfurococcaceae;Ignicoccus; gi|500800870|ref|WP_011998717.1| glutamate-1-semialdehyde aminotransferase [Ignicoccus hospitalis]


>Arc_Cre_The_14 [Archaea Crenarchaeota Thermoprotei]  E-value_1e-51  Archaea;Crenarchaeota;Thermoprotei;Thermoproteales;Thermoproteaceae;Thermoproteus; gi|503446111|ref|WP_013680772.1| glutamate-1-semialdehyde aminotransferase [Thermoproteus uzoniensis]


>Arc_Cre__1 [Archaea Crenarchaeota ]  E-value_9e-48  Archaea;Crenarchaeota; gi|516681824|ref|WP_018039624.1| hypothetical protein [crenarchaeote SCGC AAA261-N23]




Groupe extérieur : Thaumarchaeota & Euryarchaeota




>Arc_Tha_Nit_1 [Archaea Thaumarchaeota Nitrosopumilales]  E-value_3e-160  Archaea;Thaumarchaeota;Nitrosopumilales;Nitrosopumilales;Nitrosopumilaceae;Nitrosopumilus; gi|504778227|ref|WP_014965329.1| glutamate-1-semialdehyde 2,1-aminomutase [Candidatus Nitrosopumilus sp. AR2]


>Arc_Tha_Nit_2 [Archaea Thaumarchaeota Nitrosopumilales]  E-value_2e-156  Archaea;Thaumarchaeota;Nitrosopumilales;Nitrosopumilales;Nitrosopumilaceae;Nitrosopumilus; gi|495574754|ref|WP_008299333.1| glutamate-1-semialdehyde 2,1-aminomutase [Candidatus Nitrosopumilus salaria]


>Arc_Tha_Cen_1 [Archaea Thaumarchaeota Cenarchaeales]  E-value_2e-140  Archaea;Thaumarchaeota;Cenarchaeales;Cenarchaeaceae;Cenarchaeum; gi|503247758|ref|WP_013482419.1| glutamate-1-semialdehyde 2,1-aminomutase [Cenarchaeum symbiosum]


>Arc_Tha_Nit_3 [Archaea Thaumarchaeota Nitrososphaerales]  E-value_9e-112  Archaea;Thaumarchaeota;Nitrososphaerales;Nitrososphaeraceae;Nitrososphaera; gi|647810619|gb|AIC14320.1| glutamate-1-semialdehyde 2,1-aminomutase [Nitrososphaera viennensis EN76]


>Arc_Eur_Met_1 [Archaea Euryarchaeota Methanomicrobia]  E-value_3e-69  Archaea;Euryarchaeota;Methanomicrobia;Methanosarcinales;Methanosarcinaceae;Methanohalobium; gi|502958744|ref|WP_013193720.1| glutamate-1-semialdehyde aminotransferase [Methanohalobium evestigatum]


>Arc_Eur_Met_2 [Archaea Euryarchaeota Methanomicrobia]  E-value_8e-61  Archaea;Euryarchaeota;Methanomicrobia;Methanosarcinales;Methanosaetaceae;Methanosaeta; gi|500015584|ref|WP_011696302.1| glutamate-1-semialdehyde aminotransferase [Methanosaeta thermophila]


>Arc_Eur_Met_3 [Archaea Euryarchaeota Methanomicrobia]  E-value_3e-63  Archaea;Euryarchaeota;Methanomicrobia;unclassified Methanomicrobia;Methanomassiliicoccus; gi|521285278|ref|WP_020449546.1| glutamate-1-semialdehyde aminotransferase [Candidatus Methanomassiliicoccus intestinalis]


>Arc_Eur_Met_4 [Archaea Euryarchaeota Methanomicrobia]  E-value_7e-54  Archaea;Euryarchaeota;Methanomicrobia;Methanomicrobiales;Methanomicrobiaceae;Methanoplanus; gi|503094642|ref|WP_013329461.1| glutamate-1-semialdehyde aminotransferase [Methanoplanus petrolearius]


>Arc_Eur_Met_5 [Archaea Euryarchaeota Methanomicrobia]  E-value_2e-53  Archaea;Euryarchaeota;Methanomicrobia;Methanocellales;Methanocellaceae;Methanocella; gi|502665710|ref|WP_012901668.1| glutamate-1-semialdehyde aminotransferase [Methanocella paludicola]


>Arc_Eur_Met_6 [Archaea Euryarchaeota Methanobacteria]  E-value_2e-67  Archaea;Euryarchaeota;Methanobacteria;Methanobacteriales;Methanobacteriaceae;Methanobacterium; gi|490130571|ref|WP_004030955.1| glutamate-1-semialdehyde aminotransferase [Methanobacterium formicicum]


>Arc_Eur_The_1 [Archaea Euryarchaeota Thermoplasmata]  E-value_1e-65  Archaea;Euryarchaeota;Thermoplasmata;Thermoplasmatales;Thermoplasmataceae;Thermoplasma; gi|499219353|ref|WP_010916893.1| glutamate-1-semialdehyde aminotransferase [Thermoplasma volcanium]


>Arc_Eur_Met_7 [Archaea Euryarchaeota Methanococci]  E-value_2e-64  Archaea;Euryarchaeota;Methanococci;Methanococcales;Methanococcaceae;Methanococcus; gi|502945871|ref|WP_013180847.1| glutamate-1-semialdehyde aminotransferase [Methanococcus voltae]


>Arc_Eur_Hal_1 [Archaea Euryarchaeota Halobacteria]  E-value_5e-60  Archaea;Euryarchaeota;Halobacteria;Halobacteriales;Halobacteriaceae;Haloarcula; gi|503807658|ref|WP_014041652.1| glutamate-1-semialdehyde aminotransferase [Haloarcula hispanica]

RÉSULTATS BRUTS:
Lineage report
.LUCA
. Archaea
. .Crenarchaeota
. . Marine Group I
. . .Marine Group I thaumarchaeote SCGC AAA799-D07 563  0.0    1 hit   Archaea:Crenarchaeota:                   Glutamate-1-semialdehyde 21-aminomutase 2 prot...   
. . .Marine Group I crenarchaeote SCGC AB-629-I23. 531  0.0    1 hit   Archaea:Crenarchaeota:                   glutamate-1-semialdehyde 2,1-aminomutase ...   
. . .Marine Group I thaumarchaeote SCGC AAA799-P11 457  2e-156 1 hit   Archaea:Crenarchaeota:                   Glutamate-1-semialdehyde 21-aminomutase 2 prot...   
. . .Marine Group I thaumarchaeote SCGC AAA799-N04 451  2e-154 1 hit   Archaea:Crenarchaeota:                   Glutamate-1-semialdehyde 21-aminomutase 2 prot...   
. . .Marine Group I thaumarchaeote SCGC AAA799-O18 337  3e-112 1 hit   Archaea:Crenarchaeota:                   Glutamate-1-semialdehyde 21-aminomutase 2 prot...   
. . .Marine Group I thaumarchaeote SCGC AAA799-D11 170  4e-45  2 hits  Archaea:Crenarchaeota:                   Glutamate-1-semialdehyde 21-aminomutase protei...   
. . candidate division YNPFFA..................... 283  1e-88  1 hit   Archaea:Crenarchaeota:                   MULTISPECIES: hypothetical protein [candi...   
. . Metallosphaera cuprina........................ 236  1e-70  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Metallosphaera yellowstonensis................ 230  3e-68  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Metallosphaera sedula......................... 226  6e-67  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Acidianus sp. ALE_1........................... 218  1e-63  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde aminotransferase [Can...   
. . Sulfolobus islandicus......................... 216  5e-63  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Sulfolobus islandicus L.S.2.15................ 216  8e-63  3 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Acidianus hospitalis.......................... 213  8e-62  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Sulfolobus tokodaii str. 7.................... 212  2e-61  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: RecName: Full=Glutamate-1-semialdehyde ...   
. . Sulfolobus solfataricus....................... 212  3e-61  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Sulfolobus solfataricus P2.................... 212  3e-61  3 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Sulfolobus acidocaldarius..................... 203  4e-58  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Sulfolobus acidocaldarius SUSAZ............... 202  2e-57  2 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Sulfolobales archaeon AZ1..................... 225  3e-66  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde aminotransferase [Sul...   
. . Sulfolobales archaeon Acd1.................... 194  9e-55  1 hit   Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: glutamate-1-semialdehyde aminotransferase...   
. . Ignisphaera aggregans......................... 235  8e-70  1 hit   Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Caldivirga maquilingensis..................... 227  9e-67  2 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Vulcanisaeta moutnovskia...................... 222  9e-65  2 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Vulcanisaeta distributa....................... 218  2e-63  2 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Acidilobus saccharovorans..................... 217  4e-63  1 hit   Archaea:Crenarchaeota:Thermoprotei:Acidilobales: glutamate-1-semialdehyde aminotransferase...   
. . Caldisphaera lagunensis....................... 211  3e-61  1 hit   Archaea:Crenarchaeota:Thermoprotei:Acidilobales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. . Hyperthermus butylicus........................ 206  5e-59  2 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde aminotransferase...   
. . Hyperthermus butylicus DSM 5456............... 204  5e-58  5 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. . Vulcanisaeta distributa DSM 14429............. 202  2e-57  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Caldivirga maquilingensis IC-167.............. 201  3e-57  5 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Vulcanisaeta moutnovskia 768-28............... 201  4e-57  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Thermoproteus tenax........................... 200  9e-57  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Pyrobaculum sp. 1860.......................... 198  5e-56  3 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Aeropyrum pernix.............................. 198  5e-56  5 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde aminotransferase...   
. . Aeropyrum pernix K1........................... 198  6e-56  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: Chain A, Crystal Structure Of Glutamate-1-Semialde...   
. . Aeropyrum camini.............................. 197  1e-55  2 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde aminotransferase...   
. . Ignicoccus hospitalis......................... 194  2e-54  1 hit   Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde aminotransferase...   
. . Pyrolobus fumarii............................. 187  7e-52  1 hit   Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde aminotransferase...   
. . Thermoproteus uzoniensis...................... 187  9e-52  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Pyrobaculum calidifontis...................... 187  1e-51  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Pyrobaculum aerophilum........................ 171  6e-46  1 hit   Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: glutamate-1-semialdehyde aminotransferase...   
. . Aeropyrum camini SY1.......................... 170  2e-45  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: glutamate-1-semialdehyde aminotransferase...   
. . crenarchaeote SCGC AAA261-N23................. 176  8e-48  1 hit   Archaea:Crenarchaeota:                   hypothetical protein [crenarchaeote SCGC ...   
. .Thaumarchaeota archaeon N4..................... 477  2e-164 2 hits  Archaea:Thaumarchaeota:                  Glutamate-1-semialdehyde 2,1-aminomutase 2 [T...   
. .Candidatus Caldiarchaeum subterraneum.......... 225  3e-66  11 hits Archaea:Thaumarchaeota:                  glutamate-1-semialdehyde-2,1-aminomutase ...   
. .Candidatus Nitrosopumilus sp. AR2.............. 466  3e-160 3 hits  Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Nitrosopumilus sp. AR.......................... 466  3e-160 1 hit   Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Nitrosopumilus................................. 464  1e-159 2 hits  Archaea:Thaumarchaeota:Nitrosopumilales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. .Candidatus Nitrosopumilus salaria.............. 457  2e-156 1 hit   Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Candidatus Nitrosoarchaeum koreensis........... 455  8e-156 2 hits  Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Nitrosopumilus maritimus....................... 453  4e-155 2 hits  Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Candidatus Nitrosoarchaeum limnia.............. 443  1e-152 4 hits  Archaea:Thaumarchaeota:Nitrosopumilales: class III aminotransferase [Candidatus Ni...   
. .Cenarchaeum symbiosum.......................... 416  2e-140 3 hits  Archaea:Thaumarchaeota:Cenarchaeales:    glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Candidatus Nitrosoarchaeum limnia SFB1......... 407  9e-138 2 hits  Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Candidatus Nitrososphaera gargensis............ 345  1e-112 2 hits  Archaea:Thaumarchaeota:Nitrososphaerales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Candidatus Nitrososphaera evergladensis SR1.... 343  6e-112 2 hits  Archaea:Thaumarchaeota:Nitrososphaerales: glutamate-1-semialdehyde aminotransferase [Can...   
. .Nitrososphaera viennensis EN76................. 343  8e-112 2 hits  Archaea:Thaumarchaeota:Nitrososphaerales: glutamate-1-semialdehyde 2,1-aminomutase [Nitr...   
. .Candidatus Nitrososphaera gargensis Ga9.2...... 196  4e-55  4 hits  Archaea:Thaumarchaeota:Nitrososphaerales: glutamate-1-semialdehyde aminotransferase...   
. .Candidatus Nitrosoarchaeum koreensis MY1....... 176  1e-47  2 hits  Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde aminotransferase...   
. .Candidatus Nitrosoarchaeum limnia BG20......... 176  2e-47  2 hits  Archaea:Thaumarchaeota:                  glutamate-1-semialdehyde aminotransferase...   
. .Nitrosopumilus maritimus SCM1.................. 171  7e-46  5 hits  Archaea:Thaumarchaeota:Nitrosopumilales: glutamate-1-semialdehyde aminotransferase...   
. .Candidatus Nitrosopumilus koreensis AR1........ 168  7e-45  4 hits  Archaea:Thaumarchaeota:Nitrosopumilales: MULTISPECIES: glutamate-1-semialdehyde am...   
. .Methanohalobium evestigatum.................... 233  3e-69  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanosarcina mazei........................... 217  3e-63  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanosarcina mazei Tuc01..................... 216  7e-63  2 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: Glutamate-1-semialdehyde aminotransferase...   
. .Methanosalsum zhilinae......................... 213  1e-61  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanosarcina acetivorans..................... 212  3e-61  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanolobus tindarius......................... 210  2e-60  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Methanosarcina barkeri......................... 209  5e-60  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanohalophilus mahii........................ 207  2e-59  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcoides burtonii...................... 204  2e-58  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanomethylovorans hollandica................ 199  1e-56  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. .Methanolobus psychrophilus..................... 198  3e-56  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanosaeta thermophila....................... 211  8e-61  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Candidatus Methanoperedens nitroreducens....... 210  1e-60  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. .Methanosaeta concilii.......................... 207  2e-59  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Methanosaeta harundinacea...................... 194  2e-54  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: glutamate-1-semialdehyde aminotransferase...   
. .Candidatus Methanomassiliicoccus intestinalis.. 217  2e-63  1 hit   Archaea:Euryarchaeota:Methanomicrobia:   glutamate-1-semialdehyde aminotransferase...   
. .Methanocella conradii.......................... 201  6e-57  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: glutamate-1-semialdehyde aminotransferase...   
. .Methanomassiliicoccus luminyensis.............. 197  1e-55  1 hit   Archaea:Euryarchaeota:Methanomicrobia:   hypothetical protein [Methanomassiliicocc...   
. .Methanoplanus petrolearius..................... 192  7e-54  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocella paludicola........................ 191  2e-53  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: glutamate-1-semialdehyde aminotransferase...   
. .Methanofollis liminatans....................... 191  3e-53  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanosphaerula palustris..................... 191  3e-53  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanoregula boonei........................... 187  7e-52  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocella arvoryzae......................... 185  5e-51  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: glutamate-1-semialdehyde aminotransferase...   
. .Methanoculleus marisnigri...................... 182  3e-50  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanoregula formicica........................ 182  4e-50  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. .Methanoculleus sp. MH98A....................... 180  3e-49  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase [Met...   
. .Methanospirillum hungatei...................... 180  4e-49  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocorpusculum labreanum................... 178  1e-48  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanoplanus limicola......................... 177  4e-48  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanoculleus bourgensis...................... 172  2e-46  1 hit   Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobacterium formicicum.................... 228  2e-67  2 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobacterium sp. Maddingley MBC34.......... 228  3e-67  2 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. .Methanobacterium paludis....................... 224  5e-66  3 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Thermoplasma volcanium......................... 223  1e-65  1 hit   Archaea:Euryarchaeota:Thermoplasmata:Thermoplasmatales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus voltae........................... 220  2e-64  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus aeolicus......................... 219  9e-64  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobacterium lacus......................... 215  2e-62  3 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Ferroplasma acidarmanus........................ 214  5e-62  1 hit   Archaea:Euryarchaeota:Thermoplasmata:Thermoplasmatales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobrevibacter sp. AbM4.................... 214  6e-62  3 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. .Methanobrevibacter smithii..................... 213  1e-61  6 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocaldococcus fervens..................... 213  1e-61  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocaldococcus infernus.................... 213  2e-61  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobrevibacter ruminantium................. 212  2e-61  1 hit   Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobrevibacter smithii DSM 2374............ 211  4e-61  1 hit   Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobrevibacter smithii DSM 2375............ 211  5e-61  1 hit   Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus maripaludis...................... 211  9e-61  5 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanobacterium sp. MB1....................... 209  3e-60  3 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Methanotorris igneus........................... 209  4e-60  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocaldococcus sp. FS406-22................ 209  4e-60  3 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula hispanica........................... 209  5e-60  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus maripaludis X1................... 209  5e-60  2 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula argentinensis....................... 209  6e-60  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanothermus fervidus........................ 208  6e-60  1 hit   Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanothermococcus thermolithotrophicus....... 208  8e-60  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula vallismortis........................ 208  1e-59  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocaldococcus jannaschii DSM 2661......... 207  1e-59  3 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: RecName: Full=Glutamate-1-semialdehyde ...   
. .Methanocaldococcus jannaschii.................. 207  1e-59  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanothermococcus okinawensis................ 207  1e-59  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula sinaiiensis......................... 207  2e-59  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanotorris formicicus....................... 207  2e-59  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Halalkalicoccus jeotgali....................... 207  3e-59  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula amylolytica......................... 207  3e-59  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula..................................... 207  4e-59  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. .Methanococcus maripaludis C6................... 206  4e-59  3 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Methanothermobacter marburgensis............... 206  5e-59  1 hit   Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Archaeoglobus veneficus........................ 206  8e-59  1 hit   Archaea:Euryarchaeota:Archaeoglobi:Archaeoglobales: glutamate-1-semialdehyde aminotransferase...   
. .Haloarcula japonica............................ 206  1e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronorubrum tibetense........................ 206  1e-58  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrinema versiforme........................... 205  2e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halomicrobium katesii.......................... 205  2e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halobiforma nitratireducens.................... 205  2e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halomicrobium mukohataei....................... 204  3e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronococcus occultus......................... 204  4e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronobacterium gregoryi...................... 203  5e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus maripaludis C7................... 203  5e-58  3 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Halonotius sp. J07HN6.......................... 203  7e-58  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum tebenquichense...................... 203  1e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halopiger xanaduensis.......................... 202  9e-58  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus maripaludis C5................... 202  1e-57  3 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Halovivax ruber................................ 202  2e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanocaldococcus villosus.................... 202  2e-57  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Natrinema pallidum............................. 202  3e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorhabdus utahensis.......................... 201  4e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halovivax asiaticus............................ 201  4e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax sp. B-1.............................. 201  4e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronorubrum bangense......................... 201  6e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloterrigena thermotolerans................... 201  8e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronococcus jeotgali......................... 201  8e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrinema altunense............................ 201  9e-57  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrinema pellirubrum.......................... 201  1e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .halophilic archaeon J07ABHX67.................. 201  4e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase [hal...   
. .Natrinema sp. J7............................... 200  1e-56  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloterrigena limicola......................... 200  1e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halobiforma lacisalsi.......................... 200  2e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum hochstenium......................... 200  2e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorhabdus tiamatea........................... 200  2e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum saccharovorum....................... 199  2e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronorubrum sulfidifaciens................... 199  3e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halobacterium salinarum........................ 199  5e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronomonas pharaonis......................... 198  6e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum lipolyticum......................... 198  6e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum distributum......................... 198  7e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haladaptatus paucihalophilus................... 198  9e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halosimplex carlsbadense....................... 198  9e-56  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halococcus morrhuae............................ 198  1e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanococcus vannielii........................ 197  1e-55  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: glutamate-1-semialdehyde aminotransferase...   
. .Halococcus salifodinae......................... 197  1e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halonotius sp. J07ABHN4........................ 197  1e-55  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronococcus amylolyticus..................... 197  2e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halosarcina pallida............................ 197  2e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum..................................... 197  2e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. .Halorubrum litoreum............................ 196  3e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum lacusprofundi....................... 196  3e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natronomonas moolapensis....................... 196  6e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Halococcus thailandensis....................... 196  6e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum californiense....................... 196  6e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum sp. T3.............................. 196  7e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba taiwanensis.......................... 195  8e-55  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba aegyptia............................. 195  9e-55  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halococcus saccharolyticus..................... 195  9e-55  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloquadratum walsbyi.......................... 195  9e-55  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloquadratum walsbyi DSM 16790................ 195  1e-54  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba asiatica............................. 195  1e-54  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba chahannaoensis....................... 194  1e-54  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba magadii.............................. 194  1e-54  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba hulunbeirensis....................... 194  1e-54  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halogeometricum borinquense.................... 194  2e-54  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halococcus hamelinensis........................ 194  4e-54  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloquadratum sp. J07HQX50..................... 193  5e-54  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Methanopyrus kandleri.......................... 193  5e-54  1 hit   Archaea:Euryarchaeota:Methanopyri:Methanopyrales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax elongans............................. 193  7e-54  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax larsenii............................. 192  1e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum coriense............................ 192  1e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum aidingense.......................... 192  1e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax denitrificans........................ 192  1e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halorubrum kocurii............................. 192  2e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Archaeoglobus sulfaticallidus.................. 191  2e-53  1 hit   Archaea:Euryarchaeota:Archaeoglobi:Archaeoglobales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Haloferax sulfurifontis........................ 191  3e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloterrigena turkmenica....................... 191  4e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halostagnicola sp. A56......................... 191  4e-53  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase [Hal...   
. .Haloterrigena salina........................... 191  4e-53  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax prahovense........................... 191  5e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halobacterium sp. DL1.......................... 191  5e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase [Hal...   
. .Haloferax mediterranei......................... 190  6e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax...................................... 190  7e-53  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. .Haloferax sp. BAB2207.......................... 190  8e-53  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax gibbonsii............................ 190  9e-53  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Thermoplasmatales archaeon BRNA1............... 189  1e-52  3 hits  Archaea:Euryarchaeota:Thermoplasmata:Thermoplasmatales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. .Haloferax volcanii............................. 189  2e-52  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloterrigena salina JCM 13891................. 189  2e-52  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halarchaeum acidiphilum........................ 189  2e-52  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloquadratum walsbyi J07HQW2.................. 189  2e-52  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax mucosum.............................. 188  3e-52  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Haloferax sp. ATCC BAA-646..................... 188  4e-52  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. .Candidatus Halobonum tyrrellensis.............. 188  6e-52  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Halostagnicola larsenii XH-48.................. 184  2e-50  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase [Hal...   
. .Natrinema gari................................. 184  3e-50  1 hit   Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba aegyptia DSM 13077................... 184  3e-50  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba taiwanensis DSM 12281................ 182  7e-50  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Ferroglobus placidus........................... 181  1e-49  1 hit   Archaea:Euryarchaeota:Archaeoglobi:Archaeoglobales: glutamate-1-semialdehyde aminotransferase...   
. .Salinarchaeum sp. Harcht-Bsk1.................. 179  7e-49  3 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: glutamate-1-semialdehyde aminotransferase...   
. .Natrialba magadii ATCC 43099................... 176  1e-47  6 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: aminotransferase class III [Natrialba mag...   
. .Natronorubrum tibetense GA33................... 175  4e-47  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: class III aminotransferase [Natronorubrum...   
. .Natrialba hulunbeirensis JCM 10989............. 174  7e-47  2 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: class III aminotransferase [Natrialba hul...   
. .halophilic archaeon DL31....................... 196  6e-55  3 hits  Archaea::                                glutamate-1-semialdehyde aminotransferase...   
. Deferrisoma camini.............................. 272  5e-84  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein [Deferrisoma camini]      
. Candidatus Magnetoglobus multicellularis str. A. 208  2e-60  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: Glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Candidatus Entotheonella sp. TSY2............... 207  3e-59  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein ETSY2_01215 [Candidatus E...   
. Candidatus Entotheonella sp. TSY1............... 201  5e-57  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein ETSY1_22790 [Candidatus E...   
. Geobacter sp. M18............................... 197  7e-56  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Geobacter uraniireducens........................ 197  9e-56  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pelobacter carbinolicus......................... 197  2e-55  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Bdellovibrio bacteriovorus...................... 194  1e-54  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Anaeromyxobacter sp. Fw109-5.................... 194  2e-54  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Haliangium ochraceum............................ 194  2e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfuromonas acetoxidans...................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Desulfotalea psychrophila....................... 193  4e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Geobacter bemidjiensis.......................... 193  4e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Geopsychrobacter electrodiphilus................ 193  4e-54  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Geobacter metallireducens....................... 192  6e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Desulfobacterium autotrophicum.................. 192  8e-54  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Geobacter bremensis............................. 192  1e-53  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Smithella sp. ME-1.............................. 191  2e-53  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: Glutamate-1-semialdehyde aminotransferase...   
. Geobacter sp. M21............................... 191  2e-53  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Smithella sp. SCADC............................. 190  6e-53  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: glutamate-1-semialdehyde aminotransferase [Smi...   
. Geobacter daltonii.............................. 189  1e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Bdellovibrio bacteriovorus str. Tiberius........ 189  1e-52  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pelobacter propionicus.......................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Desulfocapsa sulfexigens........................ 189  2e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pelobacter seleniigenes......................... 188  3e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Bacteriovorax sp. DB6_IX........................ 188  3e-52  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: putative glutamate-1-semialdehyde-2,1-ami...   
. Geobacter sulfurreducens........................ 188  3e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Desulfarculus baarsii........................... 188  4e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfarculales: glutamate-1-semialdehyde aminotransferase...   
. Desulfococcus multivorans....................... 187  8e-52  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Desulfobacula toluolica......................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfuromonas sp. TF........................... 186  1e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio fructosivorans.................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Bacteriovorax sp. Seq25_V....................... 186  2e-51  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: putative glutamate-1-semialdehyde-2,1-ami...   
. Anaeromyxobacter sp. K.......................... 185  4e-51  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfosarcina sp. BuS5......................... 185  4e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfotignum balticum.......................... 185  5e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio magneticus........................ 185  5e-51  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Nitrospina sp. AB-629-B18....................... 185  6e-51  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Nitrospina sp. AB-6...   
. Desulfovibrio sp. U5L........................... 184  8e-51  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio sp. FW1012B....................... 184  9e-51  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Anaeromyxobacter dehalogenans................... 184  1e-50  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Anaeromyxobacter dehalogenans 2CP-1............. 184  2e-50  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfurivibrio alkaliphilus.................... 184  2e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfobacula sp. TS............................ 183  2e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfomonile tiedjei........................... 183  3e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: glutamate-1-semialdehyde aminotransferase...   
. Sorangium cellulosum............................ 183  4e-50  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfohalobium retbaense....................... 182  4e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio magneticus RS-1................... 182  4e-50  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Hippea maritima................................. 182  6e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: glutamate-1-semialdehyde aminotransferase...   
. Geobacter lovleyi............................... 182  9e-50  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: glutamate-1-semialdehyde aminotransferase...   
. Desulfatirhabdium butyrativorans................ 181  2e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfonauticus sp. A7A......................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Bacteriovorax sp. BSW11_IV...................... 181  2e-49  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: putative glutamate-1-semialdehyde-2,1-ami...   
. Bacteriovorax marinus........................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio piger............................. 180  3e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio alcoholovorans.................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Nitrospina gracilis............................. 180  4e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: Glutamate-1-semialdehyde-2,1-aminomutase ...   
. Bdellovibrio bacteriovorus W.................... 179  5e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: glutamate-1-semialdehyde aminotransferase [Bde...   
. Desulfobulbus elongatus......................... 179  6e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfotignum phosphitoxidans................... 179  6e-49  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacteriovorax sp. BAL6_X........................ 179  8e-49  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: putative glutamate-1-semialdehyde-2,1-ami...   
. Desulfobulbus propionicus....................... 179  1e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovermiculus halophilus.................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio oxyclinae......................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio desulfuricans..................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfobulbus japonicus......................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Stigmatella aurantiaca.......................... 177  4e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Sorangium cellulosum So0157-2................... 177  4e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio hydrothermalis.................... 177  4e-48  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde 2,1-aminotransfe...   
. Desulfobacca acetoxidans........................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfospira joergensenii....................... 177  5e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. delta proteobacterium MLMS-1.................... 177  6e-48  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Desulfatibacillum aliphaticivorans.............. 176  7e-48  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio desulfuricans subsp. desulfurican. 176  9e-48  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio aminophilus....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio salexigens........................ 176  2e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfatibacillum alkenivorans.................. 175  2e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Hippea sp. KM1.................................. 175  3e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: glutamate-1-semialdehyde aminotransferase...   
. Hippea alviniae................................. 175  4e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio sp. 3_1_syn3...................... 174  5e-47  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Cystobacter fuscus.............................. 174  5e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Glutamate-1-semialdehyde aminotransferase...   
. Cystobacter violaceus Cb vi76................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase [Cys...   
. Desulfovibrio sp. 6_1_46AFAA.................... 174  7e-47  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. delta proteobacterium NaphS2.................... 174  9e-47  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Myxococcus stipitatus........................... 174  1e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfomicrobium baculatum...................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfococcus oleovorans........................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio alkalitolerans.................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bdellovibrio exovorus........................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Lawsonia intracellularis........................ 172  3e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio piezophilus....................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Desulfovibrio alaskensis........................ 171  5e-46  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio vulgaris.......................... 171  6e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Chondromyces apiculatus DSM 436................. 171  8e-46  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Glutamate-1-semialdehyde aminotransferase [Cho...   
. Desulfobacter postgatei......................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfobacter curvatus.......................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Hyalangium minutum.............................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Glutamate-1-semialdehyde aminotransferase [Hya...   
. Desulfobulbus mediterraneus..................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Nitrospina sp. AB-629-B06....................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfatiglans anilini.......................... 169  3e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulforegula conservatrix...................... 169  3e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio sp. X2............................ 169  3e-45  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Desulfonatronospira thiodismutans............... 169  4e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Syntrophus aciditrophicus....................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: glutamate-1-semialdehyde aminotransferase...   
. SAR324 cluster bacterium SCGC AAA001-C10........ 169  5e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio................................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Corallococcus coralloides....................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio inopinatus........................ 169  6e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio putealis.......................... 168  7e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfovibrio frigidus.......................... 168  9e-45  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: glutamate-1-semialdehyde aminotransferase...   
. Desulfurella acetivorans A63.................... 168  1e-44  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: glutamate-1-semialdehyde aminotransferase [Des...   
. Wigglesworthia glossinidia...................... 213  1e-61  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Legionella massiliensis......................... 211  5e-61  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Glutamate-1-semialdehyde 2,1-aminomutase [Leg...   
. Wigglesworthia glossinidia endosymbiont of Glos. 205  1e-58  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas aeruginosa VRFPA01.................. 204  3e-58  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas aeruginosa.......................... 204  3e-58  27 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Idiomarina loihiensis........................... 203  8e-58  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas aeruginosa PA7...................... 201  3e-57  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas aeruginosa UCBPP-PA14............... 201  4e-57  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudoxanthomonas suwonensis.................... 201  5e-57  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium SCGC AAA300-D14........... 201  5e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. Fluoribacter dumoffii........................... 201  6e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas aeruginosa PAO1..................... 201  6e-57  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate 1-semialdehyde 2,1-aminomutase [Pse...   
. Pseudomonas stutzeri............................ 201  7e-57  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas sp. 2_1_26.......................... 200  7e-57  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas aeruginosa c7447m................... 200  8e-57  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas aeruginosa SCV20265................. 200  8e-57  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas..................................... 200  8e-57  22 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas aeruginosa MSH-10................... 200  8e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas aeruginosa PA21_ST175............... 200  8e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella drancourtii.......................... 200  8e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas aeruginosa BL07..................... 200  9e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella pneumophila.......................... 200  9e-57  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas aeruginosa BWH035................... 200  9e-57  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Histophilus somni............................... 200  1e-56  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Legionella cherrii.............................. 200  1e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Haemophilus somnus 129PT........................ 200  1e-56  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas aeruginosa MH27..................... 200  2e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Oceanospirillum maris........................... 199  2e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium SCGC AAA168-I18........... 199  2e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Piscirickettsia salmonis........................ 199  2e-56  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pseudomonas aeruginosa BL22..................... 199  3e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Silanimonas lenta............................... 199  3e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas syringae............................ 199  3e-56  21 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudoxanthomonas sp. J31....................... 199  3e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. StFLB209........................ 199  3e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Ps...   
. Pseudomonas sp. BZ93............................ 199  3e-56  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas sp. PAMC 26793...................... 199  3e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas aeruginosa PA1R..................... 198  4e-56  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas nitroreducens....................... 198  4e-56  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. 12M76_air....................... 198  4e-56  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Ps...   
. Pseudomonas mandelii PD30....................... 198  4e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Legionella pneumophila str. Paris............... 198  5e-56  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoxanthomonas sp. J35....................... 198  5e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas stutzeri MF28....................... 198  5e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Catenovulum agarivorans DS-2.................... 198  5e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [Cat...   
. Marinomonas mediterranea........................ 198  6e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella fairfieldensis....................... 198  6e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoxanthomonas sp. GW2....................... 198  6e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Lysobacter defluvii............................. 198  6e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas cichorii JBC1....................... 198  6e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Pse...   
. Pseudomonas taeanensis.......................... 198  7e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas viridiflava......................... 198  7e-56  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella wadsworthii.......................... 198  7e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas alcaliphila......................... 197  8e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas extremaustralis..................... 197  9e-56  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella pneumophila subsp. pneumophila....... 197  9e-56  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Oceanospirillales bacterium SCGC AAA298-N10..... 197  1e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella pneumophila str. Corby............... 197  1e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Catenovulum agarivorans......................... 197  1e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas viridiflava UASWS0038............... 197  1e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas pseudoalcaligenes................... 197  1e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella pneumophila str. Lens................ 197  2e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas fluorescens......................... 197  2e-55  15 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. M47T1........................... 197  2e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thiorhodococcus sp. AK35........................ 197  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: Glutamate-1-semialdehyde aminotransferase [Thi...   
. Roseobacter sp. MED193.......................... 196  2e-55  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CHM02........................... 196  2e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. PAMC 25886...................... 196  2e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CFT9............................ 196  2e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pseudomonas sp. VLB120.......................... 196  2e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. gamma proteobacterium L18....................... 196  3e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. RL.............................. 196  3e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. M1.............................. 196  3e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. AAC............................. 196  3e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas syringae pv. syringae B728a......... 196  3e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM41(2012)...................... 196  3e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. LAMO17WK12:I2................... 196  3e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM49............................ 196  3e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas synxantha........................... 196  3e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. gamma proteobacterium HIMB55.................... 196  4e-55  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. S9.............................. 196  4e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. Ag1............................. 196  4e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas thermotolerans...................... 196  4e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas luteola............................. 196  4e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens NCIMB 11764............. 196  4e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens SBW25................... 196  4e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas knackmussii B13..................... 196  4e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Ps...   
. Stenotrophomonas sp. SKA14...................... 196  5e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. RIT357.......................... 196  5e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Stenotrophomonas maltophilia SKK35.............. 196  5e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [St...   
. Marinospirillum insulare........................ 195  6e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Marinospirillum ins...   
. Pseudomonas plecoglossicida..................... 195  6e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas mosselii SJ10....................... 195  6e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas sp. TKP............................. 195  6e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Stenotrophomonas maltophilia.................... 195  6e-55  16 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas syringae pv. oryzae str. 1_6........ 195  7e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas agarici............................. 195  7e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas resinovorans........................ 195  7e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens WH6..................... 195  7e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas putida.............................. 195  8e-55  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Stenotrophomonas maltophilia MF89............... 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Arenimonas malthae CC-JY-1...................... 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Are...   
. Pasteurella pneumotropica....................... 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Legionella oakridgensis ATCC 33761 = DSM 21215.. 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde-2,1-aminomutase [Legi...   
. Pseudomonas sp. GM55............................ 195  8e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. HPB0071......................... 195  8e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. URMO17WK12:I12.................. 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. HY-24........................... 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Francisella sp. TX077308........................ 195  8e-55  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas denitrificans....................... 195  8e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia sp. JV3............................ 195  9e-55  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis.......................... 195  9e-55  15 hits Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. GM33............................ 195  9e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM84............................ 195  9e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella pneumophila subsp. pneumophila LPE50. 195  9e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Glutamate-1-semialdehyde aminotransferase...   
. Thermomonas fusca............................... 195  9e-55  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas putida UW4.......................... 195  9e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas sp. GM48............................ 195  9e-55  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM78............................ 195  1e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas syringae group...................... 195  1e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas syringae pv. actinidiae str. M30209. 195  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas syringae pv. tomato str. DC3000..... 195  1e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Stenotrophomonas maltophilia M30................ 195  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Ste...   
. Pseudomonas geniculata.......................... 195  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio rumoiensis............................... 195  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas mendocina........................... 195  1e-54  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella pneumophila subsp. pneumophila str. . 195  1e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas syringae Cit 7...................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM17............................ 194  1e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas brenneri FH4........................ 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Pse...   
. Pseudomonas syringae pv. aptata str. DSM 50252.. 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Phaeobacter gallaeciensis....................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas corrugata........................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rhodanobacter................................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pseudomonas sp. G5(2012)........................ 194  1e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Francisella novicida............................ 194  1e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas chlororaphis........................ 194  1e-54  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. URMO17WK12:I8................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Neptuniibacter caesariensis..................... 194  1e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas entomophila......................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rhodanobacter sp. OR444......................... 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas extremorientalis FH1................ 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Pse...   
. Stenotrophomonas maltophilia RA8................ 194  1e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas mendocina ymp....................... 194  2e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas cremoricolorata..................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM16............................ 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas mendocina AD6....................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas sp. 1-7............................. 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Stenotrophomonas maltophilia R551-3............. 194  2e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Ruegeria conchae................................ 194  2e-54  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CBZ-4........................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fuscovaginae........................ 194  2e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens SS101................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. Ant30-3......................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM30............................ 194  2e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM21............................ 194  2e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Legionella shakespearei......................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Haemophilus pittmaniae.......................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. RIT288.......................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas chlororaphis subsp. aureofaciens 30. 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Dyella jiangningensis........................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Dye...   
. Pseudomonas sp. CF161........................... 194  2e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. GM60............................ 194  2e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. TJI-51.......................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas sp. URHB0015........................ 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Stenotrophomonas sp. RIT309..................... 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Glutamate-1-semialdehyde 2,1-aminomutase [Sten...   
. Pseudomonas sp. GM80............................ 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas putida group........................ 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas putida BIRD-1....................... 194  2e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Stenotrophomonas maltophilia 5BA-I-2............ 194  2e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio parahaemolyticus......................... 194  2e-54  81 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas mandelii JR-1....................... 194  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Pse...   
. Chromohalobacter salexigens..................... 194  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens BRIP34879............... 194  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas fluorescens Q2-87................... 194  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Francisella philomiragia........................ 194  3e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis subsp. tularensis SCHU S. 194  3e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas mendocina DLHK...................... 194  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas putida W619......................... 194  3e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas poae................................ 194  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Haemophilus parasuis............................ 193  3e-54  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pseudomonas fluorescens R124.................... 193  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas putida KT2440....................... 193  3e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CMAA1215........................ 193  3e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Francisella tularensis subsp. tularensis WY96-3. 193  3e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas veronii............................. 193  3e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas mosselii............................ 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas putida GB-1......................... 193  4e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rhodobacteraceae bacterium KLH11................ 193  4e-54  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens HK44.................... 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas amygdali............................ 193  4e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas syringae group genomosp. 2.......... 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas sp. HYS............................. 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas syringae pv. lachrymans str. M30131. 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas moraviensis......................... 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas mendocina NK-01..................... 193  4e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CFII68.......................... 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pseudomonas syringae group genomosp. 3.......... 193  4e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens EGD-AQ6................. 193  5e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas sp. GM25............................ 193  5e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas alcaligenes......................... 193  5e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. FGI182.......................... 193  5e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas chlororaphis subsp. aurantiaca PB-S. 193  5e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. LAIL14HWK12:I12................. 193  5e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas putida S16.......................... 193  5e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas fluorescens Q8r1-96................. 193  5e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Stenotrophomonas maltophilia K279a.............. 193  5e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio vulnificus............................... 193  5e-54  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas monteilii........................... 193  5e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas putida H8234........................ 193  5e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio vulnificus YJ016......................... 193  6e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Francisella cf. novicida Fx1.................... 193  6e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas pseudoalcaligenes KF707............. 192  6e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. GM102........................... 192  6e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudomonas sp. EGD-AK9......................... 192  6e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Haemophilus parasuis HPS10...................... 192  6e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase [Hae...   
. Haemophilus parasuis D74........................ 192  6e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Phaeobacter caeruleus........................... 192  6e-54  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio vulnificus CMCP6......................... 192  7e-54  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Herbaspirillum lusitanum........................ 192  7e-54  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Haemophilus parasuis 84-15995................... 192  7e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Haemophilus parasuis ST4-2...................... 192  7e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase [Hae...   
. Legionella lansingensis......................... 192  7e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio parahaemolyticus 10329................... 192  7e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Thiorhodococcus drewsii......................... 192  7e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. GM67............................ 192  7e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CFII64.......................... 192  8e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Leisingera methylohalidivorans.................. 192  8e-54  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Stenotrophomonas maltophilia Ab55555............ 192  8e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Francisella noatunensis......................... 192  8e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Rhodanobacter thiooxydans....................... 192  8e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas brassicacearum...................... 192  8e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Pseudomonas putida S610......................... 192  9e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pseudomonas fluorescens F113.................... 192  9e-54  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Haemophilus parasuis HPS11...................... 192  9e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase [Hae...   
. Vibrio fortis................................... 192  9e-54  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vib...   
. Pseudomonas putida NBRC 14164................... 192  1e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Mannheimia succiniciproducens................... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas parafulva........................... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Haemophilus parasuis gx033...................... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis subsp. mediasiatica FSC1. 192  1e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Idiomarina xiamenensis.......................... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. GM50............................ 192  1e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. P818............................ 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio parahaemolyticus 970107.................. 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Luminiphilus syltensis.......................... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens group................... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Francisella novicida U112....................... 192  1e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Bibersteinia trehalosi USDA-ARS-USMARC-190...... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Glutamate-1-semialdehyde 2,1-aminomutase [Bibe...   
. Stenotrophomonas maltophilia EPM1............... 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. LAIL14HWK12:I7.................. 192  1e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas fluorescens Pf0-1................... 192  1e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Haemophilus parasuis SH0165..................... 192  1e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas fulva 12-X.......................... 192  1e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Haemophilus parasuis ZJ0906..................... 192  1e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Wolinella succinogenes.......................... 192  2e-53  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas sp. SHU308.......................... 192  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Coxiella burnetii............................... 192  2e-53  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Coxiella burnetii Dugway 5J108-111.............. 192  2e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Coxiella burnetii CbuG_Q212..................... 192  2e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Thalassolituus oleivorans....................... 192  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Coxiella burnetii RSA 493....................... 192  2e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Haemophilus sp. CCUG 13788...................... 191  2e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Magnetococcus marinus........................... 191  2e-53  1 hit   Bacteria:Proteobacteria:                 glutamate-1-semialdehyde aminotransferase...   
. Stenotrophomonas maltophilia D457............... 191  2e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas alkylphenolia....................... 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase [Pse...   
. Vibrio litoralis................................ 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. URMO17WK12:I3................... 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thalassolituus oleivorans R6-15................. 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase [Tha...   
. Pseudomonas sp. GM18............................ 191  2e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas psychrotolerans..................... 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas sacchari............................ 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Rhodanobacter sp. OR87.......................... 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis subsp. holarctica PHIT-F. 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase [Fra...   
. Vibrio parahaemolyticus RIMD 2210633............ 191  2e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Diplorickettsia massiliensis.................... 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas putida CSV86........................ 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas anticariensis......................... 191  2e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio parahaemolyticus BB22OP.................. 191  3e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Arenimonas oryziterrae.......................... 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Arenimonas metalli CF5-1........................ 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Are...   
. Bradyrhizobium sp. WSM1417...................... 191  3e-53  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Bradyrhizobiu...   
. Pseudomonas sp. PH1b............................ 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acidithiobacillus caldus........................ 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas syringae Lz4W....................... 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Legionella longbeachae.......................... 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Acidithiobacillus caldus ATCC 51756............. 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: Glutamate-1-semialdehyde aminotransferase [Aci...   
. Actinobacillus ureae............................ 191  3e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Rhodanobacter spathiphylli...................... 191  4e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Bibersteinia trehalosi.......................... 191  4e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Francisella philomiragia subsp. philomiragia AT. 191  4e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. 313............................. 191  4e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas umsongensis......................... 191  4e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas stutzeri A1501...................... 191  4e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio sp. Ex25................................. 191  4e-53  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis subsp. holarctica FSC022. 191  4e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio splendidus............................... 190  5e-53  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrionales bacterium SWAT-3.................... 190  5e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Marinospirillum minutulum....................... 190  5e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Marinospirillum min...   
. Dyella japonica................................. 190  5e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. Chol1........................... 190  5e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio alginolyticus............................ 190  6e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. gamma proteobacterium SCGC AAA076-P09........... 190  6e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio vulnificus BAA87......................... 190  6e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Haemophilus parainfluenzae ATCC 33392........... 190  7e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde-2,1-aminomutase [Haem...   
. Haemophilus parainfluenzae...................... 190  7e-53  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio sp. B183................................. 190  7e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vib...   
. Vibrio coralliilyticus.......................... 190  7e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio parahaemolyticus 16...................... 190  7e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Endozoicomonas numazuensis...................... 190  8e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein GZ78_19535 [Endozoicomona...   
. Pseudoalteromonas sp. BSi20439.................. 190  8e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio.......................................... 190  8e-53  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Halomonas sp. BJGMM-B45......................... 190  8e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. SAR86 cluster bacterium SAR86E.................. 190  8e-53  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pseudomonas mendocina S5.2...................... 190  8e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Ruegeria sp. R11................................ 190  9e-53  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio owensii JCM 18905........................ 190  9e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Vibrio sp. F6................................... 190  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Ferrimonas senticii............................. 189  9e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Rudaea cellulosilytica.......................... 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis subsp. holarctica OSU18.. 189  1e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Idiomarina baltica.............................. 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Mesorhizobium sp. LNJC384A00.................... 189  1e-52  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glutamate-1-semialdehyde 2,1-aminomutase [Meso...   
. Vibrio gazogenes................................ 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio brasiliensis............................. 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. BAY1662......................... 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pseu...   
. Vibrio halioticoli.............................. 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alcanivorax pacificus........................... 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cycloclasticus.................................. 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Pseudoalteromonas undina........................ 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio sp. JCM 19052............................ 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Pseudomonas stutzeri ATCC 14405 = CCUG 16156.... 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. TS44............................ 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cycloclasticus sp. P1........................... 189  1e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas sp. CF149........................... 189  1e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Neptunomonas sp. Rs1............................ 189  1e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio parahaemolyticus AQ3810.................. 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter aphrophilus..................... 189  1e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio sp. 624788............................... 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Azotobacter vinelandii.......................... 189  1e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinobacillus minor............................ 189  2e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Wohlfahrtiimonas chitiniclastica................ 189  2e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Wohlfahrtiimonas ch...   
. Helicobacter bilis.............................. 189  2e-52  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Calyptogena okutanii thioautotrophic gill symbi. 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rhodobacteraceae bacterium HIMB11............... 189  2e-52  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde aminotransferase...   
. Cobetia marina.................................. 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase [Cob...   
. Vibrio orientalis............................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio alginolyticus 12G01...................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Proteobacteria bacterium JGI 0000113-E04........ 189  2e-52  1 hit   Bacteria:Proteobacteria:                 glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas stutzeri DSM 10701.................. 189  2e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Glaciecola lipolytica........................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acidithiobacillus ferrooxidans.................. 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Marinobacterium jannaschii...................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Mannheimia granulomatis......................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Acidithiobacillus sp. GGI-221................... 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glutamate-1-semialdehyde aminotransferase [Aci...   
. Acidithiobacillus thiooxidans................... 189  2e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glutamate-1-semialdehyde aminotransferase...   
. Ectothiorhodospira sp. PHS-1.................... 189  2e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinobacillus minor 202........................ 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio owensii JCM 18904........................ 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Vibrio harveyi.................................. 189  2e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio harveyi group............................ 189  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Ferrimonas balearica............................ 188  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas azotifigens......................... 188  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. SAR 116 cluster alpha proteobacterium HIMB100... 188  2e-52  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio cholerae HENC-01......................... 188  2e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Marinobacterium stanieri........................ 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Mannheimia haemolytica.......................... 188  3e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Francisella tularensis subsp. holarctica LVS.... 188  3e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio cholerae HENC-03......................... 188  3e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Cobetia crustatorum............................. 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas sp. BSi20480.................. 188  3e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas sp. SM9913.................... 188  3e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas............................... 188  3e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Xanthomonas translucens......................... 188  3e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio ordalii.................................. 188  3e-52  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio tasmaniensis............................. 188  3e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Mannheimia haemolytica serotype A2 str. OVINE... 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas sp. PAMC 22718................ 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Thiocystis violascens........................... 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Mesorhizobium sp. LNJC395A00.................... 188  3e-52  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio harveyi 1DA3............................. 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio azureus.................................. 188  3e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Listonella anguillarum.......................... 188  3e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pseudomonas stutzeri NF13....................... 188  4e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio sinaloensis.............................. 188  4e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Actinobacillus pleuropneumoniae................. 188  4e-52  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas fragi............................... 188  4e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinobacillus pleuropneumoniae serovar 7 str. . 188  4e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Actinobacillus pleuropneumoniae serovar 3 str. . 188  4e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter sp. AK21........................... 188  4e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Glutamate-1-semialdehyde aminotransferase [Mar...   
. Vibrio anguillarum 775.......................... 188  6e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter segnis.......................... 187  4e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Saccharophagus degradans........................ 187  5e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Halomonas zhanjiangensis........................ 187  5e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudoalteromonas marina........................ 187  5e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Mannheimia haemolytica D35...................... 187  5e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella marina............................... 187  5e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter nanhaiticus........................ 187  6e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Acidithiobacillus ferrivorans................... 187  6e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: Glutamate-1-semialdehyde 2,1-aminomutase (GSA...   
. Bradyrhizobium japonicum........................ 187  6e-52  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Bradyrhizobiu...   
. Nitratiruptor sp. SB155-2....................... 187  6e-52  4 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas citrea........................ 187  6e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. HAL1.............................. 187  6e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acidithiobacillus ferrivorans SS3............... 187  6e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Luteimonas sp. J29.............................. 187  6e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudidiomarina sediminum....................... 187  6e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas stutzeri RCH2....................... 187  6e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Haemophilus paraphrohaemolyticus................ 187  7e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter macacae............................ 187  7e-52  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Photobacterium phosphoreum ANT220............... 187  7e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase (am...   
. Vibrio alginolyticus NBRC 15630................. 187  8e-52  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. HL-48............................. 187  8e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Teredinibacter turnerae......................... 187  8e-52  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas stutzeri KOS6....................... 187  8e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio ponticus................................. 187  8e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Halomonas sp. KO116............................. 187  9e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Glutamate-1-semialdehyde 2,1-aminomutase [Halo...   
. Vibrio campbellii ATCC BAA-1116................. 187  9e-52  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: RecName: Full=Glutamate-1-semialdehyde ...   
. Vibrio breoganii................................ 187  9e-52  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Xylella fastidiosa.............................. 187  9e-52  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Mannheimia varigena USDA-ARS-USMARC-1388........ 187  9e-52  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Glutamate-1-semialdehyde 2,1-aminomutase [Mann...   
. Xanthomonas sp. 97M............................. 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. TD01.............................. 187  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Mesorhizobium loti.............................. 187  1e-51  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Gammaproteobacteria bacterium MOLA455........... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Glutamate-1-semialdehyde 2,1-aminomutase [Gamm...   
. Pseudoalteromonas piscicida..................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Alteromonadales bacterium TW-7.................. 187  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas sp. SHU199.......................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Neptunomonas japonica........................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio kanaloae................................. 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter aphrophilus ATCC 33389.......... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium SCGC AAA076-P13........... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Glaciecola psychrophila......................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Aggregatibacter actinomycetemcomitans serotype . 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde-2,1-aminomutase [Aggr...   
. Pseudoalteromonas sp. NJ631..................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio mimicus VM603............................ 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio sp. MED222............................... 187  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Lysobacter antibioticus......................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter actinomycetemcomitans........... 187  1e-51  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Photodesmus blepharus................ 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Mannheimia varigena USDA-ARS-USMARC-1261........ 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Glutamate-1-semialdehyde 2,1-aminomutase [Mann...   
. SAR86 cluster bacterium SAR86C.................. 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio mimicus.................................. 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium HTCC2207.................. 187  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio crassostreae............................. 187  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio cyclitrophicus FF75...................... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Xylella fastidiosa subsp. sandyi Ann-1.......... 187  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Glutamate-1-semialdehyde-2,1-aminomutase ...   
. Vibrio campbellii............................... 187  2e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Xylella fastidiosa M12.......................... 187  2e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas sp. 20_BN........................... 186  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase [Pse...   
. Methylophaga aminisulfidivorans................. 186  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio cyclitrophicus........................... 186  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas arctica....................... 186  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pasteurella bettyae............................. 186  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Gilliamella apicola.................. 186  1e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria: Glutamate-1-semialdehyde aminotransferase [Gil...   
. Pseudoalteromonas sp. BSi20495.................. 186  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas haloplanktis.................. 186  1e-51  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Lysobacter sp. URHA0019......................... 186  1e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas sp. Bsw20308.................. 186  1e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudomonas psychrophila........................ 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio splendidus 12B01......................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas agarivorans S816.............. 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter rodentium.......................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Arenimonas composti............................. 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Idiomarina sp. MCCC 1A10513..................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [Idi...   
. Pseudoalteromonas haloplanktis ANT/505.......... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Legionella moravica............................. 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas lipolytica SCSIO 04301........ 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [Pse...   
. Helicobacter bilis ATCC 43879................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Photobacterium profundum........................ 186  2e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio cholerae................................. 186  2e-51  21 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Arenimonas donghaensis DSM 18148................ 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Are...   
. Vibrio cholerae O1 biovar El Tor str. N16961.... 186  2e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Marichromatium purpuratum 984................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase [Mari...   
. Thiobacillus prosperus.......................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase [Thi...   
. Salinisphaera shabanensis....................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio sp. RC341................................ 186  2e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio splendidus LGP32......................... 186  2e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Avibacterium paragallinarum..................... 186  2e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas sp. TB51...................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio cholerae LMA3984-4....................... 186  2e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter actinomycetemcomitans D17P-3.... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Avibacterium paragallinarum JF4211.............. 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Putative Glutamate-1-semialdehyde 2,1-ami...   
. Legionella sainthelensi......................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter actinomycetemcomitans serotype . 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Xylella fastidiosa Mul-MD....................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Xyl...   
. Glaciecola polaris.............................. 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Nitrincola lacisaponensis....................... 186  2e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Glutamate-1-semialdehyde aminotransferase [Nit...   
. Glaciecola sp. 4H-3-7+YE-5...................... 186  2e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas flavipulchra.................. 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Methylohalobius crimeensis...................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Halomonas....................................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: MULTISPECIES: Tetrapyrrole biosynthesis, ...   
. Vibrio tubiashii................................ 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas chloritidismutans................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Leucothrix mucor................................ 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ruegeria pomeroyi............................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Tolumonas sp. BRL6-1............................ 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Stenotrophomonas rhizophila..................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Ste...   
. Thioalkalivibrio thiocyanodenitrificans......... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bradyrhizobium sp. URHA0002..................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Bradyrhizobiu...   
. Glaciecola agarilytica.......................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio cholerae MZO-2........................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Glaciecola chathamensis......................... 186  3e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ralstonia sp. AU12-08........................... 186  4e-51  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter canis.............................. 186  4e-51  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Aggregatibacter sp. oral taxon 458.............. 186  4e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Halomonas sp. S18214............................ 185  4e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rhodanobacter sp. 115........................... 185  4e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Marinomonas sp. MED121.......................... 185  4e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Hafnia alvei ATCC 13337......................... 185  4e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Haf...   
. Vibrio metschnikovii............................ 185  4e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas campestris.......................... 185  4e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pasteurella multocida........................... 185  4e-51  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. GFAJ-1............................ 185  4e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudoalteromonas haloplanktis TAC125........... 185  4e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio fluvialis................................ 185  4e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glutamate-1-semialdehyde aminotransferase...   
. Vibrio ezurae................................... 185  5e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Lamprocystis purpurea........................... 185  5e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Nisaea salexigens............................... 185  5e-51  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Glaciecola arctica.............................. 185  5e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas cassavae............................ 185  5e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Gallibacterium anatis........................... 185  5e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Gallibacterium anatis UMN179.................... 185  5e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Nitrincola sp. AK23............................. 185  5e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Glutamate-1-semialdehyde 2,1-aminomutase [Nitr...   
. Pandoraea sp. SD6-2............................. 185  5e-51  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pasteurella multocida subsp. multocida str. Pm7. 185  5e-51  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Herbaspirillum sp. CF444........................ 185  5e-51  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pantoea ananatis................................ 185  5e-51  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas translucens DAR61454................ 185  6e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter sp. ES-1........................... 185  6e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Photobacterium profundum 3TCK................... 185  6e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter manganoxydans...................... 185  6e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudoxanthomonas spadix........................ 185  6e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio proteolyticus............................ 185  6e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bradyrhizobium elkanii.......................... 185  8e-51  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Bradyrhizobiu...   
. Mannheimia varigena USDA-ARS-USMARC-1312........ 184  7e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Glutamate-1-semialdehyde 2,1-aminomutase [Mann...   
. Halomonas alkaliantarctica...................... 184  7e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella sp. 38A_GOM-205m..................... 184  7e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Luteimonas mephitis............................. 184  7e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Gilliamella apicola SCGC AB-598-B02............. 184  7e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Glutamate-1-semialdehyde aminotransferase [Gil...   
. Thermithiobacillus tepidarius................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: glutamate-1-semialdehyde aminotransferase...   
. Marinomonas ushuaiensis DSM 15871............... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase [Mari...   
. Tolumonas auensis............................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Methylobacillus flagellatus..................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinobacillus succinogenes..................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Zooshikella ganghwensis......................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas arboricola pv. pruni MAFF 301420.... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Xa...   
. Shewanella amazonensis.......................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas tunicata...................... 184  8e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Nisaea denitrificans............................ 184  9e-51  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio sp. RC586................................ 184  9e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Providencia rettgeri............................ 184  9e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pantoea ananatis LMG 5342....................... 184  9e-51  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas luteoviolacea................. 184  1e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Hydrocarboniphaga effusa........................ 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas sp. BSi20429.................. 184  1e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Photobacterium damselae......................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium HTCC5015.................. 184  1e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thiothrix disciformis........................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Halomonas jeotgali.............................. 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas..................................... 184  1e-50  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Neptunomonas sp. Rs2............................ 184  1e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shewanella baltica.............................. 184  1e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Legionella geestiana............................ 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde aminotransferase...   
. Bradyrhizobium sp. Cp5.3........................ 184  1e-50  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Bradyrhizobiu...   
. Xanthomonas campestris pv. campestris str. ATCC. 184  1e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas axonopodis pv. citri str. 306....... 184  1e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pseudoalteromonas spongiae...................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Rhodopseudomonas palustris...................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Rhodopseudomo...   
. Xanthomonas translucens pv. graminis ART-Xtg29.. 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas axonopodis.......................... 184  1e-50  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Snodgrassella alvi SCGC AB-598-O02.............. 184  1e-50  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Glutamate-1-semialdehyde aminotransferase [Sno...   
. Campylobacter jejuni subsp. jejuni HPC5......... 184  1e-50  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Xanthomonas fuscans............................. 184  1e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Budvicia aquatica............................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Marinomonas sp. MWYL1........................... 184  1e-50  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Lysobacter capsici AZ78......................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Lys...   
. Moritella dasanensis............................ 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas fuscans subsp. aurantifolii str. IC. 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. KM-1.............................. 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shewanella haliotis............................. 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Bermanella marisrubri........................... 184  1e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Hafnia alvei.................................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas fuscans subsp. fuscans.............. 184  1e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: probable glutamate-1-semialdehyde aminotr...   
. Oceanimonas sp. GK1............................. 184  1e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Allochromatium vinosum.......................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni 10227...................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Aliivibrio fischeri............................. 184  1e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Gayadomonas joobiniege.......................... 184  1e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Ferrimonas futtsuensis.......................... 184  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Methylophaga nitratireducenticrescens........... 184  2e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinobacillus pleuropneumoniae serovar 10 str.. 184  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas atlantica..................... 184  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio fischeri SR5............................. 184  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio fluvialis PG41........................... 184  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glutamate-1-semialdehyde aminotransferase...   
. Vibrio nigripulchritudo......................... 184  2e-50  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Amphritea japonica.............................. 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Psychromonas aquimarina......................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas campestris pv. vesicatoria str. 85-. 183  2e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pseudoalteromonas luteoviolacea B = ATCC 29581.. 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Glutamate-1-semialdehyde aminotransferase...   
. Enterobacteriaceae.............................. 183  2e-50  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Hahella ganghwensis............................. 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas oryzae.............................. 183  2e-50  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter actinomycetemcomitans D11S-1.... 183  2e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio furnissii................................ 183  2e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio nigripulchritudo AM115................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio albensis................................. 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio nigripulchritudo BLFn1................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio fischeri MJ11............................ 183  2e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum.......................... 183  2e-50  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase [Ral...   
. Ectothiorhodospiraceae.......................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Shewanella baltica OS185........................ 183  2e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium IMCC1989.................. 183  2e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Colwellia psychrerythraea....................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Leisingera aquimarina........................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas arboricola.......................... 183  2e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter adhaerens.......................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ruegeria lacuscaerulensis....................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio furnissii CIP 102972..................... 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella frigidimarina........................ 183  2e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio genomosp. F10............................ 183  2e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium SCGC AB-629-P17........... 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Gilliamella apicola SCGC AB-598-I20............. 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Glutamate-1-semialdehyde aminotransferase [Gil...   
. Xanthomonas fragariae........................... 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas campestris pv. musacearum NCPPB 437. 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Xan...   
. Shewanella baltica OS195........................ 183  3e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas campestris pv. musacearum NCPPB 438. 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Xan...   
. Shewanella sp. HN-41............................ 183  3e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella benthica............................. 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. B6................................ 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacterium sp. AK27........................ 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Glutamate-1-semialdehyde aminotransferase [Mar...   
. Thiocapsa marina................................ 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas alfalfae............................ 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudoalteromonas ruthenica..................... 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas perforans 91-118.................... 183  3e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Xylella fastidiosa 9a5c......................... 183  4e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas hortorum............................ 183  4e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas gardneri............................ 183  8e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum IPO1609.................. 183  8e-50  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas campestris pv. musacearum NCPPB 200. 182  4e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Idiomarina sp. A28L............................. 182  4e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas albilineans......................... 182  4e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. SUBG004........................... 182  4e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase [Hal...   
. Xanthomonas axonopodis pv. punicae str. LMG 859. 182  4e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Photobacterium halotolerans..................... 182  4e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas arboricola pv. celebensis........... 182  4e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Xan...   
. Thiovulum sp. ES................................ 182  4e-50  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Oleispira antarctica RB-8....................... 182  4e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Glutamate-1-semialdehyde 2,1-aminomutase [Ole...   
. Xanthomonas axonopodis pv. malvacearum str. GSP. 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Aggregatibacter actinomycetemcomitans RhAA1..... 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Providencia sneebia............................. 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Colwellia piezophila............................ 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum K60...................... 182  5e-50  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Neorhizobium galegae bv. officinalis bv. offici. 182  5e-50  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glutamate-1-semialdehyde aminotransferase 2 [...   
. gamma proteobacterium SCGC AAA007-O20........... 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Providencia alcalifaciens 205/92................ 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Prov...   
. Vibrio shilonii................................. 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter sp. HL-58.......................... 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella putrefaciens......................... 182  5e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Mannheimia varigena USDA-ARS-USMARC-1296........ 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Glutamate-1-semialdehyde 2,1-aminomutase [Mann...   
. Xanthomonas vesicatoria......................... 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia sp. UNC404CL21Col..................... 182  5e-50  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Idiomarina salinarum............................ 182  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [Idi...   
. Shewanella decolorationis....................... 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas smyrnensis............................ 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pasteurella multocida 1500E..................... 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Dasania marina.................................. 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Providencia stuartii............................ 182  6e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Limnobacter sp. MED105.......................... 182  6e-50  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pseudoalteromonas rubra......................... 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum CMR15.................... 182  6e-50  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Solimonas soli.................................. 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum PSI07.................... 182  6e-50  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chromobacterium violaceum....................... 182  6e-50  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni Cj1........................ 182  6e-50  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Psychromonas ossibalaenae....................... 182  6e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Psychromonas ingrahamii......................... 182  7e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella...................................... 182  7e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Shewanella sp. ANA-3............................ 182  7e-50  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Gallibacterium anatis 12656/12.................. 182  7e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase [Gal...   
. Photobacterium angustum......................... 182  7e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Betaproteobacteria.............................. 182  7e-50  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Microbulbifer agarilyticus...................... 182  7e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Vibrio caribbenthicus........................... 182  7e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella denitrificans........................ 182  8e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Glaciecola mesophila............................ 182  8e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas oryzae pv. oryzae MAFF 311018....... 182  8e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas oryzae pv. oryzae PXO99A............ 182  8e-50  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas vasicola............................ 182  8e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum P673..................... 182  9e-50  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase [Rals...   
. Vibrio sp. N418................................. 182  9e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Ralstonia pickettii............................. 182  9e-50  6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella halifaxensis......................... 182  9e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas vasicola pv. vasculorum NCPPB 206... 182  9e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Photobacterium sp. SKA34........................ 182  9e-50  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Xanthomonas oryzae pv. oryzae KACC 10331........ 182  3e-49  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio sp. ER1A................................. 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vib...   
. Halothiobacillus neapolitanus................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter nectaris.......................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xanthomonas oryzae pv. oryzicola BLS256......... 181  1e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Xenorhabdus cabanillasii JM26................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase [Xen...   
. Methylophaga frappieri.......................... 181  1e-49  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pantoea ananatis LMG 20103...................... 181  1e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Oceanimonas smirnovii........................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Nitrosococcus watsonii.......................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Providencia alcalifaciens PAL-3................. 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Prov...   
. Vibrio variabilis............................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Marinobacter daepoensis......................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Gallaecimonas xiamenensis....................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia syzygii R24........................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase (ami...   
. Marinomonas sp. D104............................ 181  1e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Janthinobacterium sp. Marseille................. 181  1e-49  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Grimontia hollisae.............................. 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Gilliamella apicola SCGC AB-598-P17............. 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: Glutamate-1-semialdehyde aminotransferase [Gil...   
. Providencia rustigianii......................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Alteromonas sp. SN2............................. 181  1e-49  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Providencia rettgeri DSM 1131................... 181  1e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Providencia alcalifaciens....................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterovibrio sp. AK16........................... 181  2e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glutamate-1-semialdehyde aminotransferase...   
. Xylella fastidiosa XfPE......................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase [Xyl...   
. Shewanella xiamenensis.......................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [She...   
. Providencia alcalifaciens F90-2004.............. 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Prov...   
. Marinobacter lipolyticus........................ 181  2e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas halocynthiae.......................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Providencia alcalifaciens RIMD 1656011.......... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Prov...   
. Candidatus Ruthia magnifica..................... 181  2e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Providencia burhodogranariea.................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia sp. PBA............................... 181  2e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Oceanicola batsensis............................ 181  2e-49  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: putative [Oceanicola batsensis]                
. Enterovibrio calviensis......................... 181  2e-49  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella pealeana............................. 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella loihica.............................. 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xenorhabdus szentirmaii DSM 16338............... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase [Xen...   
. Ralstonia....................................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Moritella marina................................ 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Kiloniella laminariae........................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Kiloniellales: hypothetical protein [Kiloniella laminariae]   
. Burkholderia phytofirmans....................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shewanella oneidensis........................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Photobacterium leiognathi....................... 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas elongata.............................. 181  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Herminiimonas arsenicoxydans.................... 181  2e-49  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ralstonia solanacearum Po82..................... 181  8e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Marinobacter.................................... 180  3e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Alcanivorax sp. 97CO-5.......................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase [Alca...   
. Shewanella colwelliana.......................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Ferrimonas kyonanensis.......................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio maritimus................................ 180  3e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Thiothrix flexilis.............................. 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alcanivorax hongdengensis....................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter fennelliae......................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia sp. Ch1-1.......................... 180  3e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shewanella fidelis.............................. 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Methylophaga lonarensis......................... 180  3e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Herbaspirillum sp. YR522........................ 180  4e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ralstonia pickettii 12D......................... 180  4e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shewanella sp. MR-4............................. 180  4e-49  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. PBN3.............................. 180  4e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alcanivorax borkumensis......................... 180  4e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Mesorhizobium sp. LNHC220B00.................... 180  4e-49  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Mesorhizobium sp. L...   
. Candidatus Burkholderia kirkii.................. 180  4e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Yersinia pestis................................. 180  4e-49  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Beggiatoa sp. PS................................ 180  4e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Glutamate-1-semialdehyde 2,1-aminomutase [Begg...   
. Dyella ginsengisoli............................. 180  4e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Laribacter hongkongensis........................ 180  4e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Snodgrassella alvi................... 180  4e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Glutamate-1-semialdehyde aminotransferase [Sno...   
. Yersinia pseudotuberculosis..................... 180  4e-49  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Ewingella americana ATCC 33852.................. 180  4e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ewi...   
. Sulfurospirillum sp. SCADC...................... 180  4e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Sul...   
. Laribacter hongkongensis HLHK9.................. 180  4e-49  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. HK1........................ 180  4e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Photobacterium sp. AK15......................... 180  4e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori............................. 180  4e-49  209 hitsBacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Burkholderia xenovorans......................... 180  4e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Arcobacter nitrofigilis......................... 180  5e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum GMI1000.................. 180  5e-49  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori NQ4099...................... 180  5e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas sp. BC04.............................. 180  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase [Halo...   
. Marinobacter hydrocarbonoclasticus ATCC 49840... 179  5e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Collimonas fungivorans.......................... 179  5e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Candidatus Kinetoplastibacterium oncopeltii..... 179  5e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alteromonas sp. ALT199.......................... 179  5e-49  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas lutea................................. 179  6e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. sulfur-oxidizing symbionts...................... 179  6e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Massilia sp. BSC265............................. 179  6e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase [Mas...   
. Helicobacter pylori R046Wa...................... 179  6e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Serratia odorifera.............................. 179  6e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Plesiomonas shigelloides........................ 179  6e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori HUP-B14..................... 179  7e-49  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum FQY_4.................... 179  7e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glutamate-1-semialdehyde aminotransferase...   
. Shewanella sediminis............................ 179  7e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Alishewanella agri.............................. 179  7e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori NCTC 11637.................. 179  7e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia solanacearum SD54..................... 179  8e-49  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Balneatrix alpica............................... 179  8e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein [Balneatrix alpica]       
. Helicobacter pylori NQ4076...................... 179  8e-49  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Pelistega sp. HM-7.............................. 179  9e-49  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Aliivibrio logei................................ 179  1e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Aliivibrio salmonicida.......................... 179  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia ruckeri................................ 179  1e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Methylosarcina fibrata.......................... 179  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ralstonia solanacearum CFBP2957................. 179  1e-48  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Leeia oryzae.................................... 179  1e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Leeia oryzae]            
. Mesorhizobium metallidurans STM 4661............ 179  1e-48  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Sulfuricurvum sp. MLSB.......................... 179  1e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Sul...   
. Helicobacter pylori Shi470...................... 179  1e-48  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Xenorhabdus bovienii str. kraussei Becker Under. 179  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Xenorhabdus bovienii str. Intermedium........... 179  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Ralstonia pickettii OR214....................... 179  1e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Serratia sp. DD3................................ 179  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Serr...   
. Cardiobacterium hominis......................... 179  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Cardiobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Haliea salexigens............................... 178  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Sulfuricella denitrificans...................... 178  1e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori X47-2AL..................... 178  1e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Marinobacter algicola........................... 178  1e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xenorhabdus bovienii str. feltiae France........ 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Xenorhabdus nematophila......................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alishewanella jeotgali.......................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Variovorax paradoxus............................ 178  2e-48  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori PeCan18..................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Lutiella nitroferrum............................ 178  2e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shewanella woodyi............................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Alcanivorax..................................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Xenorhabdus bovienii str. puntauvense........... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Marinobacter sp. ELB17.......................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alishewanella aestuarii......................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Alcanivorax sp. DG881........................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp H-27..................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Vibrio ichthyoenteri............................ 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Serratia plymuthica............................. 178  2e-48  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori 98-10....................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Halotalea alkalilenta........................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori R32b........................ 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Alcanivorax dieselolei.......................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Algicola sagamiensis............................ 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori 26695....................... 178  2e-48  5 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter cinaedi............................ 178  2e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thioflavicoccus mobilis......................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori 52.......................... 178  2e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella piezotolerans........................ 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Glutamate-1-semialdehyde-2,1-aminomutase ...   
. Alteromonas macleodii........................... 178  2e-48  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia.................................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori R038b....................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-30..................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori HPAG1....................... 178  2e-48  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-11..................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter acinonychis........................ 178  2e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Methylomicrobium alcaliphilum................... 178  2e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xenorhabdus bovienii str. feltiae Moldova....... 178  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Xenorhabdus nematophila ATCC 19061.............. 178  3e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderiaceae................................ 178  3e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Aquamicrobium defluvii.......................... 178  3e-48  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: aminotransferase class III [Aquamicrobium defl...   
. Glaciecola nitratireducens...................... 178  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Sinobacter flavus............................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM210Bi.................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Shewanella waksmanii............................ 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Mesorhizobium................................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Helicobacter pylori UM032....................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-14..................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-9...................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori NY40........................ 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase [Hel...   
. Helicobacter pylori PeCan4...................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Halomonas halodenitrificans..................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Tatumella....................................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori UM114....................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium BDW918.................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cupriavidus sp. UYPR2.512....................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori CPY1662..................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp H-28..................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori R055a....................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori A45......................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia enterocolitica LC20.................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase [Yer...   
. Citrobacter..................................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Aeromonas hydrophila 4AK4....................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase [Aer...   
. Arcobacter butzleri............................. 177  3e-48  4 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Oligella ureolytica............................. 177  3e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter cinaedi PAGU611.................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rahnella aquatilis.............................. 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Nautilia profundicola........................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas salmonicida........................... 177  3e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase [Aer...   
. Candidatus Regiella insecticola................. 177  3e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-11..................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas media WS.............................. 177  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase [Aer...   
. Helicobacter pylori R018c....................... 177  3e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rheinheimera sp. A13L........................... 177  3e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas hydrophila............................ 177  3e-48  13 hits Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Pasteurella dagmatis............................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia sp. CCGE1002....................... 177  4e-48  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cupriavidus necator............................. 177  4e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Psychromonas arctica............................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas hydrophila subsp. hydrophila ATCC 796. 177  4e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Xenorhabdus bovienii str. oregonense............ 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Pantoea......................................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Cupriavidus metallidurans....................... 177  4e-48  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salinivibrio costicola.......................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Pantoea agglomerans............................. 177  4e-48  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase [Pant...   
. Moritella sp. PE36.............................. 177  4e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Contendobacter odensis Run_B_J11..... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase (am...   
. Shewanella violacea............................. 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Janthinobacterium sp. HH01...................... 177  4e-48  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Labrenzia alexandrii............................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori NQ4228...................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Xenorhabdus bovienii............................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter freundii............................ 177  4e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Achromobacter piechaudii........................ 177  4e-48  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Yersinia similis................................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Yer...   
. gamma proteobacterium Hiromi1................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 21-aminomutase [gamm...   
. gamma proteobacterium WG36...................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori R036d....................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Cupriavidus sp. SK-4............................ 177  4e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase [Cup...   
. Carnimonas nigrificans.......................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Cupriavidus sp. HMR-1........................... 177  4e-48  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ASLr1...................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter canadensis......................... 177  4e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Janthinobacterium agaricidamnosum NBRC 102515 =. 177  4e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Jan...   
. Marinobacter sp. BSs20148....................... 177  5e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Nitrosospira multiformis........................ 177  5e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp H-43..................... 177  5e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Lithuania75................. 177  5e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Nitrosococcus halophilus........................ 177  5e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Singularimonas variicoloris..................... 177  5e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli................................ 177  5e-48  124 hitsBacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Esc...   
. Rahnella........................................ 177  5e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Perlucidibaca piscinae.......................... 177  5e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Aeromonas hydrophila ML09-119................... 177  5e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Oceanospirillum beijerinckii.................... 177  5e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia kristensenii........................... 177  5e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Sat464...................... 177  5e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni............................ 177  5e-48  25 hits Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori 83.......................... 177  5e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori oki112...................... 177  5e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Hel...   
. Helicobacter pylori NQ4053...................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Arcobacter butzleri ED-1........................ 177  6e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-15..................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM244Ai.................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Yersinia enterocolitica......................... 177  6e-48  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Yers...   
. Yersinia enterocolitica subsp. enterocolitica 8. 177  6e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Kushneria aurantia.............................. 177  6e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Alteromonas macleodii str. 'Deep ecotype'....... 177  6e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Psychromonas sp. SP041.......................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas salmonicida subsp. salmonicida A449... 177  6e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-20..................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori FD577....................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas salmonicida subsp. pectinolytica 34me. 177  6e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Salinimonas chungwhensis........................ 177  6e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Alteromonas macleodii str. 'English Channel 615. 177  6e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-74..................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori OK113....................... 177  6e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Saccharospirillum impatiens..................... 177  6e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas dhakensis............................. 177  6e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Methylobacillus glycogenes...................... 177  7e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde aminotransferase...   
. Alteromonas macleodii str. 'Ionian Sea U4'...... 177  7e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Methylomicrobium................................ 177  7e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Helicobacter pylori R037c....................... 177  7e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia andropogonis....................... 177  7e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM239Bi.................... 177  7e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter sp. NIPH 1847..................... 177  7e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter junii............................. 177  8e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Citrobacter sp. MGH 55.......................... 176  8e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Citr...   
. Citrobacter sp. KTE32........................... 176  8e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Sedimenticola selenatireducens.................. 176  8e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori J99......................... 176  8e-48  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter amalonaticus........................ 176  8e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Cit...   
. Helicobacter pylori G27......................... 176  8e-48  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori F57......................... 176  8e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-24..................... 176  8e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter freundii CFNIH1..................... 176  8e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Cit...   
. Shigella........................................ 176  8e-48  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori NQ4200...................... 176  8e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Duganella zoogloeoides.......................... 176  8e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Arcobacter butzleri RM4018...................... 176  8e-48  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori UM037....................... 176  8e-48  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Cedecea davisae................................. 176  8e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia..................................... 176  8e-48  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli E24377A........................ 176  9e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori ELS37....................... 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori SJM180...................... 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori SouthAfrica7................ 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter junii SH205....................... 176  9e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Reinekea blandensis............................. 176  9e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Klebsiella oxytoca.............................. 176  9e-48  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Kle...   
. Helicobacter pylori F32......................... 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori 35A......................... 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas veronii............................... 176  9e-48  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori FD568....................... 176  9e-48  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Aklavik86................... 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Aklavik117.................. 176  9e-48  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli O146:H21 str. 2010C-3325....... 176  9e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Esc...   
. Serratia liquefaciens FK01...................... 176  9e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Se...   
. Helicobacter pylori F30......................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Methylomicrobium buryatense..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Shi112...................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GC26........................ 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Puno120..................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Cellvibrio sp. BR............................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Citrobacter youngae............................. 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter freundii ATCC 8090.................. 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Acinetobacter baumannii WC-323.................. 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori GAM101Biv................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori CPY6271..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori NQ4044...................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori v225d....................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter lari.............................. 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Competibacter denitrificans Run_A_D1. 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase (am...   
. Helicobacter pylori UM067....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-8...................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli UMEA 3489-1.................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori UM085....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori CPY1962..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori UM111....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter junii CIP 64.5.................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Cuz20....................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Morganella morganii............................. 176  1e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori UM065....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-26..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori CPY6081..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thiomicrospira sp. MA2-6........................ 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter pulveris............................ 176  1e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter aerogenes MGH 61................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Helicobacter pylori FD506....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Nitratifractor salsuginis....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Serratia symbiotica............................. 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase (am...   
. Burkholderia kururiensis........................ 176  1e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM105Ai.................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter sp. ANC 3789...................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori oki154...................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Hel...   
. Helicobacter pylori OK310....................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Shewanella sp. YQH10............................ 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [She...   
. Photorhabdus temperata subsp. temperata Meg1.... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Phot...   
. Helicobacter pylori BM012A...................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: Glutamate-1-semialdehyde aminotransferase...   
. Photorhabdus temperata.......................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALE11...................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Arcobacter butzleri 7h1h........................ 176  1e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Nitrosomonas cryotolerans....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae subsp. dissolvens SP1...... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ent...   
. Klebsiella oxytoca E718......................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori UM023....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-17..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica............................. 176  1e-47  61 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Shigella boydii................................. 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori UM066....................... 176  1e-47  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Alkalilimnicola ehrlichii....................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Oxalobacteraceae bacterium IMCC9480............. 176  1e-47  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alcanivorax sp. P2S70........................... 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. ALR17-21................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Morganella morganii subsp. morganii KT.......... 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter freundii UCI 32..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Citr...   
. Helicobacter pylori Hp P-16..................... 176  1e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Serratia........................................ 176  1e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori GAM115Ai.................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter brisouii.......................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori P12......................... 176  2e-47  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Serratia symbiotica SCt-VLC..................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase [Ser...   
. Aeromonas veronii Hm21.......................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas diversa............................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Achromobacter piechaudii HLE.................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Aeromonas hydrophila HZM........................ 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase [Aer...   
. Alteromonas sp. H17............................. 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase [Alt...   
. Pantoea stewartii............................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. AKL17...................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori CPY3281..................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas....................................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori Hp H-29..................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia sp. JPY251......................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pantoea sp. aB.................................. 176  2e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori 51.......................... 176  2e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas veronii AMC35......................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas veronii AMC34......................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli KTE147......................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Aestuariibacter salexigens...................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas caviae................................ 176  2e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter aerogenes UCI 45................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Candidatus Kinetoplastibacterium galatii........ 176  2e-47  2 hits  Bacteria:Proteobacteria:Betaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp P-4...................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rhodospirillales bacterium URHD0088............. 176  2e-47  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-23..................... 176  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori SNT49....................... 176  2e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thiorhodospira sibirica......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli ED1a........................... 175  2e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli KTE63.......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Sulfurospirillum deleyianum..................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-41..................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 6-537-08_S3_C1................. 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Escherichia coli KTE66.......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli HVH 65 (4-2262045)............. 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter aerogenes.......................... 175  2e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM119Bi.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Serratia liquefaciens........................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Endozoicomonas montiporae....................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: hypothetical protein GZ77_21635 [Endozoicomona...   
. Enterobacter aerogenes KCTC 2190................ 175  2e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli MS 153-1....................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli TA206.......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli.............................. 175  2e-47  13 hits Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: Glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli HVH 5 (4-7148410).............. 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli MS 69-1........................ 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli CFT073......................... 175  2e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Escherichia coli 07798.......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Achromobacter arsenitoxydans.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM201Ai.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp P-28b.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli UMEA 3022-1.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Janthinobacterium sp. CG3....................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli 1-250-04_S4_C2................. 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Escherichia coli TA280.......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori B8.......................... 175  2e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli HS............................. 175  2e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Escherichia coli HVH 125 (4-2634716)............ 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM265BSii.................. 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori oki128...................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Hel...   
. Serratia sp. Ag2................................ 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ser...   
. Escherichia sp. 3_2_53FAA....................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Escherichia coli 2875000........................ 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori GAM254Ai.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp P-26..................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli NA114.......................... 175  2e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Shigella flexneri............................... 175  2e-47  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae........................... 175  2e-47  22 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli TX1999......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori NQ4216...................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Serratia marcescens BIDMC 50.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Serr...   
. Escherichia coli 5-366-08_S3_C3................. 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Proteus vulgaris................................ 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Prot...   
. Ignatzschineria larvae.......................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli O69:H11 str. 06-3325........... 175  2e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Esc...   
. Helicobacter pylori GAM114Ai.................... 175  2e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori FD430....................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Puno135..................... 175  3e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli B354........................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM83Bi..................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Thioploca ingrica............................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase [Th...   
. Helicobacter pylori FD423....................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Cupriavidus taiwanensis......................... 175  3e-47  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Serratia marcescens............................. 175  3e-47  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Mesorhizobium sp. LSHC440B00.................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: class III aminotransferase ...   
. Sulfurospirillum multivorans DSM 12446.......... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde 2,1-aminomutase [Sulf...   
. Serratia nematodiphila.......................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ser...   
. Sulfurovum sp. AR............................... 175  3e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio................................ 175  3e-47  15 hits Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Mesorhizobium sp. SOD10......................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glutamate-1-semialdehyde 2,1-aminomutase [Mes...   
. Escherichia coli MP021017.9..................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Serratia odorifera 4Rx13........................ 175  3e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Arsenophonus nasoniae........................... 175  3e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Nitrosococcus oceani............................ 175  3e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase [Nit...   
. Helicobacter pylori India7...................... 175  3e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Nitrosococcus oceani ATCC 19707................. 175  3e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp H-42..................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Snodgrassella alvi wkB2.............. 175  3e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Glutamate-1-semialdehyde aminotransferase [Sno...   
. Achromobacter xylosoxidans...................... 175  3e-47  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glutamate-1-semialdehyde aminotransferase...   
. Rhizobium leguminosarum......................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: aminotransferase class III [Rhizobium leg...   
. Thioalkalivibrio sp. ALJ24...................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter sp. BIDMC 26....................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Yersinia enterocolitica subsp. palearctica 105.. 175  3e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Serratia proteamaculans......................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli MP021017.5..................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori oki102...................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Hel...   
. Helicobacter pylori GAM264Ai.................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori GAM118Bi.................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. beta proteobacterium CB......................... 175  3e-47  3 hits  Bacteria:Proteobacteria:Betaproteobacteria: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Burkholderia sp. WSM3617........................ 175  3e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter sp. BIDMC 30....................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Shigella flexneri 2a str. 301................... 175  3e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Achromobacter xylosoxidans C54.................. 175  3e-47  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. ALE19...................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Oligella urethralis............................. 175  3e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oligella urethralis]     
. Sulfurospirillum barnesii....................... 175  3e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 3623..................... 175  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Klebsiella sp. 1_1_55........................... 175  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas veronii B565.......................... 175  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Serratia plymuthica S13......................... 175  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-6...................... 175  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Serratia sp. S4................................. 175  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori NQ4110...................... 175  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter winghamensis....................... 175  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-36..................... 175  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM93Bi..................... 175  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Salinisphaera hydrothermalis C41B8.............. 175  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: glutamate-1-semialdehyde aminotransferase [Sal...   
. alpha proteobacterium BAL199.................... 175  5e-47  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Neisseria wadsworthii........................... 175  5e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Xenorhabdus poinarii G6......................... 174  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase (GSA...   
. Escherichia coli MP021552.7..................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia coli MS 16-3........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Halorhodospira halophila........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Arcobacter sp. L................................ 174  4e-47  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia sp. WSM4176........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter sp. EGD-HP1........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ent...   
. Enterobacter sp. R4-368......................... 174  4e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAMchJs124i................. 174  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia coli APEC O78....................... 174  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter cetorum............................ 174  4e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Pantoea dispersa................................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Rheinheimera nanhaiensis........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori CPY6311..................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii 146457.................. 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Taylorella equigenitalis........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM246Ai.................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori CPY1124..................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Aeromonas molluscorum........................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli p0305293.5..................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. gamma proteobacterium IMCC3088.................. 174  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Ent. 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Man. 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Pseudogulbenkiania sp. MAI-1.................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde aminotransferase...   
. Cupriavidus taiwanensis LMG 19424............... 174  4e-47  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shigella sonnei Ss046........................... 174  4e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Typ. 174  4e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella oxytoca KCTC 1686.................... 174  4e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae............................ 174  4e-47  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori UM038....................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-23..................... 174  4e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. P8-3-8........................ 174  4e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Gam. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli B29-1.......................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Citrobacter koseri ATCC BAA-895................. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: RecName: Full=Glutamate-1-semialdehyde ...   
. Aeromonas sp. 159............................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Snodgrassella alvi SCGC AB-598-J21.............. 174  5e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Glutamate-1-semialdehyde aminotransferase [Sno...   
. Photorhabdus luminescens........................ 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Methylovulum miyakonense........................ 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar New. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter parvus............................ 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni 255........................ 174  5e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Salmonella enterica subsp. enterica serovar Hav. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Serratia sp. M24T3.............................. 174  5e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Mon. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori oki828...................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Hel...   
. Helicobacter pylori GAM249T..................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Bordetella petrii............................... 174  5e-47  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli O156:H25 str. 2011C-3602....... 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Esc...   
. Klebsiella sp. AS10............................. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ind. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Shigella flexneri K-272......................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Inf. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Pul. 174  5e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-25..................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella oxytoca 10-5250...................... 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Bai. 174  5e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli O103:H25 str. CVM9340.......... 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Soe. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Par. 174  6e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter berezinae......................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM71Ai..................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Sai. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAMchJs136i................. 174  6e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia coli KTE11.......................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Thiomicrospira halophila........................ 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Gal. 174  6e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Giv. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter asburiae........................... 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Nam. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Tal. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella...................................... 174  6e-47  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Salmonella enterica subsp. enterica serovar New. 174  6e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Frateuria aurantia.............................. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde aminotransferase...   
. Pseudomonas flectens............................ 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ade. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella oxytoca 10-5243...................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Acinetobacter sp. NIPH 1859..................... 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli KTE52.......................... 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Yersinia rohdei................................. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Hei. 174  6e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella bongori.............................. 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde amino transferas...   
. Salmonella enterica subsp. enterica serovar Dub. 174  6e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-45..................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter sp. 30_2............................ 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter................................... 174  6e-47  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori Hp H-41..................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Citrobacter freundii MGH 56..................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Citr...   
. Salmonella enterica subsp. enterica serovar Mue. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. marine gamma proteobacterium HTCC2080........... 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Janthinobacterium lividum....................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glutamate-1-semialdehyde 2,1-aminomutase [Jant...   
. Enterobacter cloacae EcWSU1..................... 174  6e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. beta proteobacterium SCGC AAA027-C02............ 174  6e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella oxytoca 10-5245...................... 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ten. 174  6e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pseudogulbenkiania sp. NH8B..................... 174  6e-47  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thiomicrospira crunogena........................ 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Klebsiella oxytoca MGH 41....................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Kleb...   
. Helicobacter pylori FD662....................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-9...................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Shi169...................... 174  7e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 2036..................... 174  7e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Citrobacter koseri.............................. 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Cit...   
. Escherichia coli 907889......................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Cho. 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Typ. 174  7e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii......................... 174  7e-47  39 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Melitea salexigens.............................. 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Dickeya zeae.................................... 174  7e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli M863........................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. ETR1.......................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Salmonella enterica subsp. enterica serovar Cer. 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella sp. YR343............................ 174  7e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Gambia94/24................. 174  7e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter sp. MGH 24......................... 174  7e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia fergusonii.......................... 174  7e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Photorhabdus temperata subsp. khanii NC19....... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Phot...   
. Acinetobacter gyllenbergii...................... 174  7e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli O157:H7 str. EDL933............ 174  7e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia fergusonii ECD227................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-1...................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli KTE61.......................... 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Vir. 174  7e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM96Ai..................... 174  8e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Bar. 174  8e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-62..................... 174  8e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori R030b....................... 174  8e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Arcobacter cibarius............................. 174  8e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 8.0566......................... 174  8e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori FD703....................... 174  8e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Proteus mirabilis............................... 174  8e-47  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 809...................... 174  8e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli 2-011-08_S1_C1................. 174  8e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Helicobacter pylori F16......................... 174  8e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Ralstonia pickettii DTP0602..................... 174  8e-47  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Ruminobacter sp. RM87........................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori oki673...................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Hel...   
. Helicobacter pylori Shi417...................... 174  9e-47  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori NQ4161...................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterovibrio norvegicus......................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase...   
. Proteus mirabilis WGLW6......................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli KTE75.......................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Serratia marcescens BIDMC 80.................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Serr...   
. Erwinia amylovora............................... 174  9e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Shigella boydii Sb227........................... 174  9e-47  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Pectobacterium atrosepticum..................... 174  9e-47  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori FD535....................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-8...................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Herminiimonas sp. CN............................ 174  9e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Chitinimonas koreensis.......................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Glaciecola punicea.............................. 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia enterocolitica (type O:5) str. YE53/03. 174  9e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori FD719....................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAMchJs106B................. 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter sp. CIP 56.2...................... 174  9e-47  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Sulfurovum sp. SCGC AAA036-F05.................. 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM120Ai.................... 174  9e-47  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pectobacterium betavasculorum................... 174  1e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Pec...   
. Shigella boydii CDC 3083-94..................... 174  1e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Oxalobacteraceae bacterium AB_14................ 174  1e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Serratia marcescens SM39........................ 174  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Se...   
. Helicobacter pylori GAM231Ai.................... 174  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Aeromonas enteropelogenes....................... 174  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: glutamate-1-semialdehyde aminotransferase...   
. Glaciecola pallidula............................ 174  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM270ASi................... 174  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter sp. ATCC 27244.................... 174  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Escherichia coli SMS-3-5........................ 173  1e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Serratia marcescens VGH107...................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Photorhabdus luminescens BA1.................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Phot...   
. Citrobacter rodentium........................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli P02997067.6.................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Citrobacter freundii 4_7_47CFAA................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli O121:H7 str. 2009C-3299........ 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Esc...   
. Escherichia coli KTE47.......................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Klebsiella sp. 10982............................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli MS 107-1....................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni LMG 23223.... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli P0305260.6..................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp H-34..................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli P0305260.10.................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Klebsiella pneumoniae UCICRE 14................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Proteus mirabilis HI4320........................ 173  1e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli E101........................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-4...................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella oxytoca KONIH1....................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Kle...   
. Escherichia coli O157:H7 str. LSU-61............ 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-10..................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter gerneri........................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli IAI39.......................... 173  1e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli MS 146-1....................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori GAM103Bi.................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia coli 7-233-03_S3_C3................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Acinetobacter sp. CIP 102082.................... 173  1e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni subsp. doylei 269.97....... 173  1e-46  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 7-233-03_S4_C1................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Escherichia coli 5-172-05_S1_C3................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter sp. Ag1............................ 173  1e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Shigella flexneri VA-6.......................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM121Aii................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter baumannii NIPH 67................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli D6-113.11...................... 173  1e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase [Esc...   
. Salmonella enterica subsp. enterica serovar Tho. 173  1e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-44..................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-6...................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia mollaretii............................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar New. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni 1997-10...... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae 700603.................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae BIDMC 23.................. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli KTE146......................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Serratia marcescens subsp. marcescens Db11...... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Se...   
. Cellvibrio japonicus............................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni subsp. jejuni LMG 23357.... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii ATCC 19606.............. 173  1e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella oxytoca MGH 42....................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM260ASi................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp H-21..................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni 81116........ 173  1e-46  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Shigella dysenteriae............................ 173  1e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Simiduia agarivorans............................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cupriavidus sp. amp6............................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni 1336......... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter haemolyticus...................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori GAM250AFi................... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Campylobacter jejuni RM1221..................... 173  1e-46  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni 1854......... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter guillouiae........................ 173  1e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni subsp. jejuni 2008-894..... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Achromobacter xylosoxidans AXX-A................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter jejuni subsp. jejuni LMG 9872..... 173  1e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ent. 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Cardiobacterium valvarum........................ 173  1e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Cardiobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM117Ai.................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori CCHI 33..................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp P-13..................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli TW10509........................ 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Polycyclovorans algicola........................ 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii 1035119................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Escherichia coli 4_1_47FAA...................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Mesorhizobium plurifarium....................... 173  2e-46  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glutamate-1-semialdehyde 2,1-aminomutase [Mes...   
. Helicobacter pylori 908......................... 173  2e-46  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Photodesmus katoptron................ 173  2e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Enterobacter sp. T1-1........................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-4...................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni NCTC 11168... 173  2e-46  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Herbaspirillum massiliense...................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp H-1...................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia albertii............................ 173  2e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia albertii TW07627.................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Photodesmus katoptron Akat1.......... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Enterobacter sp. DC3............................ 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Enterobacteriaceae bacterium HS................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase [Sod...   
. Salmonella enterica subsp. enterica serovar Had. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae subsp. pneumoniae MGH 785. 173  2e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pullorum........................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni ICDCCJ07001.. 173  2e-46  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp H-3...................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Derxia gummosa.................................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 1-176-05_S3_C1................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Methylophilales bacterium HTCC2181.............. 173  2e-46  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thiothrix lacustris............................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Sulfurimonas gotlandica......................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp A-5...................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia bercovieri............................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae subsp. pneumoniae WGLW1... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 2168..................... 173  2e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Klebsiella pneumoniae UCI 26.................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Kleb...   
. Klebsiella variicola............................ 173  2e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae UCI 18.................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Kleb...   
. Congregibacter litoralis........................ 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori Hp H-5b..................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Polynucleobacter necessarius.................... 173  2e-46  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp A-27..................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter parvus DSM 16617.................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Helicobacter pylori Hp P-11..................... 173  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 758...................... 173  2e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Aminobacter sp. J41............................. 173  2e-46  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Aminobacter s...   
. Helicobacter pylori 2017........................ 172  2e-46  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter mori............................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM260BSi................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Escherichia coli p0305293.14.................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Thioalkalivibrio thiocyanoxidans ARh 4.......... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase [Thio...   
. Klebsiella pneumoniae IS46...................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase [Kl...   
. Vibrio sp. C7................................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: glutamate-1-semialdehyde aminotransferase [Vi...   
. Helicobacter pylori Hp H-18..................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia fergusonii ATCC 35469............... 172  2e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae BIDMC 22.................. 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Klebsiella pneumoniae EGD-HP19.................. 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. zeta proteobacterium SCGC AB-133-C04............ 172  2e-46  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter helveticus.......................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae subsp. pneumoniae NTUH-K2. 172  2e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Klebsiella pneumoniae MGH 20.................... 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter sp. 638............................ 172  2e-46  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ago. 172  2e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Campylobacter jejuni subsp. jejuni IA3902....... 172  2e-46  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Arcobacter...................................... 172  2e-46  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Erwinia sp. Ejp617.............................. 172  2e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. CIP 70.18..................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Rheinheimera perlucida.......................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae BIDMC 8.................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Cronobacter sakazakii........................... 172  3e-46  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori Hp P-3...................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Psychromonas hadalis............................ 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. ANC 4105...................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. unclassified Gammaproteobacteria (miscellaneous. 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Campylobacter jejuni subsp. jejuni LMG 23218.... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter sakazakii ES15...................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli KTE92.......................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Campylobacter jejuni subsp. jejuni 81-176....... 172  3e-46  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter aerogenes MGH 62................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Escherichia hermannii........................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter tjernbergiae...................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni K5......................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Moraxella boevrei............................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Sulfurospirillum arcachonense................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium SCGC AAA076-F14........... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. CIP 102529.................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter cloacae subsp. cloacae ATCC 13047.. 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter..................................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: Glutamate-1-semialdehyde am...   
. Tatumella saanichensis.......................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni LMG 23264.... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Snodgrassella alvi SCGC AB-598-P14.............. 172  3e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Glutamate-1-semialdehyde aminotransferase [Sno...   
. Serratia marcescens FGI94....................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pectobacterium carotovorum subsp. brasiliense... 172  3e-46  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Pec...   
. Hahella chejuensis.............................. 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cronobacter sp. FGI57........................... 172  3e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pectobacterium carotovorum...................... 172  3e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii OIFC111................. 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter sakazakii 696....................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Helicobacter pylori GAM245Ai.................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Helicobacter pylori GAM112Ai.................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Bordetella trematum............................. 172  3e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia rhizoxinica........................ 172  3e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Oxalobacteraceae bacterium JGI 0001004-K23...... 172  3e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cronobacter sakazakii ATCC BAA-894.............. 172  3e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Rheinheimera baltica............................ 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni LMG 23263.... 172  3e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Pantoea sp. IMH................................. 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Zymobacter palmae............................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Nitratireductor pacificus....................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli B185........................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 236...................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. CIP 102129.................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. ARh3....................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Methylovorus glucosotrophus..................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter sp. BIDMC 29....................... 172  3e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Escherichia coli UMNK88......................... 172  3e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Edwardsiella.................................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Salmonella bongori NCTC 12419................... 172  4e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. CIP 64.2...................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Burkholderia sp. SJ98........................... 172  4e-46  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. zeta proteobacterium SCGC AB-602-C20............ 172  4e-46  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni subsp. jejuni 2008-988..... 172  4e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 2846750........................ 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Salmonella enterica subsp. enterica serovar Ago. 172  4e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Yersinia frederiksenii.......................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pectobacterium carotovorum subsp. carotovorum P. 172  4e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Serratia fonticola.............................. 172  4e-46  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia sp. MP-1........................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase [Bur...   
. Klebsiella pneumoniae subsp. rhinoscleromatis A. 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Eikenella corrodens............................. 172  4e-46  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli E1520.......................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 1-250-04_S3_C1................. 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Esch...   
. Pantoea sp. AS-PWVM4............................ 172  4e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Pantoea sp. At-9b............................... 172  4e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pectobacterium carotovorum subsp. carotovorum... 172  4e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Pec...   
. Psychrobacter arcticus.......................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. gamma proteobacterium NOR5-3.................... 172  4e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter cloacae complex.................... 172  4e-46  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Acinetobacter beijerinckii...................... 172  4e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Marinimicrobium agarilyticum.................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter sp. BWH 37......................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Campylobacter jejuni subsp. jejuni ATCC 33560... 172  4e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Xanthobacter sp. 126............................ 172  4e-46  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp A-16..................... 172  4e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae subsp. dissolvens SDM...... 172  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Methylovorus sp. MP688.......................... 172  5e-46  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Arhodomonas aquaeolei........................... 172  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter gyllenbergii NIPH 230............. 172  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. NBRC 100985................... 172  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 2100..................... 172  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. ANC 3929...................... 172  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii WC-A-92................. 172  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter baumannii OIFC143................. 172  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Shigella flexneri CCH060........................ 172  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii Naval-82................ 172  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii ZW85-1.................. 172  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii IS-116.................. 172  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ris. 171  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae subsp. cloacae ENHKU01..... 171  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Enterobacter radicincitans...................... 171  5e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Snodgrassella alvi SCGC AB-598-O11.............. 171  6e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Glutamate-1-semialdehyde aminotransferase [Sno...   
. Acinetobacter baumannii OIFC032................. 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii 1417041................. 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter baumannii NIPH 329................ 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter cloacae UCICRE 12.................. 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 1546444................. 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter sp. CIP-A165...................... 171  6e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori HP116Bi..................... 171  6e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Pantoea sp. A4.................................. 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Sodalis pierantonius................. 171  6e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [pri...   
. Acinetobacter sp. ANC 3862...................... 171  6e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Sodalis glossinidius............................ 171  7e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter nosocomialis...................... 171  7e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Fangia hongkongensis............................ 171  7e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Methylophilaceae bacterium 11................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. COS3.......................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 298...................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter cloacae ECNIH3..................... 171  7e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ent...   
. Serratia fonticola AU-P3(3)..................... 171  7e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Methylotenera sp. 1P/1.......................... 171  7e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter sp. MGH 23......................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pectobacterium carotovorum subsp. carotovorum P. 171  7e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Yokenella regensburgei.......................... 171  7e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Mesorhizobium sp. LNHC209A00.................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Mesorhizobium...   
. Mesorhizobium sp. LNHC229A00.................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: class III aminotransferase [Mesorhizobium...   
. Thiorhodovibrio sp. 970......................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. CIP 110321.................... 171  7e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Dickeya dadantii................................ 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALMg13-2................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. CIP 53.82..................... 171  8e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Photorhabdus asymbiotica........................ 171  8e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALJ15...................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Polynucleobacter necessarius subsp. necessarius. 171  8e-46  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. NIPH 284...................... 171  8e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter sp. MR1............................ 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae UCI 39..................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Enterobacter cloacae UCI 49..................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Methylomonas methanica.......................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Escherichia coli E482........................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli str. K-12 substr. MG1655....... 171  8e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALMg9...................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. ALgr1...................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cupriavidus pinatubonensis...................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Microvirga lotononidis.......................... 171  8e-46  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALMg11..................... 171  8e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. AKL10...................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter cloacae BWH 43..................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Acinetobacter baumannii 25493_4................. 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter baumannii NIPH 1734............... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp P-2...................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter tandoii........................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Enterobacter cancerogenus....................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salmonella enterica subsp. enterica serovar Ent. 171  9e-46  13 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Sal...   
. Yokenella regensburgei ATCC 49455............... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Yok...   
. Enterobacter cloacae subsp. cloacae NCTC 9394... 171  9e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Enterobacter sp. MGH 8.......................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Eikenella corrodens CC92I....................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii AYE..................... 171  9e-46  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Campylobacter jejuni subsp. jejuni CG8486....... 171  9e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALE16...................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori Hp H-30..................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae MGH 54..................... 171  9e-46  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Acinetobacter calcoaceticus/baumannii complex... 171  1e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde-2,...   
. Escherichia coli 178900......................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter baumannii UH6507.................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter baumannii 1295743................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter baumannii BJAB0715................ 171  1e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Erwinia amylovora Ea644......................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 25977_7................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter baumannii 21871................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Enterobacter cloacae S611....................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Enterobacter sp. BIDMC 28....................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Ente...   
. Escherichia coli BCE011_MS-01................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Raoultella ornithinolytica...................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Rao...   
. Enterobacter.................................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Acinetobacter baumannii 25977_6................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Rhizobium etli CNPAF512......................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: aminotransferase class-III [Rhizobium etli CNP...   
. Acinetobacter baumannii 25977_10................ 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Edwardsiella piscicida.......................... 171  1e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Ed...   
. Kangiella aquimarina............................ 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: glutamate-1-semialdehyde aminotransferase...   
. Erwinia pyrifoliae.............................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Erwinia toletana................................ 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii OIFC137................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Edwardsiella tarda.............................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALE12...................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. ALE31...................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 1051830................. 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Hydrogenovibrio marinus......................... 171  1e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Accumulibacter sp. BA-93............. 171  1e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Acinetobacter venetianus........................ 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii ACICU................... 171  1e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli MS 196-1....................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter jejuni 30286...................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Methylotenera mobilis........................... 171  1e-45  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii SDF..................... 171  1e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Thiomonas intermedia............................ 171  1e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Erwinia tasmaniensis............................ 171  1e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALE23...................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. CIP 101934.................... 171  1e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter cetorum MIT 99-5656................ 171  1e-45  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Sulfurovum sp. NBC37-1.......................... 171  1e-45  4 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter baumannii 34654................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Helicobacter pylori GAM100Ai.................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter lwoffii........................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. RUH2624....................... 171  1e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Acinetobacter baumannii NIPH 601................ 171  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Moraxella catarrhalis........................... 171  2e-45  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Sinorhizobium meliloti.......................... 171  2e-45  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glutamate-1-semialdehyde aminotransferase...   
. Delftia acidovorans CCUG 15835.................. 171  2e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: glutamate-1-semialdehyde-2,...   
. Methylophaga thiooxydans........................ 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. houtenae serovar 50:. 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cronobacter genomosp. 1......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Edwardsiella hoshinae........................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. AKL19...................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 2741950........................ 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter beijerinckii ANC 3835............. 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Nitrosomonas europaea........................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. gamma proteobacterium HdN1...................... 170  2e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. houtenae str. ATCC B. 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. NIPH 713...................... 170  2e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pectobacterium wasabiae......................... 170  2e-45  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALE30...................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pectobacterium sp. SCC3193...................... 170  2e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salmonella enterica subsp. arizonae serovar 62:. 170  2e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. K90mix..................... 170  2e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter schindleri........................ 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rheinheimera texasensis......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde aminotransferase...   
. Serratia fonticola RB-25........................ 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Gallionella capsiferriformans................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter mustelae........................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Enterobacter cloacae BWH 31..................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Acinetobacter bouvetii.......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter sp. NIPH 2171..................... 170  2e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter radioresistens.................... 170  2e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Thiomicrospira pelophila........................ 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia caledonica......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. marine gamma proteobacterium HTCC2143........... 170  2e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter soli.............................. 170  2e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter soli CIP 110264................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Candidatus Accumulibacter sp. BA-92............. 170  2e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Thiomicrospira kuenenii......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Methyloglobulus morosus......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. ALE9....................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Erwinia mallotivora............................. 170  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase [Erw...   
. Advenella kashmirensis.......................... 170  2e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Yersinia pestis Pestoides F..................... 170  2e-45  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Chain A, 2.0a Crystal Structure Of A Glutamate-1-S...   
. Campylobacter jejuni subsp. jejuni 110-21....... 170  2e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia bryophila.......................... 170  3e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Kingella oralis................................. 170  3e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Moraxella macacae............................... 170  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter johnsonii......................... 170  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 951631.................. 170  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Nevskia ramosa.................................. 170  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 348935.................. 170  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter indicus........................... 170  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pantoea vagans.................................. 170  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter soli NIPH 2899.................... 169  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rhodocyclaceae.................................. 169  3e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Leminorella grimontii........................... 169  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Pantoea sp. SC-1................................ 169  3e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Moraxella catarrhalis BC7....................... 169  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Escherichia coli 2785200........................ 169  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acinetobacter radioresistens DSM 6976........... 169  3e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. A1PC16........................ 169  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Rickettsiella grylli............................ 169  4e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Shigella dysenteriae CDC 74-1112................ 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli 15-537360.................... 169  4e-45  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: Glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. ALM2T...................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. gamma proteobacterium SCGC AAA003-E02........... 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli RM4661....................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase [Cam...   
. Chitinilyticum litopenaei....................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter lwoffii SH145..................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Erwinia tracheiphila............................ 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bordetella avium................................ 169  4e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalimicrobium aerophilum AL3.............. 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase [Thio...   
. Thioalkalivibrio sp. ALMg2...................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thioalkalivibrio sp. AKL11...................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Methylobacter luteus............................ 169  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli H6........................... 169  4e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Methylophilus methylotrophus.................... 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Psychromonas sp. CNPT3.......................... 169  5e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Bordetella bronchiseptica....................... 169  5e-45  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter coli CVM N29710................... 169  5e-45  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Accumulibacter sp. SK-12............. 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Cronobacter condimenti.......................... 169  5e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Campylobacter upsaliensis....................... 169  5e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bordetella bronchiseptica MBORD635.............. 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Bord...   
. Brackiella oedipodis............................ 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. CIP 51.11..................... 169  5e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bordetella bronchiseptica 99-R-0433............. 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Bord...   
. Burkholderia pyrrocinia......................... 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Burkholderia pyrroc...   
. Acinetobacter lwoffii NIPH 715.................. 169  5e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Bordetella bronchiseptica CARE970018BB.......... 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Bord...   
. Bordetella bronchiseptica A1-7.................. 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Bord...   
. Bordetella bronchiseptica MBORD901.............. 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Bord...   
. Bordetella bronchiseptica OSU-O54............... 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase [Bo...   
. Bordetella bronchiseptica RB50.................. 169  5e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Helicobacter pylori B38......................... 169  5e-45  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bordetella pertussis............................ 169  5e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii UH8907.................. 169  5e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Bordetella sp. FB-8............................. 169  5e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Nitrosomonas sp. AL212.......................... 169  6e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. unclassified Zetaproteobacteria................. 169  6e-45  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: MULTISPECIES: glutamate-1-semialdehyde am...   
. Thioalkalivibrio sp. ALRh....................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Nitrosomonas eutropha........................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thiomicrospira chilensis........................ 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. HA............................ 169  6e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Massilia niastensis............................. 169  6e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Marinimicrobium sp. LS-A18...................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: glutamate-1-semialdehyde aminotransferase...   
. Spongiibacter tropicus.......................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 1461402................. 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Methylocaldum szegediense....................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter johnsonii SH046................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Methylobacter marinus........................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Glomeribacter sp. 1016415....................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase...   
. Thiomonas sp. CB2............................... 169  6e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde aminotransferase (am...   
. Brenneria sp. EniD312........................... 169  7e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Mesorhizobium sp. ORS3359....................... 169  7e-45  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Glutamate-1-semialdehyde 2,1-aminomutase [Mes...   
. Thioalkalivibrio sp. ALJT....................... 169  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter baumannii 1295549................. 169  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Acin...   
. Acinetobacter radioresistens SK82............... 169  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Acinetobacter sp. ADP1.......................... 169  7e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Campylobacter showae............................ 169  9e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli 111-3........................ 168  7e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thioalkalivibrio sp. HL-Eb18.................... 168  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Methyloversatilis universalis................... 168  7e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Campylobacter coli Z163......................... 168  7e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli LMG 9853..................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli 2692......................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Nitrosospira briensis........................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: glutamate-1-semialdehyde aminotransferase...   
. Thiomicrospira sp. Milos-T2..................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter turicensis.......................... 168  8e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Taylorella asinigenitalis....................... 168  8e-45  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cronobacter turicensis 564...................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Thiomonas arsenitoxydans........................ 168  8e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Burkholderia sp. YI23........................... 168  8e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cronobacter dublinensis......................... 168  8e-45  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Taylorella asinigenitalis 14/45................. 168  8e-45  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cronobacter dublinensis 582..................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli 151-9........................ 168  8e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli 317/04....................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Burkholderia cenocepacia........................ 168  8e-45  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Burk...   
. Moraxella catarrhalis RH4....................... 168  8e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Campylobacter coli RM2228....................... 168  9e-45  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bordetella pertussis 18323...................... 168  9e-45  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Edwardsiella ictaluri........................... 168  9e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Cronobacter sp. 1383............................ 168  9e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Moraxella catarrhalis 103P14B1.................. 168  9e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Thiomicrospira arctica.......................... 168  9e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acinetobacter ursingii.......................... 168  1e-44  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: glutamate-1-semialdehyde aminotransferase...   
. Methyloversatilis sp. NVD....................... 168  1e-44  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Sulfuricurvum kujiense.......................... 168  1e-44  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bordetella bronchiseptica MBORD707.............. 168  1e-44  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde-2,1-aminomutase [Bord...   
. Burkholderia sp. CCGE1001....................... 168  1e-44  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Burkholderia phenoliruptrix..................... 168  1e-44  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Variovorax paradoxus EPS........................ 168  1e-44  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bordetella parapertussis........................ 168  1e-44  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Calditerrivibrio nitroreducens.................. 254  3e-77  2 hits  Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: aminotransferase class-iii [Calditerrivib...   
. Denitrovibrio acetiphilus....................... 244  1e-73  2 hits  Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: class III aminotransferase [Denitrovibrio...   
. Eggerthella lenta............................... 220  4e-64  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Chlamydia sp. 'Rubis'........................... 210  1e-60  1 hit   Bacteria:Chlamydiae:Chlamydiales:        Glutamate-1-semialdehyde 2,1-aminomutase [Chl...   
. Thermoanaerobacter.............................. 204  3e-58  3 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Thermoanaerobacter wiegelii..................... 204  4e-58  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacterium thermosaccharolyticum..... 203  8e-58  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rubrobacter xylanophilus........................ 203  8e-58  1 hit   Bacteria:Actinobacteria:Actinobacteria:Rubrobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacterium thermosaccharolyticum M07. 203  9e-58  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Sulfobacillus acidophilus....................... 202  1e-57  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacter ethanolicus.................. 202  1e-57  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rubrobacter radiotolerans....................... 202  1e-57  1 hit   Bacteria:Actinobacteria:Actinobacteria:Rubrobacterales: hemL: glutamate-1-semialdehyde-2,1-aminomutase...   
. Rhodopirellula europaea......................... 202  1e-57  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Caldanaerobacter subterraneus................... 202  2e-57  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rhodopirellula europaea SH398................... 202  2e-57  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thermoanaerobacter italicus..................... 202  3e-57  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacterium saccharolyticum........... 201  3e-57  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Rhodopirellula baltica.......................... 201  3e-57  3 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfobacterium hveragerdense............ 201  4e-57  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Caldanaerobacter subterraneus subsp. yonseiensi. 201  5e-57  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase [Cal...   
. Rhodopirellula baltica WH47..................... 201  6e-57  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus herbarius...................... 201  7e-57  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacter pseudethanolicus ATCC 33223.. 201  2e-55  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: potassium transporter Trk [...   
. Thermobaculum terrenum.......................... 200  1e-56  2 hits  Bacteria::                               glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum carboxydivorans................ 200  1e-56  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus macrosporangiidus.............. 200  1e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacter sp. A7A...................... 200  2e-56  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum nigrificans.................... 199  2e-56  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfobacterium commune DSM 2178......... 199  2e-56  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: glutamate-1-semialdehyde aminotransferase [The...   
. Thermoanaerobacter thermocopriae................ 199  2e-56  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacter mathranii.................... 199  3e-56  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus........................................ 199  3e-56  24 hits Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus amyloliquefaciens...................... 199  3e-56  16 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Bacillus amyloliquefaciens SQR9................. 199  3e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Bacillus amyloliquefaciens subsp. plantarum M27. 199  3e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens IT-45................ 199  3e-56  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB245a_518D8............... 199  3e-56  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptococcus sp. F0442......................... 199  3e-56  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Acidobacteriaceae bacterium URHE0068............ 199  4e-56  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Cryptobacterium curtum.......................... 198  4e-56  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acidobacterium capsulatum....................... 198  4e-56  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus................................... 198  5e-56  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Jeotgalicoccus sp. 13MG44_air................... 198  5e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 2 [J...   
. Bacillus amyloliquefaciens subsp. plantarum NAU. 198  5e-56  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Acetohalobium arabaticum........................ 198  6e-56  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sp. AB2......................... 198  6e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Exi...   
. Exiguobacterium marinum......................... 198  6e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chryseobacterium hispalense..................... 198  6e-56  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Leptospirillum ferrodiazotrophum................ 198  7e-56  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde-2,1-aminomutase [Lept...   
. Exiguobacterium sp. 8-11-1...................... 198  8e-56  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus fordii................................. 198  1e-55  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chryseobacterium sp. StRB126.................... 197  9e-56  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Chr...   
. Fusobacterium necrophorum BL.................... 197  1e-55  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase [Fus...   
. Geobacillus thermocatenulatus................... 197  1e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chthonomonas calidirosea........................ 197  2e-55  1 hit   Bacteria:Armatimonadetes:Chthonomonadetes:Chthonomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Halonatronum saccharophilum..................... 197  2e-55  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sp. NG55........................ 197  2e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermoanaerobacter sp. X514..................... 197  2e-54  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: potassium transporter Trk [...   
. Bacillus siamensis.............................. 196  2e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cellulophaga lytica............................. 196  3e-55  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium necrophorum....................... 196  3e-55  4 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium necrophorum subsp. funduliforme B. 196  3e-55  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase [Fus...   
. Fusobacterium necrophorum subsp. funduliforme A. 196  3e-55  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Chryseobacterium sp. CF314...................... 196  3e-55  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Marinimicrobia bacterium SCGC AAA003-L08........ 196  3e-55  1 hit   Bacteria::                               glutamate-1-semialdehyde aminotransferase...   
. Chryseobacterium luteum......................... 196  3e-55  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Geobacillus vulcani............................. 196  3e-55  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Natranaerobius thermophilus..................... 196  4e-55  1 hit   Bacteria:Firmicutes:Clostridia:Natranaerobiales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteriaceae bacterium 3519-10............. 196  4e-55  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus..................................... 196  4e-55  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Chryseobacterium antarcticum.................... 196  4e-55  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Geobacillus sp. MAS1............................ 196  4e-55  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sp. RIT341...................... 196  4e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 1 [Ex...   
. Exiguobacterium aurantiacum..................... 196  5e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus coahuilensis........................... 196  5e-55  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus aurantiacus............................ 196  6e-55  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chryseobacterium sp. JM1........................ 195  6e-55  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Flavobacterium daejeonense...................... 195  6e-55  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus tequilensis............................ 195  7e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cytophaga fermentans............................ 195  8e-55  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum hydrothermale.................. 195  8e-55  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chryseobacterium vrystaatense................... 195  8e-55  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Bacillus vallismortis........................... 195  8e-55  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis............................... 195  8e-55  35 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. spizizenii str. W23.... 195  9e-55  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. inaquosorum KCTC 13429. 195  1e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sp. AT1b........................ 195  1e-54  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus aidingensis............................ 195  2e-54  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Geobacillus stearothermophilus.................. 194  2e-54  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Geo...   
. Bacillus mojavensis............................. 194  2e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium necrophorum BFTR-1................ 194  2e-54  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase [Fus...   
. Chryseobacterium piperi......................... 194  2e-54  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Desulfurobacterium thermolithotrophum........... 194  2e-54  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. subtilis str. 168...... 194  2e-54  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chryseobacterium sp. UNC8MFCol.................. 194  2e-54  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Jeotgalicoccus marinus.......................... 194  2e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium necrophorum DJ-1.................. 194  2e-54  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase [Fus...   
. Bacillus subtilis subsp. subtilis str. BSP1..... 194  2e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus sp. BT1B_CT2........................... 194  2e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus methanolicus........................... 194  2e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum reducens....................... 194  2e-54  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus kaustophilus........................ 194  2e-54  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium acetylicum...................... 194  2e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Heliophilum fasciatum........................... 194  2e-54  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: HemL [Heliophilum fasciatum]                        
. Nitrolancea hollandica.......................... 194  3e-54  1 hit   Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfurobacterium sp. TC5-1.................... 194  3e-54  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sp. MH3......................... 194  3e-54  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Candidatus Kuenenia stuttgartiensis............. 194  3e-54  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: strongly similar to glutamate-1-semialdehyde ...   
. Chryseobacterium sp. P1-3....................... 193  3e-54  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Bacillus subtilis BSn5.......................... 193  3e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillales...................................... 193  4e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Desulfitobacterium metallireducens DSM 15288.... 193  4e-54  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase [Des...   
. Bacillus sp. URHB0009........................... 193  4e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Ureibacillus thermosphaericus................... 193  4e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Caldithrix abyssi............................... 193  4e-54  1 hit   Bacteria::                               glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sp. S17......................... 193  4e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Flavobacterium hydatis.......................... 193  4e-54  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Fla...   
. Chryseobacterium gleum.......................... 193  5e-54  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Halobacteroides halobius........................ 193  5e-54  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Bacillus licheniformis.......................... 193  6e-54  9 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Baci...   
. Chryseobacterium daeguense...................... 192  6e-54  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus licheniformis S 16..................... 192  6e-54  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Bacillus subtilis XF-1.......................... 192  6e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus atrophaeus............................. 192  6e-54  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. natto BEST195.......... 192  7e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus licheniformis 9945A.................... 192  7e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium sp. CF136........................ 192  7e-54  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Psychrilyobacter atlanticus..................... 192  7e-54  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Geobacillus sp. Y4.1MC1......................... 192  7e-54  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Thermovibrio ammonificans....................... 192  7e-54  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Virgibacillus halodenitrificans................. 192  8e-54  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase [Vir...   
. Aquifex aeolicus................................ 192  9e-54  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfatator indicus...................... 192  1e-53  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium psychrophilum.................... 192  1e-53  8 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sibiricum....................... 192  1e-53  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus................................. 192  1e-53  85 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. planctomycete KSU-1............................. 192  1e-53  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Thermincola potens.............................. 192  1e-53  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. NSP9.1............................. 192  1e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. CPSM8.............................. 192  1e-53  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus licheniformis ATCC 14580............... 192  1e-53  10 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Jeotgalicoccus psychrophilus.................... 192  1e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Lysinibacillus fusiformis....................... 192  1e-53  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bizionia argentinensis.......................... 192  1e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Koribacter versatilis................ 192  1e-53  1 hit   Bacteria:Acidobacteria:                  glutamate-1-semialdehyde aminotransferase...   
. Candidatus Nitrospira defluvii.................. 192  2e-53  3 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium psychrophilum FPG3............... 192  2e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Fla...   
. Brochothrix thermosphacta....................... 192  2e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chryseobacterium soli........................... 191  2e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Chryseobacterium indologenes NBRC 14944......... 191  2e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Chr...   
. Lysinibacillus fusiformis ZB2................... 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Acidobacteriaceae bacterium KBS 89.............. 191  2e-53  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium undae........................... 191  2e-53  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Sediminibacter sp. Hel_I_10..................... 191  2e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Sporosarcina sp. D27............................ 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. L1(2012)........................... 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Riemerella anatipestifer........................ 191  2e-53  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus indicus LMG 22858...................... 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Exiguobacterium sp. GIC31....................... 191  2e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 10403023........................... 191  2e-53  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chryseobacterium formosense..................... 191  2e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Chr...   
. Thermodesulfatator atlanticus................... 191  3e-53  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium rivuli........................... 191  3e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteriaceae bacterium 3A10................ 191  3e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium sp. URHB0058..................... 191  3e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. SB47............................... 191  3e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. TS-2............................... 191  3e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ba...   
. Staphylococcus aureus C0673..................... 191  3e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Bacillus atrophaeus UCMB-5137................... 191  3e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase...   
. Listeria marthii FSL S4-120..................... 191  3e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [Li...   
. Bacillus acidiproducens......................... 191  3e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bergeyella zoohelcum............................ 191  3e-53  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium sibiricum 255-15................ 191  4e-53  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus pohliae........................ 191  4e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum ruminis........................ 191  4e-53  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus contaminans.................... 191  4e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus vitulinus........................ 191  4e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Alkaliphilus metalliredigens.................... 191  4e-53  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. WCH70........................... 191  4e-53  9 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus halodurans............................. 191  7e-53  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Caldicellulosiruptor............................ 190  4e-53  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Flavobacterium sp. EM1321....................... 190  5e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Fla...   
. Staphylococcus sciuri........................... 190  5e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Epilithonimonas lactis.......................... 190  5e-53  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Epi...   
. Salinibacter ruber.............................. 190  5e-53  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: glutamate-1-semialdehyde aminotransferase...   
. Lysinibacillus sphaericus....................... 190  5e-53  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 17376.............................. 190  6e-53  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Lysinibacillus sp. GY32......................... 190  6e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lys...   
. Geobacillus stearothermophilus NUB3621.......... 190  6e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Geo...   
. Riemerella anatipestifer RA-CH-1................ 190  6e-53  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salinibacter ruber DSM 13855.................... 190  6e-53  3 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteria bacterium MS024-3C................ 190  6e-53  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:   glutamate-1-semialdehyde aminotransferase...   
. Turneriella parva............................... 190  7e-53  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus infantis NRRL B-14911.................. 190  7e-53  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Exiguobacterium pavilionensis................... 190  7e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Brochothrix campestris FSL F6-1037.............. 190  7e-53  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bro...   
. Exiguobacterium antarcticum..................... 190  7e-53  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Brevibacillus thermoruber....................... 190  7e-53  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus methanolicus PB1....................... 190  8e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. UNC438CL73TsuS30................... 190  8e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria welshimeri............................. 190  9e-53  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus pumilus................................ 190  9e-53  15 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Hymenobacter norwichensis....................... 190  9e-53  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Aneurinibacillus aneurinilyticus................ 190  1e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Sphaerobacter thermophilus...................... 189  9e-53  3 hits  Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Syntrophomonas wolfei........................... 189  1e-52  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus agnetis.......................... 189  1e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Sta...   
. Bacillus sp. DW5-4.............................. 189  1e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Bhargavaea cecembensis.......................... 189  1e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus firmus DS1............................. 189  1e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Bacillus massilioanorexius...................... 189  1e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium subsaxonicum..................... 189  1e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Desulfitobacterium dichloroeliminans............ 189  1e-52  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfobium narugense..................... 189  1e-52  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Slackia heliotrinireducens...................... 189  1e-52  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus thermodenitrificans................. 189  1e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cibi................................... 189  1e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Thermaerobacter marianensis..................... 189  1e-52  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis...................... 189  1e-52  41 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Brevibacillus brevis............................ 189  1e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis VCU118............... 189  1e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Peptococcaceae bacterium SCADC.................. 189  1e-52  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase [Pep...   
. Actinokineospora enzanensis..................... 189  2e-52  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinokineospora en...   
. Myroides odoratimimus........................... 189  2e-52  6 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acidobacteriaceae bacterium TAA166.............. 189  2e-52  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Salinicoccus albus.............................. 189  2e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Salinicoccus albus]      
. Salinimicrobium terrae.......................... 189  2e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus thermodenitrificans NG80-2.......... 189  2e-52  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Sulfobacillus thermosulfidooxidans.............. 189  2e-52  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Sulfobacillus therm...   
. Gracilimonas tropica............................ 189  2e-52  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Gracilimonas tropica]    
. Geobacillus caldoxylosilyticus.................. 189  2e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 123MFChir2......................... 189  2e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Elizabethkingia anophelis....................... 189  2e-52  5 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [El...   
. Bacillus safensis FO-36b........................ 189  2e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Staphylococcus sp. URHA0057..................... 189  2e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sonorensis............................. 189  2e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis......................... 189  2e-52  14 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. FJAT-14515......................... 189  2e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Granulicella sp. MP5ACTX9....................... 189  2e-52  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Myroides odoratimimus CCUG 12901................ 189  2e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium sp. ACAM 123..................... 189  2e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Solibacillus silvestris StLB046................. 189  2e-52  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Clostridium pasteurianum........................ 189  2e-52  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Caldalkalibacillus thermarum.................... 189  4e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus cellulosilyticus....................... 189  4e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thermicanus aegyptius........................... 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cellulosilyticus DSM 2522.............. 188  3e-52  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus capitis.......................... 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium clariflavum......................... 188  3e-52  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 105MF.............................. 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. HYC-10............................. 188  3e-52  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria innocua................................ 188  3e-52  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Acidobacteriaceae bacterium KBS 83.............. 188  3e-52  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. Flavobacterium saliperosum...................... 188  3e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Flexibacter litoralis........................... 188  3e-52  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteria bacterium MS024-2A................ 188  3e-52  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:   glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium sasangense....................... 188  3e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. UNC437CL72CviS29................... 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus bataviensis............................ 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Singulisphaera acidiphila....................... 188  3e-52  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Hymenobacter sp. DY53........................... 188  3e-52  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase [Hym...   
. Prevotella bryantii............................. 188  3e-52  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Brevibacillus sp. BC25.......................... 188  3e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus stratosphericus........................ 188  4e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. UNC41MFS5.......................... 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIH04008............. 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus aerophilus KACC 16563.................. 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus.................................. 188  4e-52  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus epidermidis NIHLM057............. 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermacetogenium phaeum......................... 188  4e-52  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium oxidotolerans................... 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus safensis............................... 188  4e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis VCU041............... 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium frigoris......................... 188  4e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Rhodothermus marinus............................ 188  4e-52  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: glutamate-1-semialdehyde aminotransferase...   
. Leadbetterella byssophila....................... 188  4e-52  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Gloeobacter violaceus........................... 188  4e-52  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium succinicans...................... 188  4e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus thermoamylovorans...................... 188  4e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 2 [B...   
. Carnobacterium sp. 17-4......................... 188  4e-52  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus equorum subsp. equorum Mu2....... 188  4e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Listeria innocua FSL S4-378..................... 188  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [Li...   
. Lysinibacillus sp. 13S34_air.................... 188  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase [Lys...   
. Salinicoccus carnicancri........................ 188  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Salinicoccus carnic...   
. Bacillus pumilus ATCC 7061...................... 188  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus licheniformis CG-B52................... 187  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Rhodonellum psychrophilum....................... 187  5e-52  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus warneri.......................... 187  5e-52  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus warneri L37603................... 187  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Sulfurihydrogenibium subterraneum............... 187  5e-52  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus pseudintermedius................. 187  5e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermosipho melanesiensis....................... 187  5e-52  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: glutamate-1-semialdehyde aminotransferase...   
. Caldicellulosiruptor hydrothermalis............. 187  5e-52  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. MB2021............................. 187  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Myroides odoratimimus CCUG 3837................. 187  5e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Myroides odoratimimus CCUG 12700................ 187  5e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptococcus sanguinis SK405................... 187  5e-52  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus tepidamans........................ 187  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria grandensis FSL F6-971.................. 187  5e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Staphylococcus hominis.......................... 187  6e-52  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus sp. HGB0015...................... 187  6e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Flavobacterium filum............................ 187  6e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus marmarensis............................ 187  6e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus smithii................................ 187  6e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Mesonia mobilis................................. 187  6e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cytotoxicus............................ 187  6e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 2_A_57_CT2......................... 187  6e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desmospora sp. 8437............................. 187  6e-52  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus sp. E463......................... 187  6e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus equorum.......................... 187  6e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Hydrogenivirga sp. 128-5-R1-1................... 187  6e-52  4 hits  Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM008............. 187  6e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria innocua FSL J1-023..................... 187  6e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Lysinibacillus sp. BF-4......................... 187  6e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lys...   
. Desulfotomaculum kuznetsovii.................... 187  6e-52  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus pseudofirmus........................... 187  6e-52  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 1NLA3E............................. 187  6e-52  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus xylosus.......................... 187  6e-52  9 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Elizabethkingia meningoseptica.................. 187  6e-52  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Eli...   
. Elizabethkingia anophelis Ag1................... 187  6e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Listeria aquatica FSL S10-1188.................. 187  7e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Riemerella columbina............................ 187  7e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteria bacterium BAL38................... 187  7e-52  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Listeria innocua Clip11262...................... 187  7e-52  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sp. AS14.......................... 187  7e-52  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Meiothermus chliarophilus....................... 187  7e-52  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Rhodothermus marinus DSM 4252................... 187  8e-52  2 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: glutamate-1-semialdehyde aminotransferase...   
. Mesoflavibacter zeaxanthinifaciens.............. 187  8e-52  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Deferribacter desulfuricans..................... 187  8e-52  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus alvei............................. 187  8e-52  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus vireti................................. 187  8e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM061............. 187  8e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM031............. 187  8e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Carnobacterium.................................. 187  8e-52  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Gramella echinicola............................. 187  8e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM037............. 187  8e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus pseudofirmus OF4....................... 187  9e-52  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Parachlamydia acanthamoebae..................... 187  9e-52  2 hits  Bacteria:Chlamydiae:Chlamydiales:        glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus sp. 95MFCvi2.1......................... 187  9e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes.......................... 187  9e-52  463 hitsBacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus hemicellulosilyticus JCM 9152.......... 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ba...   
. Staphylococcus epidermidis W23144............... 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aquimarina agarilytica.......................... 187  9e-52  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis FRI909............... 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus pseudomycoides......................... 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus oceanisediminis........................ 187  9e-52  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM023............. 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis 14.1.R1.SE........... 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis VCU128............... 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM070............. 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM095............. 187  9e-52  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus megaterium............................. 187  9e-52  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK150................... 187  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus macauensis............................. 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM087............. 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Weeksella virosa................................ 187  1e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sonorensis L12......................... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM053............. 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cohnella laeviribosi............................ 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus gaemokensis............................ 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Leeuwenhoekiella sp. Hel_I_48................... 187  1e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis Sentile2............. 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis UC7032............... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Sta...   
. Staphylococcus intermedius...................... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus megaterium QM B1551.................... 187  1e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Acidobacterium sp. PMMR2........................ 187  1e-51  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis NIHLM040............. 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis PM221................ 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase [St...   
. Capnocytophaga canimorsus....................... 187  1e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 278922_107......................... 187  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Virgibacillus sp. Vm-5.......................... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 1 [V...   
. Candidatus Chloracidobacterium thermophilum..... 187  1e-51  1 hit   Bacteria:Acidobacteria:                  glutamate-1-semialdehyde aminotransferase...   
. Bacillus mycoides............................... 187  1e-51  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus coagulans.............................. 187  1e-51  9 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chlorobium sp. GBChlB........................... 187  1e-51  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: glutamate-1-semialdehyde aminotransferase [Chl...   
. Halobacillus trueperi........................... 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase [Hal...   
. Listeria monocytogenes HCC23.................... 187  1e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Dyadobacter beijingensis........................ 187  1e-51  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Fulvivirga imtechensis.......................... 187  1e-51  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 171095_106......................... 187  1e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus tusciae................................ 187  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Parachlamydia acanthamoebae str. Hall's coccus.. 187  1e-51  1 hit   Bacteria:Chlamydiae:Chlamydiales:        glutamate-1-semialdehyde 2,1-aminomutase ...   
. Salsuginibacillus kocurii....................... 187  2e-51  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Salsuginibacillus k...   
. Capnocytophaga sp. oral taxon 335............... 186  1e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus megaterium WSH-002..................... 186  1e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus licheniformis WX-02.................... 186  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Macrococcus caseolyticus........................ 186  1e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Mahella australiensis........................... 186  1e-51  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD136........................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus sp. J33................................ 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermus thermophilus............................ 186  2e-51  4 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteriaceae bacterium S85................. 186  2e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus delphini......................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus hesperidum..................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Elizabethkingia anophelis NUHP1................. 186  2e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus flexus................................. 186  2e-51  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus coagulans 2-6.......................... 186  2e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK1056.................. 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Virgibacillus sp. CM-4.......................... 186  2e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes serotype 4b str. CLIP 80. 186  2e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermosipho africanus........................... 186  2e-51  2 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: glutamate-1-semialdehyde aminotransferase...   
. Heliobacillus mobilis........................... 186  2e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminotransferase ...   
. Marivirga tractuosa............................. 186  2e-51  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Adhaeribacter aquaticus......................... 186  2e-51  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK330................... 186  2e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M0480..................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium akagii.............................. 186  2e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus coagulans 36D1......................... 186  2e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chloroherpeton thalassium....................... 186  2e-51  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: glutamate-1-semialdehyde aminotransferase...   
. Acidobacteriaceae bacterium KBS 96.............. 186  2e-51  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. Listeria monocytogenes str. Scott A............. 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 1 [Li...   
. Listeria monocytogenes 6179..................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes J1-220................... 186  2e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes SLCC2376................. 186  2e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. GHH01........................... 186  2e-51  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Staphylococcus epidermidis VCU065............... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus nealsonii.............................. 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus megaterium DSM 319..................... 186  2e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Salinicoccus luteus............................. 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Akkermansia muciniphila......................... 186  2e-51  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. SJS................................ 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Staphylococcus hominis SK119.................... 186  2e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Planococcus donghaensis......................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium gonidiaformans.................... 186  3e-51  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Dyadobacter fermentans.......................... 186  3e-51  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Cohnella panacarvi.............................. 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfobacterium geofontis................ 186  3e-51  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thermoactinomyces sp. Gus2-1.................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [The...   
. Desulfosporosinus meridiei...................... 186  3e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes EGD-e.................... 186  3e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus kribbensis............................. 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Epilithonimonas tenax........................... 186  3e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK36.................... 186  3e-51  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. RP1137............................. 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Listeria monocytogenes J0161.................... 186  3e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus lentus........................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus marmarensis DSM 21297.................. 186  3e-51  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus sp. 37MA............................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacteroidetes bacterium SCGC AAA027-N21......... 186  3e-51  1 hit   Bacteria:Bacteroidetes:                  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus AH676........................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus........................... 186  3e-51  153 hitsBacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes FSL J1-208............... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK1087.................. 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis VMC66................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis serovar chinensis CT-43.. 186  3e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Lysinibacillus sphaericus OT4b.................. 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus flavithermus...................... 186  3e-51  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Streptococcus sanguinis SK355................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. FJAT-13831......................... 186  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK353................... 186  3e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK49.................... 186  4e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Halanaerobium praevalens........................ 186  4e-51  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: glutamate-1-semialdehyde aminotransferase...   
. Thermobacillus composti......................... 186  4e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Staphylococcus simulans......................... 185  3e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Listeria monocytogenes Finland 1988............. 185  4e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermosipho africanus H17ap60334................ 185  4e-51  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus HuA4-10......................... 185  4e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis BVS058A4............. 185  4e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Listeria monocytogenes 10403S................... 185  4e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK160................... 185  4e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Hydrogenobacter thermophilus.................... 185  4e-51  2 hits  Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes 08-5578.................. 185  4e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga cynodegmi........................ 185  4e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Prolixibacter bellariivorans.................... 185  4e-51  1 hit   Bacteria:Bacteroidetes:                  glutamate-1-semialdehyde aminotransferase...   
. Porphyromonas macacae........................... 185  4e-51  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Blastopirellula marina.......................... 185  4e-51  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus massiliosenegalensis................... 185  4e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Gillisia limnaea................................ 185  4e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Symbiobacterium thermophilum.................... 185  4e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Caldibacillus debilis........................... 185  4e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Lysinibacillus sphaericus C3-41................. 185  4e-51  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Rhodopirellula sp. SWK7......................... 185  5e-51  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus sp. WBUNB009........................... 185  5e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Lachnoanaerobaculum sp. OBRC5-5................. 185  5e-51  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus 172560W......................... 185  5e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aquimarina muelleri............................. 185  5e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis VCU071............... 185  5e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfosporosinus acidiphilus................... 185  5e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Leeuwenhoekiella sp. MAR_2009_132............... 185  5e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Lacinutrix sp. 5H-3-7-4......................... 185  5e-51  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Lachnoanaerobaculum sp. MSX33................... 185  5e-51  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase [Lach...   
. Staphylococcus epidermidis ATCC 12228........... 185  5e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus sp. B14905............................. 185  5e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium gonidiaformans ATCC 25563......... 185  5e-51  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sp. oral taxon 336............... 185  5e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Thermomicrobium roseum.......................... 185  6e-51  1 hit   Bacteria:Chloroflexi:Thermomicrobia:Thermomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus acidoterrestris................ 185  6e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Alicyclobacillus ac...   
. Bacillus mannanilyticus......................... 185  6e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aequorivita capsosiphonis....................... 185  6e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sp. oral taxon 412............... 185  6e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Acidobacteria bacterium KBS 146................. 185  6e-51  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus flavithermus WK1.................. 185  6e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  RecName: Full=Glutamate-1-semialdehyde...   
. Gemmatimonas sp. AP64........................... 185  6e-51  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes:Gemmatimonadales: glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus................................... 185  6e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: Glutamate-1-semialdehyde 2,...   
. Capnocytophaga sp. oral taxon 324............... 185  6e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Listeria seeligeri.............................. 185  6e-51  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus AH621........................... 185  6e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Carnobacterium sp. WN1359....................... 185  6e-51  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK115................... 185  6e-51  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus larvae............................ 185  7e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Tuberibacillus calidus.......................... 185  8e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Phycisphaera mikrensis.......................... 185  1e-50  1 hit   Bacteria:Planctomycetes:Phycisphaerae:Phycisphaerales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. J37................................ 184  7e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Planococcus halocryophilus...................... 184  8e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus epidermidis VCU144............... 184  8e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. A8.............................. 184  8e-51  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. G1w1............................ 184  8e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Geo...   
. Olleya sp. VCSA23............................... 184  8e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Herpetosiphon aurantiacus....................... 184  8e-51  1 hit   Bacteria:Chloroflexi:Chloroflexi:Herpetosiphonales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus pinihumi.......................... 184  8e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium pavilionensis RW-2.............. 184  8e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. JDR-2......................... 184  8e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus gelatini............................... 184  8e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus E33L............................ 184  9e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus caprae........................... 184  9e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus anthracis.............................. 184  9e-51  26 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospirillum ferrooxidans..................... 184  9e-51  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus ATCC 14579...................... 184  9e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Listeria monocytogenes serotype 4b str. F2365... 184  9e-51  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG6O-2......................... 184  9e-51  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus sp. KU2-6(11)..................... 184  9e-51  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ano...   
. Pseudanabaena biceps............................ 184  9e-51  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Elizabethkingia meningoseptica 502.............. 184  9e-51  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG6X1-2........................ 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus group........................... 184  1e-50  19 hits Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cereus BAG2X1-1........................ 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus str. Schrouff................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Anoxybacillus flavithermus NBRC 109594.......... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus acidocaldarius................. 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus G9842........................... 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cereus AH820........................... 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cereus AH1271.......................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Sporolactobacillus laevolacticus................ 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sp. oral taxon 380............... 184  1e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Paenibacillus larvae subsp. larvae 08-100....... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [Pa...   
. Bacillus cereus BAG5X1-1........................ 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis.......................... 184  1e-50  11 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus SJ1............................. 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VDM034.......................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis serovar kurstaki str. HD. 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus thuringiensis str. Al Hakam............ 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus thuringiensis HD-771................... 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cereus Rock3-44........................ 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria ivanovii............................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. SG-1............................... 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus anthracis str. Ames.................... 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Anaerophaga thermohalophila..................... 184  1e-50  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Listeria rocourtiae FSL F6-920.................. 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Maribacter sp. Hel_I_7.......................... 184  1e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD156........................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Myroides........................................ 184  1e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus thuringiensis serovar konkukian str. 9. 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis serovar huazhongensis BG. 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus MC67............................ 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum thermocisternum................ 184  1e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Salinimicrobium xinjiangense.................... 184  1e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus biovar anthracis str. CI........ 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis serovar andalousiensis B. 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus weihenstephanensis FSL R5-860.......... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Listeria seeligeri serovar 1/2b str. SLCC3954... 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus FRI-35.......................... 184  1e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum alcoholivorax.................. 184  1e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus anthracis str. CDC 684................. 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chloroflexus aggregans.......................... 184  1e-50  1 hit   Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus MSX-A1.......................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Olleya sp. VCSM12............................... 184  1e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus G9241........................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus R309803......................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Gracilibacillus halophilus...................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. Y412MC52........................ 184  1e-50  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. JGI 001011-F15..................... 184  1e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Persephonella marina............................ 184  1e-50  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. Y412MC61........................ 184  1e-50  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus ATCC 10987...................... 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus carnosus......................... 184  1e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus kaustophilus HTA426................. 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Emticicia oligotrophica......................... 184  1e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Spirosoma panaciterrae.......................... 184  1e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus AH187........................... 184  1e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes FSL N3-165............... 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Heliobacterium modesticaldum.................... 184  2e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Meiothermus timidus............................. 184  2e-50  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: hypothetical protein [Meiothermus timidus]     
. Bacillus sp. H1a................................ 184  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD107........................... 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. C56-T3.......................... 184  2e-50  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. FW23............................ 184  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. CAMR5420........................ 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Geo...   
. Caldicellulosiruptor saccharolyticus............ 184  2e-50  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus sp. SK3-4......................... 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Staphylococcus saprophyticus.................... 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Schlesneria paludicola.......................... 184  2e-50  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus panaciterrae........................... 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Nostoc sp. PCC 7107............................. 184  2e-50  3 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus cereus AH1134.......................... 184  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Clostridium pasteurianum BC1.................... 184  2e-50  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Thalassobacillus devorans....................... 184  2e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Hymenobacter sp. APR13.......................... 184  2e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein N008_00395 [Hymenobacter ...   
. Hymenobacter aerophilus......................... 184  2e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Hymenobacter aeroph...   
. Thermosediminibacter oceani..................... 184  1e-49  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: potassium transporter Trk [Thermosedimini...   
. Capnocytophaga ochracea......................... 183  2e-50  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Persephonella sp. KM09-Lau-8.................... 183  2e-50  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD014........................... 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Persephonella sp. IF05-L8....................... 183  2e-50  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga ochracea DSM 7271................ 183  2e-50  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus sanguinis SK72.................... 183  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus Btn1260..... 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus warneri SG1...................... 183  2e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aquimarina latercula............................ 183  2e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sputigena........................ 183  2e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Gramella forsetii............................... 183  2e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Belliella baltica............................... 183  2e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Listeria floridensis FSL S10-1187............... 183  2e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Bacillus sp. m3-13.............................. 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Laceyella sacchari.............................. 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium ultunense........................... 183  2e-50  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminotransfe...   
. Flectobacillus major............................ 183  2e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Listeria seeligeri FSL S4-171................... 183  2e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [List...   
. Aequorivita sublithincola....................... 183  2e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Gloeobacter kilaueensis......................... 183  2e-50  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga granulosa........................ 183  2e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Runella zeae.................................... 183  3e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Ilyobacter polytropus........................... 183  3e-50  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Planococcus donghaensis MPA1U2.................. 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacteroides..................................... 183  3e-50  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Verrucomicrobia bacterium SCGC AAA164-E04....... 183  3e-50  1 hit   Bacteria:Verrucomicrobia:                hypothetical protein [Verrucomicrobia bac...   
. Bacillus cereus VD045........................... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. ZYK................................ 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD115........................... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospirillum sp. Group II '5-way CG'.......... 183  3e-50  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: Glutamate-1-semialdehyde 2,1-aminomutase [Lept...   
. Lysinibacillus boronitolerans................... 183  3e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus C5086..................... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Caldicellulosiruptor bescii..................... 183  3e-50  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Lysinibacillus fusiformis ZC1................... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus VET0081R.................. 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Bacillus endophyticus........................... 183  3e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Trichormus azollae.............................. 183  3e-50  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus MM3............................. 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG2O-3......................... 183  3e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus cereus BAG5X2-1........................ 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. FJAT-14578......................... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus akibai JCM 9157........................ 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ba...   
. Psychroflexus gondwanensis...................... 183  3e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus massiliensis..................... 183  3e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Carnobacterium maltaromaticum................... 183  3e-50  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium josui............................... 183  3e-50  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus smithii 7_3_47FAA...................... 183  3e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG2X1-2........................ 183  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Caldalkalibacillus thermarum TA2.A1............. 183  4e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Simkania negevensis............................. 183  7e-50  1 hit   Bacteria:Chlamydiae:Chlamydiales:        glutamate-1-semialdehyde 2,1-aminomutase ...   
. Eudoraea adriatica.............................. 182  4e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Aneurinibacillus terranovensis.................. 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus T72814.................... 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Staphylococcus aureus DAR1507................... 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Bacillus weihenstephanensis KBAB4............... 182  4e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus 18754-2................... 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium gelidilacus...................... 182  4e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Roseiflexus castenholzii........................ 182  4e-50  1 hit   Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glutamate-1-semialdehyde aminotransferase...   
. Listeria riparia FSL S10-1204................... 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Bacillus cereus ATCC 4342....................... 182  4e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus subsp. aureus COL......... 182  4e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermus thermophilus HB27....................... 182  4e-50  3 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Listeria weihenstephanensis FSL R9-0317......... 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Kurthia huakuii................................. 182  4e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Gracilibacillus lacisalsi....................... 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Niastella koreensis............................. 182  4e-50  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Brevibacillus panacihumi........................ 182  4e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Alkalibacillus haloalkaliphilus................. 182  5e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Sphingobacterium paucimobilis................... 182  5e-50  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Sphingobacterium pa...   
. Clostridium sp. BNL1100......................... 182  5e-50  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Echinicola vietnamensis......................... 182  5e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Sulfurihydrogenibium yellowstonense............. 182  5e-50  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Anoxybacillus flavithermus AK1.................. 182  5e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cytophaga hutchinsonii.......................... 182  5e-50  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Olleya marilimosa............................... 182  5e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sp. CM59......................... 182  5e-50  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Zavarzinella formosa............................ 182  5e-50  2 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: hypothetical protein [Zavarzinella formosa]    
. Ornithobacterium rhinotracheale................. 182  5e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Caloramator australicus......................... 182  5e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Listeria grayi.................................. 182  5e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens DSM 7................ 182  5e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus R0353..................... 182  6e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Paenibacillus sp. FSL H8-237.................... 182  6e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Paenibacillus ginsengihumi...................... 182  6e-50  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Maribacter sp. HTCC2170......................... 182  6e-50  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Elizabethkingia meningoseptica NBRC 12535....... 182  6e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum......................... 182  7e-50  25 hits Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Bacillus halodurans C-125....................... 182  7e-50  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Balneola vulgaris............................... 182  7e-50  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein [Balneola vulgaris]       
. Streptomyces sp. NRRL S-118..................... 182  7e-50  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Streptomyces sp. NR...   
. Staphylococcus aureus subsp. aureus MSHR1132.... 182  7e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG2O-2......................... 182  7e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus thuringiensis MC28..................... 182  7e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M0139..................... 182  7e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Bacillus cereus AH1272.......................... 182  7e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Shimazuella kribbensis.......................... 182  7e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Granulicella mallensis.......................... 182  7e-50  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Geomicrobium sp. JCM 19038...................... 182  8e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ge...   
. Sphingobacterium paucimobilis HER1398........... 182  8e-50  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: hypothetical protein M472_10400 [Sphingobacter...   
. Orenia marismortui.............................. 182  8e-50  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: hypothetical protein [Orenia marismortui]      
. Staphylococcus pettenkoferi..................... 182  8e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Tepidanaerobacter sp. Re1....................... 182  8e-50  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Thermus thermophilus JL-18...................... 182  8e-50  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. JF8............................. 182  8e-50  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Gemmatimonadetes bacterium KBS708............... 182  8e-50  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes: Glutamate-1-semialdehyde 2,1-aminomutase [Gemm...   
. Ilyobacter polytropus DSM 2926.................. 182  8e-50  4 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus clausii................................ 182  8e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase [Bac...   
. Desulfosporosinus youngiae...................... 182  8e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG1X1-3........................ 182  8e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Gillisia marina................................. 182  8e-50  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Caldanaerobius polysaccharolyticus.............. 182  8e-50  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes 08-5923.................. 182  8e-50  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans.......................... 182  9e-50  19 hits Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus DAR3907................... 182  9e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum alkaliphilum................... 182  9e-50  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB241_528J8................ 182  9e-50  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG3X2-1........................ 182  9e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus clausii KSM-K16........................ 182  9e-50  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Methylacidiphilum fumariolicum.................. 182  9e-50  1 hit   Bacteria:Verrucomicrobia:Methylacidiphilales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus sp. AL1.......................... 182  9e-50  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. JA-3-3Ab...................... 182  9e-50  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Cellulosilyticum lentocellum.................... 182  1e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Synechococcus sp. PCC 7502...................... 182  1e-49  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde-2,1-aminomutase ...   
. Synergistes sp. 3_1_syn1........................ 182  1e-49  2 hits  Bacteria:Synergistetes:Synergistia:Synergistales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Clostridium thermocellum........................ 181  1e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M0467..................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Listeria monocytogenes FSL R2-561............... 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus toyonensis BCT-7112.................... 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Brevibacillus borstelensis...................... 181  1e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Alicyclobacillus acidoterrestris ATCC 49025..... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ali...   
. Staphylococcus aureus subsp. aureus 55/2053..... 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes SLCC7179................. 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus Rock3-28........................ 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M0628..................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Staphylococcus aureus subsp. aureus CGS00....... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus megaterium NBRC 15308.................. 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. [Scytonema hofmanni] UTEX 2349.................. 181  1e-49  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Geovibrio sp. L21-Ace-BES....................... 181  1e-49  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfitibacter alkalitolerans.................. 181  1e-49  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 71193....... 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bryobacter aggregatus........................... 181  1e-49  1 hit   Bacteria:Acidobacteria:                  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. BL4-6.............................. 181  1e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Calothrix sp. PCC 7507.......................... 181  1e-49  3 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde 2,1-aminomutase ...   
. Terriglobus saanensis........................... 181  1e-49  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus acidocaldarius LAA1............ 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria seeligeri FSL N1-067................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus F87619.................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus azotoformans MEV2011................... 181  1e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase [Baci...   
. Pseudanabaena sp. PCC 6802...................... 181  1e-49  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD022........................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M21126.................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes 07PF0776................. 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus haemolyticus..................... 181  1e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aneurinibacillus aneurinilyticus DSM 5562....... 181  1e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Staphylococcus aureus subsp. aureus 21342....... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cylindrospermum stagnale........................ 181  1e-49  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde 2,1-aminomutase ...   
. Listeria monocytogenes FSL J1-194............... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus HuB4-10......................... 181  1e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus simiae........................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. subtilis RO-NN-1....... 181  2e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Winogradskyella sp. PG-2........................ 181  2e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Wi...   
. Bacillus bataviensis LMG 21833.................. 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum CTI-6................... 181  2e-49  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Verrucomicrobia bacterium SCGC AAA300-O17....... 181  2e-49  1 hit   Bacteria:Verrucomicrobia:                hypothetical protein [Verrucomicrobia bac...   
. Staphylococcus aureus M1275..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Staphylococcus aureus C1655..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Cyanobium sp. PCC 7001.......................... 181  2e-49  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus W41914.................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Staphylococcus aureus subsp. aureus E1410....... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes QOC2..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria fleischmannii.......................... 181  2e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Tenacibaculum sp. 47A_GOM-205m.................. 181  2e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus MRSA252..... 181  2e-49  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Carnobacterium jeotgali......................... 181  2e-49  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfovibrio yellowstonii................ 181  2e-49  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. subtilis str. BAB-1.... 181  2e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus DAR3617................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Staphylococcus aureus H84973.................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospira kirschneri........................... 181  2e-49  8 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Staphylococcus aureus subsp. aureus Mu50........ 181  2e-49  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis Miyagi-4...................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis subsp. subtilis str. SC-8..... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus ginsengihumi........................... 181  2e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Mangrovimonas yunxiaonensis..................... 181  2e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Man...   
. Thermodesulfovibrio islandicus.................. 181  2e-49  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde aminotransferase...   
. Planococcus halocryophilus Or1.................. 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase...   
. Bacillus methanolicus MGA3...................... 181  2e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus mycoides Rock1-4....................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus M1311..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Leptospira kirschneri serovar Bulgarica str. Ni. 181  2e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Paenisporosarcina sp. TG-14..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 21340....... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium cellobioparum....................... 181  2e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira kmetyi............................... 181  2e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M0732..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Staphylococcus aureus subsp. aureus C160........ 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M1277..................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Gracilibacillus halophilus YIM-C55.5............ 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes L99...................... 181  2e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria grayi FSL F6-1183...................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Bacillus bogoriensis............................ 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis QB928......................... 181  2e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. JS................................. 181  2e-49  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Flexithrix dorotheae............................ 181  2e-49  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: hypothetical protein [Flexithrix dorotheae]    
. Prochlorococcus sp. scB241_528O2................ 181  2e-49  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Sulfurihydrogenibium sp. YO3AOP1................ 181  2e-49  4 hits  Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Arenitalea lutea................................ 181  2e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus vireti LMG 21834....................... 181  2e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Candidatus Protochlamydia amoebophila........... 181  2e-49  1 hit   Bacteria:Chlamydiae:Chlamydiales:        glutamate-1-semialdehyde 2,1-aminomutase ...   
. Fusobacterium nucleatum subsp. nucleatum ATCC 2. 181  3e-49  3 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Kurthia sp. JC8E................................ 181  3e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Pontibacillus halophilus........................ 181  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum CTI-2................... 181  3e-49  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Leptospirillum ferriphilum...................... 181  3e-49  2 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Lai str. 56601... 181  3e-49  3 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans str. UI 12621............ 181  3e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Autumnalis str. . 181  3e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Leptospira interrogans serovar Grippotyphosa st. 181  3e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium suncheonense..................... 180  3e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 21269....... 180  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermosynechococcus elongatus................... 180  3e-49  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Listeria monocytogenes FSL J2-071............... 180  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus warneri VCU121................... 180  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus pseudomycoides DSM 12442............... 180  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermosynechococcus elongatus BP-1.............. 180  3e-49  3 hits  Bacteria:Cyanobacteria:Chroococcales:    RecName: Full=Glutamate-1-semialdehyde ...   
. Staphylococcus aureus R0545..................... 180  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Staphylococcus aureus RF122..................... 180  3e-49  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cyclobacteriaceae bacterium AK24................ 180  3e-49  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus................................... 180  3e-49  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus hominis subsp. hominis C80....... 180  3e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus subsp. aureus ED133....... 180  3e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. polymorphum ATCC. 180  3e-49  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Listeria ivanovii subsp. ivanovii PAM 55........ 180  3e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus acidocaldarius subsp. acidocal. 180  3e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium celerecrescens...................... 180  3e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase [ [ ...   
. Planococcus antarcticus......................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus lehensis G1............................ 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bac...   
. Paenibacillus senegalensis...................... 180  4e-49  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Marvinbryantia formatexigens.................... 180  4e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Manilae.......... 180  4e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. MIT 9515........... 180  4e-49  3 hits  Bacteria:Cyanobacteria:Prochlorales:     RecName: Full=Glutamate-1-semialdehyde ...   
. Staphylococcus aureus subsp. aureus MW2......... 180  4e-49  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geomicrobium sp. JCM 19037...................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ge...   
. Bacillus sp. JCM 19047.......................... 180  4e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glutamate-1-semialdehyde...   
. Bacillus wakoensis JCM 9140..................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ba...   
. Bacillus cereus VDM062.......................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Lentibacillus jeotgali.......................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Moorella thermoacetica.......................... 180  4e-49  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Paucisalibacillus globulus...................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Bulgarica str. M. 180  4e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus DAR2067................... 180  4e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Paenibacillus curdlanolyticus................... 180  4e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Slackia exigua.................................. 180  4e-49  1 hit   Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Ammonifex degensii.............................. 180  4e-49  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Lora str. TE 199. 180  5e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. JCM 19046.......................... 180  5e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glutamate-1-semialdehyde...   
. Bacillus sp. NSP22.2............................ 180  5e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Mitsuokella multacida........................... 180  5e-49  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Listeria fleischmannii FSL S10-1203............. 180  5e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Clostridiisalibacter paucivorans................ 180  5e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiisalibacte...   
. Ruminococcus callidus........................... 180  5e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Bacillus boroniphilus JCM 21738................. 180  5e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Ornithinibacillus scapharcae.................... 180  5e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus sp. G11MC16......................... 180  5e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Listeria welshimeri serovar 6b str. SLCC5334.... 180  5e-49  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermaerobacter subterraneus.................... 180  5e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermosynechococcus sp. NK55.................... 180  5e-49  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminomutase HemL...   
. Paenibacillus daejeonensis...................... 180  5e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria grayi DSM 20601........................ 180  5e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Moorella thermoacetica Y72...................... 180  6e-49  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase [Mo...   
. Synechococcus sp. JA-2-3B'a(2-13)............... 180  6e-49  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Chloroflexus sp. MS-G........................... 180  6e-49  1 hit   Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glutamate-1-semialdehyde aminotransferase...   
. Pseudanabaena sp. PCC 7367...................... 179  6e-49  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Halobacillus sp. BAB-2008....................... 179  6e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Psychroserpens burtonensis...................... 179  6e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Dyadobacter alkalitolerans...................... 179  6e-49  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Streptococcus merionis.......................... 179  6e-49  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus merio...   
. Lachnoanaerobaculum sp. ICM7.................... 179  6e-49  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. 5B6................................ 179  6e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Nonlabens ulvanivorans.......................... 179  6e-49  4 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Non...   
. Desulfitobacterium hafniense.................... 179  6e-49  5 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermodesulfovibrio thiophilus.................. 179  7e-49  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: glutamate-1-semialdehyde aminotransferase...   
. Sediminibacillus halophilus..................... 179  7e-49  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Runella limosa.................................. 179  7e-49  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacteriaceae bacterium HQM9................ 179  7e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Marinithermus hydrothermalis.................... 179  7e-49  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus stratosphericus LAMA 585............... 179  7e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus subsp. aureus JKD6159..... 179  7e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus KPL1845..... 179  7e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chlorogloeopsis fritschii....................... 179  7e-49  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Bacillus altitudinis 41KF2b..................... 179  7e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Clostridium clariflavum DSM 19732............... 179  7e-49  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Alkaliphilus transvaalensis..................... 179  7e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira kirschneri serovar Grippotyphosa str. 179  8e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Planococcus antarcticus DSM 14505............... 179  8e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus KLT6...................... 179  8e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Capnocytophaga sp. oral taxon 332............... 179  8e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Gillisia sp. JM1................................ 179  8e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus......................... 179  8e-49  13 hits Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Brevibacillus sp. phR........................... 179  8e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Rudanella lutea................................. 179  8e-49  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans str. L1207............... 179  8e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Marinilabilia salmonicolor...................... 179  9e-49  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium cadaveris........................... 179  9e-49  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens subsp. plantarum UCM. 179  9e-49  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminotransfe...   
. Flavobacterium columnare........................ 179  9e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Caldilinea aerophila............................ 179  9e-49  1 hit   Bacteria:Chloroflexi:Caldilineae:Caldilineales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus simiae CCM 7213.................. 179  9e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Listeria innocua ATCC 33091..................... 179  9e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sp. oral taxon 863............... 179  9e-49  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Leptospira interrogans str. Brem 329............ 179  9e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Halalkalibacillus halophilus.................... 179  9e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium russii............................ 179  9e-49  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Pomona str. Kenn. 179  9e-49  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD142........................... 179  9e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD048........................... 179  9e-49  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prevotella sp. MA2016........................... 179  9e-49  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG2X1-3........................ 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chlorogloeopsis sp. PCC 7702.................... 179  1e-48  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium sp. OBRC1......................... 179  1e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde-2,1-aminomutase [Fuso...   
. Syntrophothermus lipocalidus.................... 179  1e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus AH603........................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leeuwenhoekiella blandensis..................... 179  1e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Criblamydia sequanensis CRIB-18................. 179  1e-48  1 hit   Bacteria:Chlamydiae:Chlamydiales:        Glutamate-1-semialdehyde 2,1-aminomutase [Cri...   
. Bacillus cereus VDM006.......................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Clostridium acetobutylicum...................... 179  1e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BDRD-ST196...................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Sporosarcina ureae.............................. 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geomicrobium sp. JCM 19055...................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glutamate-1-semialdehyde...   
. Bacillus amyloliquefaciens EGD-AQ14............. 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus MC118........................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus H65863.................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Selenomonas bovis............................... 179  1e-48  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Selenomonas bovis]       
. Leptospira interrogans str. 2002000624.......... 179  1e-48  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens FZB42................ 179  1e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cyanobacterium stanieri......................... 179  1e-48  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde 2,1-aminomutase ...   
. Leptospira kirschneri str. 200802841............ 179  1e-48  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Bacillus cereus CER057.......................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Microchaete sp. PCC 7126........................ 179  1e-48  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Leptospira...................................... 179  1e-48  3 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Streptococcus suis.............................. 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Anaerophaga sp. HS1............................. 179  1e-48  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus subtilis group......................... 179  1e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Clostridium sp. SY8519.......................... 179  1e-48  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens subsp. plantarum AS4. 179  1e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Chloroflexus sp. Y-396-1........................ 179  1e-48  1 hit   Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium cellulolyticum...................... 179  1e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Fischerella sp. PCC 9339........................ 179  1e-48  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Bacillus atrophaeus 1942........................ 179  1e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis serovar finitimus YBT-02. 179  1e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus methylotrophicus....................... 179  1e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus W............................... 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cereus B5-2............................ 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptomyces sp. NRRL F-5123.................... 179  1e-48  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens CAU-B946............. 179  1e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus 03BB102......................... 179  1e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Slackia sp. CM382............................... 179  1e-48  2 hits  Bacteria:Actinobacteria:Actinobacteria:Coriobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus amyloliquefaciens UASWS BA1............ 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium papyrosolvens....................... 179  1e-48  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Stanieria cyanosphaera.......................... 179  1e-48  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Pelosinus....................................... 179  1e-48  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Veillonella montpellierensis.................... 179  1e-48  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB245a_520K10.............. 179  1e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. NATL2A............. 179  1e-48  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Alicyclobacillus pomorum........................ 179  1e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB243_497N18............... 179  1e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum ChDC F128............... 179  1e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Clostridium arbusti............................. 179  1e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Pelosinus fermentans............................ 179  2e-48  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Spirosoma linguale.............................. 179  2e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira kirschneri serovar Sokoine str. RM1.. 179  2e-48  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Bacillus anthracis str. 'Ames Ancestor'......... 178  1e-48  10 hits Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus Q1.............................. 178  1e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Gramella portivictoriae......................... 178  2e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Caldicellulosiruptor kronotskyensis............. 178  2e-48  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Desulfitobacterium hafniense DCB-2.............. 178  2e-48  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Formosa sp. AK20................................ 178  2e-48  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: Glutamate-1-semialdehyde aminotransferase...   
. Sporolactobacillus laevolacticus DSM 442........ 178  2e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Virgibacillus sp. SK37.......................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Vir...   
. Listeria fleischmannii LU2006-1................. 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. AS9601............. 178  2e-48  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Geomicrobium sp. JCM 19039...................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glutamate-1-semialdehyde...   
. Bacillus cereus VD200........................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis HD-789................... 178  2e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cereus BAG5O-1......................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Muricauda ruestringensis........................ 178  2e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Dysgonomonas capnocytophagoides................. 178  2e-48  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira interrogans serovar Copenhageni str.. 178  2e-48  3 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Fibrisoma limi.................................. 178  2e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD146........................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Anabaena sp. PCC 7108........................... 178  2e-48  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum CTI-5................... 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Prochlorococcus marinus str. MIT 9301........... 178  2e-48  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Tumebacillus sp. NFB............................ 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Tum...   
. Clostridium botulinum C/D str. BKT12695......... 178  2e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase [Clos...   
. Paenibacillus sp. PAMC 26794.................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermanaerovibrio velox......................... 178  2e-48  1 hit   Bacteria:Synergistetes:Synergistia:Synergistales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Fusobacterium nucleatum CTI-3................... 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Fusobacterium nucleatum subsp. animalis OT 420.. 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium sp. oral taxon 370................ 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. animalis 3_1_33.. 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. animalis 4_8..... 178  2e-48  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus thuringiensis Bt407.................... 178  2e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus taiwanensis....................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fibrella aestuarina............................. 178  2e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Gelidibacter mesophilus......................... 178  2e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Arenibacter algicola............................ 178  2e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus CO-98....... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Stap...   
. Nodularia spumigena............................. 178  2e-48  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Algoriphagus vanfongensis....................... 178  2e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Microscilla marina.............................. 178  2e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Robinsoniella sp. KNHs210....................... 178  2e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermocrinis albus.............................. 178  2e-48  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus HuB5-5.......................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. animalis 11_3_2.. 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus B4264........................... 178  2e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Paenibacillus fonticola......................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Runella slithyformis............................ 178  2e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus tusciae DSM 2912....................... 178  2e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. MIT 9211........... 178  2e-48  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Mastigocladopsis repens......................... 178  2e-48  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus VD131........................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Marinococcus halotolerans....................... 178  2e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus SJUD6124.................. 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Leptospira interrogans str. FPW2026............. 178  2e-48  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG6X1-1........................ 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aquimarina sp. 22II-S11-z7...................... 178  2e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Aqu...   
. Bacillus thuringiensis BMB171................... 178  2e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Prochlorococcus sp. scB245a_520F22.............. 178  2e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus A6300..................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium sp. CM22.......................... 178  2e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde-2,1-aminomutase [Fuso...   
. Staphylococcus carnosus subsp. carnosus TM300... 178  2e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG4X12-1....................... 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus thuringiensis serovar pakistani str. T. 178  2e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Candidatus Synechococcus spongiarum............. 178  2e-48  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus................................. 178  2e-48  10 hits Bacteria:Cyanobacteria:Prochlorales:     MULTISPECIES: glutamate-1-semialdehyde am...   
. Lachnospiraceae oral taxon 107.................. 178  2e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus alvei A6-6i-x..................... 178  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Listeria ivanovii FSL F6-596.................... 178  3e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [List...   
. Prochlorococcus sp. scB243_498F21............... 178  3e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. FSL R5-192.................... 178  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Synechococcus sp. CB0101........................ 178  3e-48  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG4X2-1........................ 178  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Desulfitobacterium.............................. 178  3e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Nocardioides sp. JGI 0001009-J09................ 178  3e-48  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Lactobacillus reuteri........................... 178  3e-48  7 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus m1550........................... 177  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fischerella sp. PCC 9431........................ 177  3e-48  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Cyclobacterium marinum.......................... 177  3e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus TUSH6001.................. 177  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Desulfovirgula thermocuniculi................... 177  3e-48  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Lactobacillus reuteri ATCC 53608................ 177  3e-48  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus Rock1-3......................... 177  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Sediminibacterium sp. C3........................ 177  3e-48  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Bacteroidetes bacterium FH5..................... 177  3e-48  1 hit   Bacteria:Bacteroidetes:                  glutamate-1-semialdehyde aminotransferase [Bac...   
. Bacillus sp. GeD10.............................. 177  3e-48  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase...   
. Rhodopirellula maiorica......................... 177  3e-48  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Staphylococcus aureus subsp. aureus CIG1165..... 177  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. vincentii 3_1_36. 177  3e-48  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Psychroflexus tropicus.......................... 177  3e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium periodonticum..................... 177  3e-48  4 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Sebaldella termitidis........................... 177  3e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Echinicola pacifica............................. 177  3e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus BAG1O-1......................... 177  3e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Terriglobus roseus.............................. 177  3e-48  1 hit   Bacteria:Acidobacteria:Acidobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Scytonema hofmanni.............................. 177  3e-48  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Flavobacteria bacterium BBFL7................... 177  3e-48  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:   glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus subsp. pastoris str. CC. 177  4e-48  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Clostridium botulinum........................... 177  4e-48  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Clostridium phytofermentans..................... 177  4e-48  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium beijerinckii MBC34-26............... 177  4e-48  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. MIT 9202........... 177  4e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Nostoc sp. PCC 7120............................. 177  4e-48  4 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde 2,1-aminomutase [Nos...   
. Staphylococcus epidermidis VCU012............... 177  4e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. H1m................................ 177  4e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Joostella marina................................ 177  4e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. vincentii 4_1_13. 177  4e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. vincentii ATCC 4. 177  4e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Leptospira kirschneri str. H1................... 177  4e-48  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Staphylococcus aureus subsp. aureus............. 177  4e-48  16 hits Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde aminotransferase (EC...   
. Staphylococcus aureus subsp. aureus 21196....... 177  4e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Fusobacterium periodonticum D10................. 177  4e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB243_498C16............... 177  4e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Prochlorothrix hollandica....................... 177  4e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Dactylococcopsis salina......................... 177  4e-48  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde-2,1-aminomutase ...   
. Sporolactobacillus terrae....................... 177  4e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Algoriphagus sp. PR1............................ 177  4e-48  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus OCMM6110.................. 177  4e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Bacillus pumilus SAFR-032....................... 177  4e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium sp. ASBs410......................... 177  4e-48  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Dyadobacter crusticola.......................... 177  4e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB241_527N11............... 177  4e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M1297..................... 177  4e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Zobellia galactanivorans........................ 177  4e-48  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Oceanobacillus picturae......................... 177  4e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase [Oce...   
. Spirosoma luteum................................ 177  4e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Sporomusa ovata................................. 177  4e-48  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Fusobacterium nucleatum subsp. animalis ATCC 51. 177  4e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde-2,1-aminomutase [Fuso...   
. Fusobacterium nucleatum subsp. animalis 21_1A... 177  4e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase [Fuso...   
. Oceanobacillus kimchii.......................... 177  5e-48  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Oceanobacillus kimc...   
. Alicyclobacillus acidocaldarius subsp. acidocal. 177  5e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus cereus HuA2-4.......................... 177  5e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fischerella muscicola........................... 177  5e-48  2 hits  Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Sporolactobacillus inulinus..................... 177  5e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Sediminibacterium salmoneum..................... 177  5e-48  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum gibsoniae...................... 177  5e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB241_528N20............... 177  5e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Alkaliphilus oremlandii......................... 177  5e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. OSY-SE........................ 177  5e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus T84594.................... 177  5e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Bacillus cereus HuA2-1.......................... 177  5e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Truepera radiovictrix........................... 177  5e-48  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Deinococcales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus HO 5096 041. 177  5e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB241_527L15............... 177  5e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Nostoc punctiforme.............................. 177  5e-48  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. Aloe-11....................... 177  5e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Salisaeta longa................................. 177  5e-48  1 hit   Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: glutamate-1-semialdehyde aminotransferase...   
. Leptospira kirschneri str. 2008720114........... 177  5e-48  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Synechococcus sp. PCC 7335...................... 177  6e-48  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. FSL H7-689.................... 177  6e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Paenibacillus sp. UNC451MF...................... 177  6e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Flexistipes sinusarabici........................ 177  6e-48  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: glutamate-1-semialdehyde aminotransferase...   
. Salimicrobium sp. MJ3........................... 177  6e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 11819-97.... 177  6e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB245a_521O23.............. 177  6e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Clostridium novyi............................... 177  6e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Clostridiales................................... 177  7e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Imtechella halotolerans......................... 177  7e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. CB0205........................ 177  7e-48  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Anabaena variabilis............................. 177  7e-48  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus F82600.................... 177  7e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Brevibacillus laterosporus...................... 177  7e-48  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB245a_519L21.............. 177  7e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus assamensis........................ 177  7e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium varium............................ 177  7e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. JCM 19045.......................... 177  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: glutamate-1-semialdehyde...   
. Prochlorococcus sp. scB243_495P20............... 177  8e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Halobacillus kuroshimensis...................... 177  8e-48  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinomadura flavalba........................... 177  1e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinomadura flavalba]   
. Staphylococcus aureus subsp. aureus N315........ 176  8e-48  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus VET1956S.................. 176  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Staphylococcus aureus DICM09/00997-9HST2........ 176  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Formosa agariphila KMM 3901..................... 176  8e-48  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Fo...   
. Staphylococcus aureus F25913.................... 176  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Oceanithermus profundus......................... 176  8e-48  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Bhargavaea cecembensis DSE10.................... 176  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Staphylococcus aureus M0801..................... 176  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Fusobacterium nucleatum subsp. animalis D11..... 176  8e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus harenae........................... 176  8e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus 36P1...................... 176  8e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Fusobacterium ulcerans.......................... 176  9e-48  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Algoriphagus mannitolivorans.................... 176  9e-48  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus TCH60....... 176  9e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus alvei TS-15....................... 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Eubacterium saburreum........................... 176  9e-48  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus C427........ 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. fusiforme ATCC 5. 176  9e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Paenisporosarcina sp. HGH0030................... 176  9e-48  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Verrucomicrobiae bacterium DG1235............... 176  9e-48  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium periodonticum ATCC 33693.......... 176  9e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus dendritiformis.................... 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Carnobacterium maltaromaticum LMA28............. 176  9e-48  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Staphylococcus aureus SJOS6050.................. 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Ktedonobacter racemifer......................... 176  9e-48  1 hit   Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium termitidis.......................... 176  9e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Prochlorococcus sp. W7.......................... 176  9e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus DAR3179................... 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus DAR5891................... 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus HIF003_B2N-C.............. 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Fusobacterium sp. CM1........................... 176  9e-48  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde-2,1-aminomutase [Fuso...   
. Prochlorococcus sp. scB243_498N4................ 176  9e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus 12S01399.................. 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Staphylococcus aureus DAR948.................... 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Brevibacillus borstelensis AK1.................. 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium novyi A str. 4540................... 176  9e-48  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase [Clos...   
. Prochlorococcus sp. scB243_498B22............... 176  9e-48  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sanguinis......................... 176  9e-48  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus D139........ 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus MUF168.................... 176  9e-48  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus alvei DSM 29...................... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Methylacidiphilum infernorum.................... 176  1e-47  1 hit   Bacteria:Verrucomicrobia:Methylacidiphilales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus 6665-5.................... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus MSSA476..... 176  1e-47  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Virgibacillus alimentarius...................... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Krokinobacter sp. 4H-3-7-5...................... 176  1e-47  3 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 21235....... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fervidibacteria bacterium JGI 0000001-D5........ 176  1e-47  1 hit   Bacteria::                               hypothetical protein [candidate division ...   
. Staphylococcus aureus subsp. aureus USA300_FPR3. 176  1e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Anditalea andensis.............................. 176  1e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase [Cyt...   
. Staphylococcus aureus subsp. aureus CIGC128..... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Crocinitomix catalasitica....................... 176  1e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thermosinus carboxydivorans..................... 176  1e-47  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Nafulsella turpanensis.......................... 176  1e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium periodonticum 2_1_31.............. 176  1e-47  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Desulfosporosinus sp. OT........................ 176  1e-47  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus H72115.................... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. 142MFCol3.1.................... 176  1e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus nealsonii AAU1......................... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. animalis 7_1..... 176  1e-47  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Cyanothece sp. PCC 7424......................... 176  1e-47  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Aquimarina megaterium........................... 176  1e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB243_495G23............... 176  1e-47  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Clostridium straminisolvens JCM 21531........... 176  1e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase [ [...   
. Staphylococcus aureus SARM C5621................ 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Pleurocapsa minor............................... 176  1e-47  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   glutamate-1-semialdehyde-2,1-aminomutase ...   
. Calothrix sp. 336/3............................. 176  1e-47  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase [Cal...   
. Zunongwangia profunda........................... 176  1e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Roseiflexus sp. RS-1............................ 176  1e-47  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 21321....... 176  1e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Stap...   
. Staphylococcus lugdunensis...................... 176  2e-47  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus arlettae CVD059.................. 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Paenibacillus popilliae......................... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Anabaena cylindrica............................. 176  2e-47  1 hit   Bacteria:Cyanobacteria:Nostocales:       Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Staphylococcus lugdunensis VCU150............... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Stap...   
. Tenacibaculum maritimum......................... 176  2e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Sporosarcina sp. EUR3 2.2.2..................... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. MIT 9215........... 176  2e-47  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Kordia algicida................................. 176  2e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Rivularia sp. PCC 7116.......................... 176  2e-47  3 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde-2,1-aminomutase ...   
. Fusobacterium ulcerans ATCC 49185............... 176  2e-47  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus M1313..................... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Listeria cornellensis FSL F6-969................ 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Lis...   
. Bacillus isronensis............................. 176  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospira genomosp. 5.......................... 176  2e-47  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Staphylococcus aureus subsp. aureus 21194....... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Saccharibacillus kuerlensis..................... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenisporosarcina quisquiliarum TG20............ 176  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus macerans.......................... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Cohnella thermotolerans......................... 176  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. NRRL F-5630.................... 176  2e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Viridibacillus arenosi FSL R5-213............... 175  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Vir...   
. Staphylococcus aureus subsp. aureus IS-160...... 175  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus 21202....... 175  2e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus subsp. aureus M013........ 175  2e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cyanothece sp. PCC 7822......................... 175  2e-47  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Pirellula staleyi............................... 175  2e-47  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Prevotella brevis............................... 175  2e-47  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB243_498P15............... 175  2e-47  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium sp. JGI 0001001-D01.............. 175  2e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus pasadenensis...................... 175  2e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Carboxydothermus ferrireducens.................. 175  3e-47  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Carboxydothermus hydrogenoformans............... 175  3e-47  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus DAR1814................... 175  3e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Clostridium tyrobutyricum....................... 175  3e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium sticklandii......................... 175  3e-47  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Bacillus selenitireducens....................... 175  3e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. W8.......................... 175  3e-47  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Planomicrobium glaciei CHR43.................... 175  3e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Pla...   
. Brevibacillus laterosporus LMG 15441............ 175  3e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [Br...   
. Cytophaga aurantiaca............................ 175  3e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Xenococcus sp. PCC 7305......................... 175  3e-47  2 hits  Bacteria:Cyanobacteria:Pleurocapsales:   glutamate-1-semialdehyde-2,1-aminomutase ...   
. Kamptonema...................................... 175  3e-47  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Clostridium glycolicum.......................... 175  3e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Paenibacillus lactis............................ 175  3e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Sporolactobacillus vineae....................... 175  3e-47  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. J13................................ 175  3e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus caldoxylosilyticus NBRC 107762...... 175  3e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Microcoleus sp. PCC 7113........................ 175  3e-47  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Plautia stali symbiont.......................... 175  3e-47  3 hits  Bacteria::                               glutamate-1-semialdehyde aminotransferase...   
. Chloroflexus.................................... 175  3e-47  1 hit   Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Sporocytophaga myxococcoides.................... 175  3e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Solibacillus silvestris......................... 175  3e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Dolichospermum circinale........................ 175  4e-47  2 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Nostoc sp. PCC 7524............................. 175  4e-47  3 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde-2,1-aminomutase ...   
. Candidate division OctSpa1-106.................. 175  4e-47  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [Fervi...   
. Staphylococcus aureus SJUD6064.................. 175  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Pontibacter sp. BAB1700......................... 175  4e-47  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. TCA20......................... 175  4e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Pa...   
. Terribacillus aidingensis....................... 175  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Ter...   
. Staphylococcus aureus subsp. aureus 21314....... 175  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Stap...   
. Spirulina subsalsa.............................. 175  4e-47  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Mastigocoleus testarum.......................... 175  4e-47  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Flexibacter sp. AMV16........................... 175  4e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Veillonella sp. oral taxon 780.................. 174  4e-47  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus FP_N5203 OX............... 174  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Halobacillus halophilus......................... 174  4e-47  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aquiflexum sp. LW9.............................. 174  4e-47  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Owenweeksia hongkongensis....................... 174  4e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Gaetbulibacter saemankumensis................... 174  4e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium bartlettii DORA_8_9................. 174  4e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein Q606_CBAC00403G0037 [Clos...   
. Oceanobacillus iheyensis........................ 174  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Pontibacillus marinus........................... 174  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermus islandicus.............................. 174  4e-47  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Acaryochloris sp. CCMEE 5410.................... 174  4e-47  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga gingivalis....................... 174  4e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Aquimarina macrocephali......................... 174  4e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Poribacteria bacterium JGI 0000000-Pori2........ 174  4e-47  1 hit   Bacteria:Poribacteria:                   glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. FSL H8-457.................... 174  4e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Bacillaceae..................................... 174  4e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus subsp. aureus 6850........ 174  5e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Staphylococcus aureus O11....................... 174  5e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium bartlettii.......................... 174  5e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Flavobacterium soli............................. 174  5e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus UCIM6116.................. 174  5e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...   
. Meiothermus silvanus............................ 174  5e-47  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Polaribacter irgensii........................... 174  5e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus aureus DAR3165................... 174  5e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase 2 [St...   
. Veillonella atypica............................. 174  5e-47  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. Y412MC10...................... 174  5e-47  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Gemmatimonas aurantiaca......................... 174  5e-47  1 hit   Bacteria:Gemmatimonadetes:Gemmatimonadetes:Gemmatimonadales: glutamate-1-semialdehyde aminotransferase...   
. Dokdonia donghaensis MED134..................... 174  5e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde 2,1-aminomutase [Dokd...   
. Fischerella..................................... 174  5e-47  1 hit   Bacteria:Cyanobacteria:Stigonematales:   MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus DAR5805................... 174  5e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus pseudintermedius HKU10-03........ 174  5e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Bacillus sp. NRRL B-14911....................... 174  6e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Bacillus cytotoxicus NVH 391-98................. 174  6e-47  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus haemolyticus JCSC1435............ 174  6e-47  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Pelosinus sp. UFO1.............................. 174  6e-47  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: Glutamate-1-semialdehyde 2,1-aminomutase [Pelo...   
. Bacillus macauensis ZFHKF-1..................... 174  6e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Negativicoccus succinicivorans DORA_17_25....... 174  6e-47  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: Glutamate-1-semialdehyde-2,1-aminomutase [Nega...   
. Staphylococcus epidermidis VCU139............... 174  6e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Cyanothece sp. PCC 7425......................... 174  6e-47  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Leptospira santarosai........................... 174  6e-47  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Staphylococcus pseudintermedius ED99............ 174  6e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Schleiferia thermophila str. Yellowstone........ 174  6e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Sch...   
. Leptospira wolffii.............................. 174  6e-47  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Leptospira santarosai str. MOR084............... 174  6e-47  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus aureus DAR3901................... 174  6e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geothrix fermentans............................. 174  6e-47  1 hit   Bacteria:Acidobacteria:Holophagae:Holophagales: glutamate-1-semialdehyde aminotransferase...   
. Thermobacillus composti KWC4.................... 174  6e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Aquimarina sp. SW150............................ 174  7e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum CTI-1................... 174  7e-47  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptosporangium roseum........................ 174  7e-47  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Dethiobacter alkaliphilus....................... 174  7e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Chroococcidiopsis thermalis..................... 174  7e-47  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Eubacterium saburreum DSM 3986.................. 174  7e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. A9............................ 174  7e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Gordonia amicalis............................... 174  7e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Gordonia amicalis]       
. Paenibacillus barengoltzii G22.................. 174  7e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde 2,...   
. Lactobacillus reuteri DSM 20016................. 174  7e-47  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium papyrosolvens C7.................... 174  7e-47  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Porphyromonas sp. oral taxon 278................ 174  8e-47  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Paenibacillus sp. 1-18.......................... 174  8e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Maribacter antarcticus.......................... 174  8e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. PCC 6312...................... 174  8e-47  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde-2,1-aminomutase ...   
. Acaryochloris marina............................ 174  8e-47  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Gemmata obscuriglobus........................... 174  8e-47  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Kurthia massiliensis............................ 174  8e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Nonlabens sediminis............................. 174  8e-47  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [No...   
. Paenibacillus forsythiae........................ 174  9e-47  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Chrysiogenes arsenatis.......................... 174  9e-47  1 hit   Bacteria:Chrysiogenetes:Chrysiogenetes:Chrysiogenales: glutamate-1-semialdehyde aminotransferase...   
. Chlorobium limicola............................. 174  9e-47  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: glutamate-1-semialdehyde aminotransferase...   
. Bacillus selenitireducens MLS10................. 174  9e-47  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces albus.............................. 174  9e-47  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Thermus aquaticus............................... 174  9e-47  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira santarosai str. ZUN179............... 174  9e-47  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Alicyclobacillus hesperidum URH17-3-68.......... 174  9e-47  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Geobacillus thermoglucosidasius................. 174  1e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Planctomyces brasiliensis....................... 174  1e-46  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Trichodesmium erythraeum........................ 174  1e-46  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Lactobacillus reuteri MM2-3..................... 174  1e-46  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Geobacillus thermoglucosidasius GT20............ 174  1e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Isosphaera pallida.............................. 174  1e-46  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Sphaerobacter thermophilus DSM 20745............ 174  1e-46  6 hits  Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: class III aminotransferase [Sphaerobacter...   
. Brevibacillus laterosporus GI-9................. 173  1e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Exiguobacterium antarcticum B7.................. 173  1e-46  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fischerella sp. PCC 9605........................ 173  1e-46  1 hit   Bacteria:Cyanobacteria:Stigonematales:   glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. HW567......................... 173  1e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. W2.......................... 173  1e-46  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus vortex............................ 173  1e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Peptostreptococcaceae bacterium VA2............. 173  1e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Macrococcus caseolyticus JCSC5402............... 173  1e-46  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Staphylococcus capitis SK14..................... 173  1e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. oral taxon 786................ 173  1e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus subsp. marinus str. CCM. 173  1e-46  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Thermus oshimai................................. 173  1e-46  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Coprococcus catus............................... 173  1e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Synechococcus sp. CC9311........................ 173  1e-46  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Flavobacteriales bacterium ALC-1................ 173  1e-46  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium botulinum BKT015925................. 173  2e-46  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cyanothece...................................... 173  2e-46  1 hit   Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: glutamate-1-semialdehyde am...   
. Thermus igniterrae.............................. 173  2e-46  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Lachnospiraceae bacterium NC2004................ 173  2e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Oscillatoria sp. PCC 10802...................... 173  2e-46  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus sp. scB245a_521C8............... 173  2e-46  1 hit   Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Thermanaerovibrio acidaminovorans............... 173  2e-46  1 hit   Bacteria:Synergistetes:Synergistia:Synergistales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Gillisia sp. ck-I2-15........................... 173  2e-46  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Crinalium epipsammum............................ 173  2e-46  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Veillonella parvula............................. 173  2e-46  3 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium sp. SCGC AAA160-P02.............. 173  2e-46  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sabinae T27....................... 173  2e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Paenibacillus pini JCM 16418.................... 173  2e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Pa...   
. Veillonella sp. HPA0037......................... 173  2e-46  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Fusobacterium perfoetens........................ 173  2e-46  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Leptospira noguchii............................. 173  2e-46  6 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Brevibacillus laterosporus PE36................. 173  2e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Bre...   
. Leptospira fainei............................... 173  5e-46  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: aminotransferase, class III [Leptospira f...   
. Effluviibacter roseus........................... 172  2e-46  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Ignavibacterium album........................... 172  2e-46  1 hit   Bacteria:Chlorobi:Ignavibacteria:Ignavibacteriales: glutamate-1-semialdehyde aminotransferase...   
. Fusobacterium nucleatum subsp. vincentii 3_1_27. 172  2e-46  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase [Fuso...   
. Halothece sp. PCC 7418.......................... 172  2e-46  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde 2,1-aminomutase ...   
. Paenibacillus popilliae ATCC 14706.............. 172  2e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Mariniradius saccharolyticus.................... 172  2e-46  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: Glutamate-1-semialdehyde aminotransferase...   
. Leptospira genomosp. 4.......................... 172  2e-46  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. endosymbiont of unidentified scaly snail isolat. 172  3e-46  1 hit   Bacteria::                               glutamate-1-semialdehyde 2,1-aminomutase [end...   
. Streptomyces sp. GXT6........................... 172  3e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Gloeocapsa sp. PCC 7428......................... 172  3e-46  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde 2,1-aminomutase ...   
. Paenibacillus vortex V453....................... 172  3e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermus sp. NMX2.A1............................. 172  3e-46  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase [The...   
. Verrucomicrobia bacterium LP2A.................. 172  3e-46  1 hit   Bacteria:Verrucomicrobia:                glutamate-1-semialdehyde aminotransferase...   
. Leptospira santarosai str. ST188................ 172  3e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Leptospira santarosai str. CBC379............... 172  3e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Pedosphaera parvula............................. 172  3e-46  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: glutamate-1-semialdehyde aminotransferase...   
. Synechocystis sp. PCC 6803...................... 172  3e-46  8 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde 2,1-aminomutase ...   
. Synechococcus sp. WH 8016....................... 172  3e-46  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Gloeocapsa sp. PCC 73106........................ 172  3e-46  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde-2,1-aminomutase ...   
. Streptomyces lavenduligriseus................... 172  3e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces collinus........................... 172  3e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Synechocystis sp. PCC 6803 substr. GT-I......... 172  3e-46  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Veillonella parvula DSM 2008.................... 172  3e-46  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Planctomyces maris.............................. 172  3e-46  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Denitrovibrio acetiphilus DSM 12809............. 172  3e-46  4 hits  Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira noguchii str. 2006001870............. 172  3e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Dyadobacter sp. Y620-1.......................... 172  3e-46  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Eubacterium eligens............................. 172  3e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Thermus sp. CCB_US3_UF1......................... 172  3e-46  3 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Oscillatoria acuminata.......................... 172  3e-46  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Hydrogenobaculum sp. Y04AAS1.................... 172  3e-46  4 hits  Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase...   
. Chlamydia muridarum............................. 172  3e-46  6 hits  Bacteria:Chlamydiae:Chlamydiales:        glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus zanthoxyli........................ 172  3e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Halobacillus dabanensis......................... 172  3e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 1 [H...   
. Paenibacillus sp. FSL R7-277.................... 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Pae...   
. Veillonella sp. oral taxon 158.................. 172  4e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus terrigena......................... 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. cyanobacterium UCYN-A........................... 172  4e-46  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Geitlerinema sp. PCC 7407....................... 172  4e-46  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptomyces sp. NRRL S-623..................... 172  4e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Megamonas hypermegale........................... 172  4e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Megamonas....................................... 172  4e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Synechococcus sp. RCC307........................ 172  4e-46  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus durus............................. 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus mucilaginosus..................... 172  4e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces achromogenes....................... 172  4e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Sporosarcina newyorkensis....................... 172  4e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Thermocrinis ruber.............................. 172  4e-46  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: glutamate-1-semialdehyde aminotransferase [The...   
. Meiothermus rufus............................... 172  4e-46  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira meyeri............................... 172  5e-46  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Flavobacterium sp. WG21......................... 172  5e-46  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Thermobaculum terrenum ATCC BAA-798............. 172  5e-46  4 hits  Bacteria::                               glutamate-1-semialdehyde 2,1-aminomutase ...   
. Actinopolymorpha alba........................... 172  5e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolymorpha alba]   
. Moorea producta................................. 172  5e-46  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Leptospira meyeri serovar Hardjo str. Went 5.... 172  5e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus elongatus PCC 6301................ 172  5e-46  19 hits Bacteria:Cyanobacteria:Chroococcales:    glutamate 1-semialdehyde aminotransferase [Syn...   
. Oceanobacillus iheyensis HTE831................. 172  5e-46  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces roseoverticillatus................. 172  5e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Capnocytophaga sp. oral taxon 338............... 172  5e-46  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella sp. ACP1............................ 172  5e-46  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Flexibacter roseolus............................ 172  5e-46  1 hit   Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella sp. ICM51a.......................... 172  6e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Veil...   
. Veillonella parvula ATCC 17745.................. 172  6e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella dispar DORA_11...................... 172  6e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: Glutamate-1-semialdehyde-2,1-aminomutase [Veil...   
. Leptospira noguchii serovar Panama str. CZ214... 172  7e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira noguchii str. 2001034031............. 172  7e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Bacillus chagannorensis......................... 172  8e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Clostridium botulinum D str. 1873............... 171  6e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Tenacibaculum ovolyticum........................ 171  6e-46  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Lachnospiraceae bacterium 10-1.................. 171  6e-46  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Chlorobaculum tepidum........................... 171  7e-46  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella sp. 3_1_44.......................... 171  7e-46  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella sp. AS16............................ 171  7e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde-2,1-aminomutase [Veil...   
. Chlorobium phaeovibrioides...................... 171  7e-46  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: glutamate-1-semialdehyde aminotransferase...   
. Sulfobacillus acidophilus TPY................... 171  7e-46  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptomyces sp. PsTaAH-124..................... 171  7e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Megamonas rupellensis........................... 171  7e-46  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Omnitrophus fodinae.................. 171  7e-46  1 hit   Bacteria::                               glutamate-1-semialdehyde aminotransferase...   
. Leptonema illini................................ 171  7e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Paenibacillus sp. FSL R7-269.................... 171  7e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde-2,1-aminomutase [Paen...   
. Synechococcus sp................................ 171  8e-46  6 hits  Bacteria:Cyanobacteria:Chroococcales:    Chain A, Crystal Structure Of Glutamate-1-Semialde...   
. Leptospira interrogans str. HAI1536............. 171  8e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Streptomyces sp. NRRL S-31...................... 171  8e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. WH 5701....................... 171  8e-46  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Prochlorococcus marinus str. MIT 9303........... 171  8e-46  3 hits  Bacteria:Cyanobacteria:Prochlorales:     glutamate-1-semialdehyde aminotransferase...   
. Cetobacterium somerae........................... 171  8e-46  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   hypothetical protein [Cetobacterium somerae]   
. Lachnospiraceae bacterium oral taxon 082........ 171  8e-46  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. P22........................... 171  8e-46  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Glutamate-1-semialdehyde 2,1-aminomutase 2 [P...   
. Zhouia amylolytica AD3.......................... 171  9e-46  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde-2,1-aminomutase [Zhou...   
. Streptomyces tsukubaensis....................... 171  9e-46  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Algoriphagus marincola.......................... 171  9e-46  2 hits  Bacteria:Bacteroidetes:Cytophagia:Cytophagales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira noguchii serovar Autumnalis str. ZUN. 171  9e-46  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Microcystis aeruginosa.......................... 171  9e-46  9 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Leptolyngbya nodulosa........................... 171  9e-46  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Synechococcus elongatus PCC 7942................ 171  9e-46  5 hits  Bacteria:Cyanobacteria:Chroococcales:    RecName: Full=Glutamate-1-semialdehyde ...   
. Anoxybacillus kamchatkensis..................... 171  9e-46  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Syntrophobotulus glycolicus..................... 171  1e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira noguchii str. 2007001578............. 171  1e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Crocosphaera watsonii........................... 171  1e-45  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Leptospira sp. B5-022........................... 171  1e-45  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Crocosphaera watsonii WH 8501................... 171  1e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Streptomyces megasporus......................... 171  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Porphyromonas crevioricanis..................... 171  1e-45  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira borgpetersenii....................... 171  1e-45  3 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Paenibacillus dendritiformis C454............... 171  1e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Anabaena sp. 90................................. 171  1e-45  3 hits  Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Porphyromonas cansulci.......................... 171  1e-45  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces himastatinicus..................... 171  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Oscillatoria nigroviridis....................... 171  1e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Cyanobium sp. CACIA14........................... 171  1e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase [Cya...   
. Streptomyces peruviensis........................ 171  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Leptolyngbya sp. PCC 6406....................... 171  1e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde-2,1-aminomutase ...   
. Terrimonas ferruginea........................... 171  1e-45  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira weilii............................... 171  1e-45  5 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Chthoniobacter flavus........................... 171  1e-45  1 hit   Bacteria:Verrucomicrobia:Spartobacteria: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces flavochromogenes................... 171  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. SS............................. 171  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. NRRL F-5126.................... 171  1e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. ML694-90F3..................... 171  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase [St...   
. Leptospira weilii str. UI 13098................. 171  2e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Leptospira sp. P2653............................ 171  2e-45  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Streptomyces violaceorubidus.................... 171  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces avermitilis........................ 171  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus elongatus......................... 171  2e-45  3 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Leptospira weilii str. 2006001855............... 171  2e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus elgii............................. 171  2e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. MSt1.......................... 171  2e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Pae...   
. Leptospira inadai............................... 171  3e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Flavobacterium johnsoniae....................... 170  2e-45  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Calditerrivibrio nitroreducens DSM 19672........ 170  2e-45  4 hits  Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: glutamate-1-semialdehyde aminotransferase...   
. Brevibacillus panacihumi W25.................... 170  2e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Amycolatopsis taiwanensis....................... 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Amycolatopsis taiwa...   
. Microcystis aeruginosa TAIHU98.................. 170  2e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde-2,1-aminomutase ...   
. Veillonella sp. DORA_A_3_16_22.................. 170  2e-45  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: Glutamate-1-semialdehyde-2,1-aminomutase [Veil...   
. Streptomyces coelicoflavus ZG0656............... 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase [Str...   
. Cylindrospermopsis raciborskii.................. 170  2e-45  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Candidatus Caldatribacterium saccharofermentans. 170  2e-45  1 hit   Bacteria::                               hypothetical protein [Candidatus Caldatri...   
. Streptomyces mobaraensis........................ 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Leptotrichia buccalis........................... 170  2e-45  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde aminotransferase...   
. Leptospira weilii str. 2006001853............... 170  2e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Flavobacterium reichenbachii.................... 170  2e-45  1 hit   Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase [Fla...   
. Streptomyces globisporus........................ 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Veillonellaceae................................. 170  2e-45  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: hypothetical protein [Veill...   
. Planktothrix.................................... 170  2e-45  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Staphylococcus chromogenes MU 970............... 170  2e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase [Sta...   
. Thermobispora bispora........................... 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sclerotialus....................... 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Thermobrachium celere........................... 170  2e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Glutamate-1-semialdehyde aminotransferase...   
. Lactobacillus versmoldensis..................... 170  2e-45  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: glutamate-1-semialdehyde aminotransferase...   
. Cyanothece sp. CCY0110.......................... 170  2e-45  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Veillonella sp. 6_1_27.......................... 170  2e-45  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. Tu 6176........................ 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase [Str...   
. Leptolyngbya boryana............................ 170  2e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Leptotrichia wadei.............................. 170  2e-45  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde-2,1-aminomutase ...   
. Clostridium sp. ASF502.......................... 170  2e-45  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Lachnospiraceae bacterium A2.................... 170  2e-45  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Desulfurispora thermophila...................... 170  2e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Eubacterium acidaminophilum DSM 3953............ 170  2e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase HemL ...   
. Meiothermus taiwanensis......................... 170  2e-45  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella dispar.............................. 170  2e-45  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. NRRL S-1022.................... 170  2e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium phytofermentans ISDg................ 170  3e-45  6 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. KORDI-100..................... 170  3e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase [Syn...   
. Clostridium novyi B str. NCTC 9691.............. 170  3e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase [Clos...   
. Leptotrichia trevisanii......................... 170  3e-45  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde 2,1-aminomutase ...   
. Synechococcus sp. BL107......................... 170  3e-45  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Demetria terragena.............................. 170  3e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Clostridium haemolyticum NCTC 9693.............. 170  3e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase [Clos...   
. Halobacillus halophilus DSM 2266................ 170  3e-45  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptomyces.................................... 170  3e-45  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: MULTISPECIES: glutamate-1-semialdehyde am...   
. Streptomyces sp. Tu6071......................... 170  3e-45  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. NRRL WC-3626................... 170  3e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus peoriae........................... 170  3e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus lactis 154........................ 170  3e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Paenibacillus ehimensis......................... 170  3e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Actinopolyspora mortivallis..................... 170  3e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Actinopolyspora mor...   
. Planctomyces limnophilus........................ 170  4e-45  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira terpstrae serovar Hualin str. LT 11-. 170  4e-45  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: aminotransferase, class III [Leptospira t...   
. Leptospira broomii.............................. 170  5e-45  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Thermus scotoductus............................. 170  6e-45  2 hits  Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces ochraceiscleroticus................ 169  3e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Candidatus Poribacteria sp. WGA-4E.............. 169  3e-45  3 hits  Bacteria:Poribacteria:                   hypothetical protein [Candidatus Poribact...   
. Pseudoramibacter alactolyticus.................. 169  3e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Microcoleus vaginatus........................... 169  3e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. KORDI-52...................... 169  3e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase [Syn...   
. Flavobacterium sp. F52.......................... 169  3e-45  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. SPB78.......................... 169  3e-45  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces niveus NCIMB 11891................. 169  3e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase [Str...   
. Paenibacillus sp. HGF7.......................... 169  3e-45  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: glutamate-1-semialdehyde am...   
. Nocardiopsis alkaliphila........................ 169  4e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces griseus............................ 169  4e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Synechococcus sp. CC9902........................ 169  4e-45  4 hits  Bacteria:Cyanobacteria:Chroococcales:    RecName: Full=Glutamate-1-semialdehyde ...   
. Synechococcus sp. RS9917........................ 169  4e-45  2 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Candidatus Atelocyanobacterium thalassa isolate. 169  4e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde 2,1-aminomutase [Cand...   
. Meiothermus cerbereus........................... 169  4e-45  1 hit   Bacteria:Deinococcus-Thermus:Deinococci:Thermales: glutamate-1-semialdehyde aminotransferase...   
. Microcystis aeruginosa PCC 9443................. 169  4e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Hydrogenobaculum................................ 169  4e-45  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: MULTISPECIES: glutamate-1-semialdehyde-2,...   
. Calothrix sp. PCC 7103.......................... 169  4e-45  1 hit   Bacteria:Cyanobacteria:Nostocales:       glutamate-1-semialdehyde aminotransferase...   
. Streptomyces violens............................ 169  4e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. NRRL S-337..................... 169  4e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Eubacterium sp. 14-2............................ 169  4e-45  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Arthrospira platensis str. Paraca............... 169  4e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase [Art...   
. Streptomyces clavuligerus....................... 169  4e-45  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Microcystis aeruginosa PCC 7941................. 169  4e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Desulfotomaculum acetoxidans.................... 169  5e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Pleurocapsa sp. PCC 7319........................ 169  5e-45  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   glutamate-1-semialdehyde aminotransferase...   
. Leptospira fainei serovar Hurstbridge str. BUT . 169  5e-45  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Veillonella ratti............................... 169  5e-45  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Streptomyces laceyi............................. 169  5e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Arthrospira platensis........................... 169  5e-45  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptomyces seoulensis......................... 169  5e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces sp. CNH287......................... 169  5e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. filamentous cyanobacterium ESFC-1............... 169  5e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Chlorobium phaeobacteroides..................... 169  5e-45  1 hit   Bacteria:Chlorobi:Chlorobia:Chlorobiales: glutamate-1-semialdehyde aminotransferase...   
. Geitlerinema sp. PCC 7105....................... 169  5e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Arthrospira maxima.............................. 169  6e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Pelotomaculum thermopropionicum................. 169  6e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. bacterium JKG1.................................. 169  6e-45  1 hit   Bacteria::                               glutamate-1-semialdehyde aminotransferase...   
. Geminocystis herdmanii.......................... 169  6e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Sphingobacterium antarcticus 4BY................ 169  6e-45  1 hit   Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: glutamate-1-semialdehyde aminotransferase [Sph...   
. Streptomyces sp. NRRL F-5065.................... 169  6e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Arthrospira sp. PCC 8005........................ 169  6e-45  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Leptolyngbya sp. Heron Island J................. 169  6e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces clavuligerus ATCC 27064............ 169  6e-45  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Arthrospira platensis C1........................ 169  6e-45  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  glutamate-1-semialdehyde aminotransferase...   
. Streptomyces fulvissimus........................ 169  6e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: Glutamate-1-semialdehyde aminotransferase...   
. Leptospira borgpetersenii serovar Pomona str. 2. 169  6e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Eubacterium cellulosolvens...................... 169  7e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde aminotransferase...   
. Waddlia chondrophila............................ 169  7e-45  1 hit   Bacteria:Chlamydiae:Chlamydiales:        glutamate-1-semialdehyde 2,1-aminomutase ...   
. Streptomyces sp. NRRL S-1448.................... 169  7e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces durhamensis........................ 169  7e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Streptomyces exfoliatus......................... 169  7e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Veillonella atypica ACS-134-V-Col7a............. 169  7e-45  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira borgpetersenii str. Brem 307......... 169  8e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative glutamate-1-semialdehyde-2,1-ami...   
. Streptomyces sp. NRRL F-2799.................... 169  8e-45  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Leptospira borgpetersenii str. 200801926........ 169  8e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: putative glutamate-1-semial...   
. Leptospira alexanderi........................... 169  8e-45  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus polymyxa.......................... 168  9e-45  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Fibrobacter succinogenes........................ 168  9e-45  1 hit   Bacteria:Fibrobacteres:Fibrobacterales:  glutamate-1-semialdehyde aminotransferase...   
. Clostridium tunisiense.......................... 168  9e-45  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium tunisie...   
. Synechococcus sp. NKBG15041c.................... 168  9e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. ICGEB2008..................... 168  9e-45  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Erysipelotrichaceae bacterium 2_2_44A........... 168  9e-45  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Synechococcus sp. WH 8102....................... 168  9e-45  4 hits  Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Synechocystis sp. PCC 6714...................... 168  9e-45  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Glutamate-1-semialdehyde aminotransferase [Syn...   
. Clostridium innocuum............................ 168  9e-45  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: glutamate-1-semialdehyde-2,1-aminomutase ...   
. Selenomonas flueggei............................ 168  9e-45  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. 1-49.......................... 168  1e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Ruminococcus bromii............................. 168  1e-44  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Firmicutes bacterium M10-2...................... 168  1e-44  2 hits  Bacteria:Firmicutes:                     glutamate-1-semialdehyde-2,1-aminomutase ...   
. Paenibacillus alginolyticus..................... 168  1e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Microcystis aeruginosa PCC 7806................. 168  1e-44  1 hit   Bacteria:Cyanobacteria:Chroococcales:    glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus sp. URHA0014...................... 168  1e-44  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. Paenibacillus polymyxa SC2...................... 168  1e-44  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  glutamate-1-semialdehyde aminotransferase...   
. bacterium MP-01................................. 168  1e-44  1 hit   Bacteria::                               glutamate-1-semialdehyde aminotransferase [bac...   
. Streptomyces pristinaespiralis.................. 168  1e-44  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: glutamate-1-semialdehyde aminotransferase...   
. Leptotrichia sp. oral taxon 879................. 168  1e-44  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   glutamate-1-semialdehyde-2,1-aminomutase ...   
. Amphidinium carterae............................ 202  2e-57  1 hit   Eukaryota::Dinophyceae:Gymnodiniales:    glutamate semialdehyde synthase [Amphidinium c...   
. Morus notabilis................................. 192  2e-53  1 hit   Eukaryota:Streptophyta:Rosales:          Glutamate-1-semialdehyde 2,1-aminomutase 1 [Mo...   
. Bombus impatiens................................ 192  1e-52  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Bigelowiella natans............................. 187  3e-51  1 hit   Eukaryota::                              glutamate 1-semialdehyde 2,1-aminomutase [Bige...   
. Arabis alpina................................... 186  3e-51  1 hit   Eukaryota:Streptophyta:Brassicales:      hypothetical protein AALP_AA8G463600 [Arabis a...   
. Ectocarpus siliculosus.......................... 186  8e-51  1 hit   Eukaryota:Phaeophyceae:Ectocarpales:     glutamate-1-semialdehyde 2,1-aminomutase, put...   
. Coccomyxa subellipsoidea C-169.................. 185  1e-50  2 hits  Eukaryota:Chlorophyta:Trebouxiophyceae:  glutamate-1-semialdehyde 2,1-aminomutase,...   
. Eutrema salsugineum............................. 184  2e-50  4 hits  Eukaryota:Streptophyta:Brassicales:      hypothetical protein EUTSA_v10004138mg [E...   
. Jatropha curcas................................. 183  5e-50  1 hit   Eukaryota:Streptophyta:Malpighiales:     hypothetical protein JCGZ_26408 [Jatropha curcas]   
. Arabidopsis thaliana............................ 182  1e-49  14 hits Eukaryota:Streptophyta:Brassicales:      glutamate-1-semialdehyde-2,1-aminomutase [Ar...   
. Arabidopsis lyrata subsp. lyrata................ 182  2e-49  4 hits  Eukaryota:Streptophyta:Brassicales:      glutamate-1-semialdehyde-2,1-aminomutase ...   
. Ricinus communis................................ 182  2e-49  2 hits  Eukaryota:Streptophyta:Malpighiales:     glutamate-1-semialdehyde 2,1-aminomutase,...   
. Solanum tuberosum............................... 182  2e-49  1 hit   Eukaryota:Streptophyta:Solanales:        PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Cucumis melo.................................... 181  3e-49  3 hits  Eukaryota:Streptophyta:Cucurbitales:     PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Capsella rubella................................ 181  4e-49  4 hits  Eukaryota:Streptophyta:Brassicales:      hypothetical protein CARUB_v10026335mg [C...   
. Solanum lycopersicum............................ 181  4e-49  3 hits  Eukaryota:Streptophyta:Solanales:        glutamate-1-semialdehyde 2,1-aminomutase,...   
. Brassica napus.................................. 181  5e-49  7 hits  Eukaryota:Streptophyta:Brassicales:      glutamate 1-semialdehyde aminotransf...   
. Vitis vinifera.................................. 180  9e-49  3 hits  Eukaryota:Streptophyta:Vitales:          PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Brassica rapa................................... 179  2e-48  2 hits  Eukaryota:Streptophyta:Brassicales:      PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Medicago truncatula............................. 179  2e-48  4 hits  Eukaryota:Streptophyta:Fabales:          Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chlorella variabilis............................ 178  3e-48  2 hits  Eukaryota:Chlorophyta:Trebouxiophyceae:Chlorellales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Medicago sativa................................. 178  4e-48  1 hit   Eukaryota:Streptophyta:Fabales:          glutamate 1-semialdehyde aminotransferase [Med...   
. Emiliania huxleyi CCMP1516...................... 178  4e-48  2 hits  Eukaryota::Isochrysidales:               glutamate 1-semialdehyde 2,1-aminomutase ...   
. Prunus mume..................................... 178  5e-48  1 hit   Eukaryota:Streptophyta:Rosales:          PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Prunus persica.................................. 178  5e-48  2 hits  Eukaryota:Streptophyta:Rosales:          hypothetical protein PRUPE_ppa005146mg [P...   
. Populus trichocarpa............................. 178  7e-48  2 hits  Eukaryota:Streptophyta:Malpighiales:     glutamate 1-semialdehyde aminotransferase...   
. Fragaria vesca subsp. vesca..................... 177  8e-48  2 hits  Eukaryota:Streptophyta:Rosales:          PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Theobroma cacao................................. 177  1e-47  2 hits  Eukaryota:Streptophyta:Malvales:         Glutamate-1-semialdehyde 2,1-aminomutase ...   
. Phaeodactylum tricornutum CCAP 1055/1........... 177  1e-47  2 hits  Eukaryota:Bacillariophyta:Bacillariophyceae:Naviculales: predicted protein [Phaeodactylum tricornu...   
. Auxenochlorella protothecoides.................. 177  3e-46  1 hit   Eukaryota:Chlorophyta:Trebouxiophyceae:Chlorellales: Glutamate-1-semialdehyde 2,1-aminomutase, chlo...   
. Coffea canephora................................ 176  2e-47  1 hit   Eukaryota:Streptophyta:Gentianales:      unnamed protein product [Coffea canephora]         
. Cucumis sativus................................. 176  3e-47  2 hits  Eukaryota:Streptophyta:Cucurbitales:     PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Brachypodium distachyon......................... 176  4e-47  1 hit   Eukaryota:Streptophyta:Liliopsida:Poales: PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Malus domestica................................. 176  4e-47  3 hits  Eukaryota:Streptophyta:Rosales:          PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Citrus sinensis................................. 174  4e-47  4 hits  Eukaryota:Streptophyta:Sapindales:       hypothetical protein CISIN_1g011856mg [Citrus ...   
. Citrus clementina............................... 174  4e-47  4 hits  Eukaryota:Streptophyta:Sapindales:       hypothetical protein CICLE_v10031414mg [C...   
. Phoenix dactylifera............................. 174  9e-47  3 hits  Eukaryota:Streptophyta:Liliopsida:Arecales: PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Glycine max..................................... 174  1e-46  6 hits  Eukaryota:Streptophyta:Fabales:          unknown [Glycine max]                               
. Nicotiana tabacum............................... 174  1e-46  3 hits  Eukaryota:Streptophyta:Solanales:        RecName: Full=Glutamate-1-semialdehyde ...   
. Selaginella moellendorffii...................... 174  1e-46  4 hits  Eukaryota:Streptophyta:Isoetopsida:Selaginellales: hypothetical protein SELMODRAFT_271939 [S...   
. Phaseolus vulgaris.............................. 174  2e-46  2 hits  Eukaryota:Streptophyta:Fabales:          hypothetical protein PHAVU_009G118500g [P...   
. Oryza sativa Japonica Group..................... 173  3e-46  7 hits  Eukaryota:Streptophyta:Liliopsida:Poales: Os08g0532200 [Oryza sativa Japonica Group]     
. Saccharum hybrid cultivar R570.................. 173  3e-46  3 hits  Eukaryota:Streptophyta:Liliopsida:Poales: glutamate-1-semialdehyde 2,1-aminomutase [Sacc...   
. Aegilops tauschii............................... 173  4e-46  1 hit   Eukaryota:Streptophyta:Liliopsida:Poales: Glutamate-1-semialdehyde 2,1-aminomutase, chlo...   
. Amborella trichopoda............................ 173  5e-46  2 hits  Eukaryota:Streptophyta:Amborellales:     hypothetical protein AMTR_s00016p00208490...   
. Zea mays........................................ 172  6e-46  4 hits  Eukaryota:Streptophyta:Liliopsida:Poales: PREDICTED: uncharacterized protein LOC100...   
. Eucalyptus grandis.............................. 172  6e-46  1 hit   Eukaryota:Streptophyta:Myrtales:         hypothetical protein EUGRSUZ_K00727 [Eucalyptu...   
. Setaria italica................................. 172  7e-46  1 hit   Eukaryota:Streptophyta:Liliopsida:Poales: PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Thalassiosira oceanica.......................... 172  8e-46  1 hit   Eukaryota:Bacillariophyta:Coscinodiscophyceae: hypothetical protein THAOC_09237 [Thalassiosir...   
. Cicer arietinum................................. 172  9e-46  1 hit   Eukaryota:Streptophyta:Fabales:          PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Picea sitchensis................................ 172  1e-45  1 hit   Eukaryota:Streptophyta:Coniferopsida:Coniferales: unknown [Picea sitchensis]                          
. Ostreococcus lucimarinus CCE9901................ 172  1e-45  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: predicted protein [Ostreococcus lucimarin...   
. Paulinella chromatophora........................ 171  2e-45  2 hits  Eukaryota::Euglyphida:                   glutamate-1-semialdehyde aminotransferase...   
. Oryza brachyantha............................... 171  2e-45  1 hit   Eukaryota:Streptophyta:Liliopsida:Poales: PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Hordeum vulgare................................. 171  2e-45  2 hits  Eukaryota:Streptophyta:Liliopsida:Poales: RecName: Full=Glutamate-1-semialdehyde ...   
. Ceratitis capitata.............................. 171  2e-45  1 hit   Eukaryota:Arthropoda:Insecta:Diptera:    PREDICTED: glutamate-1-semialdehyde 2,1-a...   
. Triticum urartu................................. 171  3e-45  1 hit   Eukaryota:Streptophyta:Liliopsida:Poales: Glutamate-1-semialdehyde 2,1-aminomutase, chlo...   
. Micromonas pusilla CCMP1545..................... 170  5e-45  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: glutamate-1-semialdehyde 2,1-aminomutase ...   
. Chlamydomonas reinhardtii....................... 169  8e-45  4 hits  Eukaryota:Chlorophyta:Chlorophyceae:Chlamydomonadales: glutamate-1-semialdehyde aminotransferase...   
. Physcomitrella patens........................... 169  1e-44  2 hits  Eukaryota:Streptophyta:Bryopsida:Funariales: predicted protein [Physcomitrella patens]   

BLAST

PROTOCOLE:


a) Blastp contre NR ORF d'intérêt  direct        site: NCBI    outils: BLASTp contre NR   max target sequences: 10 000


b) Blastp contre SP ORF d'intérêt  direct        site: NCBI    outils: BLASTp contre SP   max target sequences: 5000



Résultats complémentaires pour la recherche d'ORF



C)  Blastp contre NR ORF 1 CADRE 1 indirect      site: NCBI    outils: BLASTp contre NR   max target sequences: 5000


d) Blastp contre NR ORF 1 cadre 2 indirect       site: NCBI    outils: BLASTp contre NR   max target sequences: 5000


e) Blastp contre NR ORF 2 cadre 2 indirect       site: NCBI    outils: BLASTp contre NR   max target sequences: 5000





ANALYSE DES RÉSULTATS:



Résumé Blastp contre NR et SWISSPROT de l'ORF d'intérêt (ORF 1 cadre 3 du brin direct) :


__________________________________________________

      |  nombre de  | e-value | e-value | e-value |

      |  résultats  |   min   |   max   |  seuil  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

      |    > 5 000  |   0.0   |  5e-45  | > 5E-45 |

  NR  |_____________|_________|_________|_________|

      |             |         |         |         |

      |   > 10 000  |   0.0   |  9E-27  |     -   |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  SP  |     919     | 2E-142  |   7.3   |   0.5   |

______|_____________|_________|_________|_________|



Synthèse du Blastp contre NR de l'ORF d'intérêt :


   ___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • aminotransferase                                                    |    0.0      |   5e-45     |

  | • aminomutase                                                         |    0.0      |   5e-45     |

  | • glutamate semialdehyde synthase                                     |    2e-57    |   2e-57     |

  | • potassium transporter Trk                                           |    1e-49    |   1e-49     |

  |_______________________________________________________________________|_____________|_____________|

  


Synthèse du Blastp contre SP de l'ORF d'intérêt :


   ___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • aminotransferase                                                    |    2e-142   |   0.48      |

  | • décarboxylase                                                       |    2e-21    |   0.56      |

  | • transaminase                                                        |    5e-20    |   7e-11     |

  | • Racemase                                                            |    7e-05    |   7e-05     |

  | • complement C1r subcomponent                                         |    1.6      |   6.0       |

  | • 30S ribosomal protein S5                                            |    4.2      |   4.4       |

  | • Synthetase                                                          |    4.7      |   7.3       |

  | • Transcription factor                                                |    5.5      |   5.5       |

  | • disease resistance protein RPS2                                     |    6.1      |   6.1       |

  |_______________________________________________________________________|_____________|_____________|

  


Nous obtenons plus de 5000 résultats d'homologues potentiels ou du moins de protéines similaires à notre ORF lors de l'analyse de ce dernier par Blast contre la banque de données NR. Les e-values sont très significatives et s'étendent de 0.0 à 5e-45 (scores : 566 à 169) lorsque la limite est posée à 5000 séquences. Nous avons donc réalisé un Blasp toujours contre la banque de données NR qui nous à retourné 10 000 résultats, dans ce cas, les e-value s'étendent de 0.0 à 9e-27. Ces résultats nous confortent dans l'idée que notre ORF est bien codant pour une protéine ou du moins une partie de protéine car notre ORF est incomplet en 5' et 3' comme nous l'avons dit précédemment.


Pour la suite de notre analyse nous nous concentrons sur le Blast limité à 5000 séquences comme il nous l'a été demandé.


Dans la liste de résultats du Blastp contre la banque de données NR nous observons de nombreuses aminotransferases, aminomutases et transaminases dont les e-values s'étendent de 0.0 à 5e-45. Les homologues dont la e-valeur est de 0.0 présentent des scores très élevés, 566 à 528, ce qui nous montre que les alignement sont de bonne qualité. D'après nos recherches ces trois noms d'enzymes sont des synonymes. Ces enzymes sont toutes des transférases de groupement amines. Elles exercent toutes la même fonction de transfert de groupement amines.


Les dix premiers alignements du Blastp contre la banque de données NR avec comme séquence requête l'ORF 1 cadre 3 du brin direct (ORF choisi) nous montrent 91 à 100 % de recouvrement ce qui signifie que l'alignement entre la séquence requête et la séquence sujet s'est fait sur 287 à 316 acides aminés de la séquence requêtes dont la longueur est de 316 acides aminés. Sur ces acides aminés, il y a environ 78 à 90% d'identité c'est-à-dire que les acides aminés sont identiques entre les séquences alignées. Et 89 à 95% des acides aminés alignés sont positifs c'est-à-dire qu'ils sont identiques ou que ce sont des substitutions conservatives. Pour finir, ces alignements présentent un faible taux de gap (0%). Ces résultats sont très significatif et nous montre qu'il y a une homologie.


Nous observons également une synthase dont la e-value est de 2e-57 et un transporteur de potassium dont la e-value est de 1e-49. Après nos recherches nous pouvons dire que la synthase a une activité aminomutase et transaminase. Ce qui concorde avec les résultats INTERPRO  qui nous indiquent que la protéine codée par notre ORF possède un domaine aminotransferase class III.  En revanche, le transporteur potassium exerce une fonction différente. Cette séquence est peut-être mal annotée mais nous ne pouvons l'exclure car elle présente une bonne e-value ce qui nous indique que cela reste un très bon homologue.


Lorsque nous analysons le transporteur de potassium, nous observons 93% de recouvrement ce qui signifie que l'alignement entre la séquence protéique de notre ORF et celle du transporteur de potassium s'est fait sur 294 acides aminés de la séquence requêtes dont la longueur est de 316 acides aminés. Sur ces 294 acides aminés couverts par l'alignement, 36% sont des identités c'est-à-dire que les acides aminés sont identiques entre les séquences alignées. Et 54% des acides aminés alignés sont positifs c'est-à-dire qu'ils sont identiques ou des substitutions conservatives. Nous pouvons également remarquer que l'alignement du transporteur avec la séquence protéique requête présente un taux de gaps faible (3%).


Toutes ces valeurs sont significatives et nous indiquent que l'on a une homologie vraisemblable. Nous ne pouvons donc pas éliminer cette protéine en plaçant notre seuil de e-value juste en dessous de sa e-value autrement nous risquerions de perdre des homologues. Nous pouvons cependant penser que cette protéine résulte d'une mauvaise annotation.


Les fonctions des protéines homologues retournées par Blastp contre la banque de données NR tronqué à 5000 sont homogènes sauf la protéine décrite précédemment que nous ne pouvons exclure. Il est très probable qu'il reste énormément de hit au-delà des 5000 premiers du blastp contre la banque de donnée NR. Notre seuil est donc supérieur à 5e-45 car nous n'avons aucune idée d'où se situe exactement le seuil. De plus, faire l'analyse du Blastp contre NR tronqué à 10 000 est un travail long pour le temps qu'il nous impartit sachant que nous obtenons 10 000 résultats et que la dernière e-value est à 9e-27 (même problème) c'est pourquoi nous nous concentrons sur le Blastp contre NR tronqué à 5 000.




Pour ce qui est du Blastp contre SP nous avons obtenu 919 résultats. Les e-value s'étendent de 2e-142 à 7.3.


Nous avons remarqué la présence de racemase 7e-05, or après recherches nous pouvons dire que cette enzyme fait partie de la famille des aminotransférases de classe III ce qui correspond à notre hypothèse concernant la protéine codée par notre ORF.  De plus, nous n'observons pas de rupture de e-value donc nous ne plaçons pas notre seuil ici.


Nous observons une décarboxylase qui ne fait cependant pas apparaître clairement une rupture de e-value et est entourée de transférases. Sa e-value est de 2e-21. Le pourcentage de recouvrement de 96% nous indique que 302 acides aminés de la séquence protéique de notre ORF sont alignés à la séquence protéique de la décarboxylase. De plus, nous observons 26% d'identités et 41% de positifs ces valeurs sont acceptables et nous indiquent que les acides aminés sont plutôt conservés. Nous observons également 13% d'indel ce qui est plutôt faible. Nous pouvons penser qu'il y a eu une erreur d'annotation.


De plus, nous observons l'apparition de fonctions totalement différentes des transférases à partir d'une e-value à 0.56 dont une décarboxylase et des protéines ribosomales et nous n'observons plus d'aminotransférases au-delà de 0.48.


Nous plaçons donc le seuil de e-value à 0.5 en ce qui concerne le blastp contre SP.



Nous ne pouvons pas déterminer le symbole du gène codant la protéine car il diffère d'un alignement à l'autre (CENSYa_1168, Msed_0216, TVN0635...).


Au vu des résultats observés dans les deux blasts, nous pouvons supposer que la protéine codée par notre ORF serait une transférase de type aminotransférase. Cette hypothèse est confortée par les résultats retournés par INTERPRO. Ces transférases sont impliquées dans le transfert de groupement amines.


RÉSULTATS BRUTS:
a) Blastp contre NR ORF d'intérêt tronqué à 10 000 résultats (brin direct ORF 1 cadre 3)

                                                                                              Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|ACF09459.1|  glutamate-1-semialdehyde aminotransferase [unc...    566   0.0   
gb|ACF09594.1|  glutamate-1-semialdehyde aminotransferase [unc...    563   0.0   
gb|KFM20780.1|  Glutamate-1-semialdehyde 21-aminomutase 2 prot...    563   0.0   
gb|ACF09517.1|  glutamate-1-semialdehyde aminotransferase [unc...    561   0.0   
gb|ACF09695.1|  glutamate-1-semialdehyde aminotransferase [unc...    561   0.0   
gb|AIF19753.1|  class III aminotransferase (hemL) [uncultured ...    553   0.0   
gb|AIE95560.1|  class III aminotransferase (hemL) [uncultured ...    546   0.0   
gb|ACF09988.1|  glutamate-1-semialdehyde aminotransferase [unc...    545   0.0   
gb|ABZ07951.1|  putative aminotransferase class-III [unculture...    535   0.0   
ref|WP_027327939.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    531   0.0   
gb|ACF09654.1|  glutamate-1-semialdehyde aminotransferase [unc...    531   0.0   
gb|ACF09719.1|  glutamate-1-semialdehyde aminotransferase [unc...    529   0.0   
gb|AAR24494.1|  glutamate-1-semialdehyde aminotransferase [unc...    528   0.0   
gb|ACF09824.1|  glutamate-1-semialdehyde aminotransferase [unc...    515   2e-179
gb|AAA93183.2|  glutamate-1-semialdehyde aminotransferase [unc...    490   1e-169
emb|CDI05787.1|  Glutamate-1-semialdehyde 2,1-aminomutase 2 [T...    477   2e-164
gb|AIF21231.1|  class III aminotransferase (hemL) [uncultured ...    473   3e-164
gb|AFD03291.1|  glutamate-1-semialdehyde aminotransferase [unc...    474   3e-163
ref|WP_014965329.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    466   3e-160
ref|WP_016940294.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    466   3e-160
ref|WP_014963402.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    464   1e-159
ref|WP_008299333.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    457   2e-156
gb|KFM19499.1|  Glutamate-1-semialdehyde 21-aminomutase 2 prot...    457   2e-156
ref|WP_007550800.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    455   8e-156
ref|WP_012215400.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    453   4e-155
gb|KEQ56654.1|  Glutamate-1-semialdehyde 21-aminomutase 2 prot...    451   2e-154
ref|WP_010193267.1|  class III aminotransferase [Candidatus Ni...    443   1e-152
ref|WP_013482419.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    416   2e-140
gb|AAK96083.1|AF393466_20  glutamate-1-semialdehyde aminotrans...    410   3e-139
ref|WP_007401836.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    407   1e-137
gb|AAC62704.1|  glutamate-1-semialdehyde aminotransferase [Cen...    408   2e-137
gb|AIE90778.1|  class III aminotransferase (hemL) [uncultured ...    390   9e-132
dbj|BAL60309.1|  glutamate-1-semialdehyde 2,1-aminomutase [unc...    350   2e-114
dbj|BAE03245.1|  glutamate-1-semialdehyde 2,1-aminomutase [unc...    349   4e-114
ref|WP_015018762.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    345   1e-112
gb|KFM15147.1|  Glutamate-1-semialdehyde 21-aminomutase 2 prot...    337   4e-112
gb|AFK24816.1|  putative glutamate-1-semialdehyde aminotransfe...    343   6e-112
gb|AIF83514.1|  glutamate-1-semialdehyde aminotransferase [Can...    343   6e-112
gb|AIC14320.1|  glutamate-1-semialdehyde 2,1-aminomutase [Nitr...    343   8e-112
gb|AAK76999.1|AF393307_1  glutamate semialdehyde aminotransfer...    315   2e-104
gb|AAK76998.1|AF393306_1  glutamate semialdehyde aminotransfer...    315   3e-104
gb|AAK76997.1|AF393304_1  glutamate semialdehyde aminotransfer...    307   3e-101
ref|WP_018194259.1|  MULTISPECIES: hypothetical protein [candi...    283   1e-88 
ref|WP_029734085.1|  hypothetical protein [Deferrisoma camini]       272   5e-84 
ref|WP_013451661.1|  aminotransferase class-iii [Calditerrivib...    254   3e-77 
ref|WP_013012048.1|  class III aminotransferase [Denitrovibrio...    244   1e-73 
ref|WP_013738456.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    236   1e-70 
ref|WP_013304147.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    235   9e-70 
ref|WP_013193720.1|  glutamate-1-semialdehyde aminotransferase...    233   3e-69 
gb|AGF93249.1|  glutamate-1-semialdehyde-2,1-aminomutase [uncu...    230   2e-68 
ref|WP_009073246.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    230   3e-68 
ref|WP_004030955.1|  glutamate-1-semialdehyde aminotransferase...    228   2e-67 
ref|WP_008516977.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    228   3e-67 
ref|WP_011921361.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    226   6e-67 
ref|WP_012185352.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    227   1e-66 
ref|WP_020864473.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    225   3e-66 
gb|EWG07375.1|  glutamate-1-semialdehyde aminotransferase [Sul...    225   3e-66 
ref|WP_013825021.1|  glutamate-1-semialdehyde aminotransferase...    224   5e-66 
ref|WP_010916893.1|  glutamate-1-semialdehyde aminotransferase...    223   1e-65 
dbj|BAJ49613.1|  glutamate-1-semialdehyde-2,1-aminomutase [Can...    223   1e-65 
ref|WP_013604201.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    222   9e-65 
ref|WP_013180847.1|  glutamate-1-semialdehyde aminotransferase...    220   2e-64 
ref|WP_015760934.1|  glutamate-1-semialdehyde aminotransferase...    220   4e-64 
gb|KGI71424.1|  glutamate-1-semialdehyde-2,1-aminomutase [Egge...    219   9e-64 
ref|WP_011973917.1|  glutamate-1-semialdehyde aminotransferase...    219   9e-64 
gb|EZQ03800.1|  glutamate-1-semialdehyde aminotransferase [Can...    218   1e-63 
ref|WP_013337530.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    218   2e-63 
ref|WP_020449546.1|  glutamate-1-semialdehyde aminotransferase...    217   2e-63 
ref|WP_023425475.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    217   3e-63 
ref|WP_011033683.1|  glutamate-1-semialdehyde aminotransferase...    217   3e-63 
ref|WP_013267121.1|  glutamate-1-semialdehyde aminotransferase...    217   4e-63 
ref|WP_023424189.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    216   4e-63 
ref|WP_012711924.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    216   5e-63 
ref|WP_015412060.1|  Glutamate-1-semialdehyde aminotransferase...    216   7e-63 
ref|WP_012714102.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    216   8e-63 
emb|CBH36690.1|  glutamate-1-semialdehyde 2,1-aminomutase [unc...    215   1e-62 
ref|WP_023429768.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    215   1e-62 
ref|WP_013645701.1|  glutamate-1-semialdehyde aminotransferase...    215   2e-62 
ref|WP_009887200.1|  glutamate-1-semialdehyde aminotransferase...    214   5e-62 
ref|WP_016358282.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    214   6e-62 
ref|WP_013775425.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    213   9e-62 
ref|WP_011954373.1|  glutamate-1-semialdehyde aminotransferase...    213   1e-61 
ref|WP_023427623.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    213   1e-61 
ref|WP_014353876.1|  glutamate-1-semialdehyde aminotransferase...    213   1e-61 
ref|WP_013898772.1|  glutamate-1-semialdehyde aminotransferase...    213   1e-61 
ref|WP_015791927.1|  glutamate-1-semialdehyde aminotransferase...    213   2e-61 
ref|WP_013100738.1|  glutamate-1-semialdehyde aminotransferase...    213   2e-61 
sp|Q976H2.3|GSA_SULTO  RecName: Full=Glutamate-1-semialdehyde ...    212   2e-61 
ref|WP_012955800.1|  glutamate-1-semialdehyde aminotransferase...    212   2e-61 
ref|WP_011020630.1|  glutamate-1-semialdehyde aminotransferase...    212   3e-61 
ref|WP_014511502.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    212   3e-61 
ref|WP_009990416.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    212   3e-61 
ref|WP_015232774.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    211   3e-61 
ref|WP_022531844.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    211   4e-61 
ref|WP_004032692.1|  glutamate-1-semialdehyde aminotransferase...    211   4e-61 
emb|CEE14039.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Leg...    211   5e-61 
ref|WP_004036100.1|  glutamate-1-semialdehyde aminotransferase...    211   5e-61 
ref|WP_019265122.1|  glutamate-1-semialdehyde aminotransferase...    211   5e-61 
ref|WP_011696302.1|  glutamate-1-semialdehyde aminotransferase...    211   8e-61 
ref|WP_011170168.1|  glutamate-1-semialdehyde aminotransferase...    211   9e-61 
gb|KCZ72555.1|  glutamate-1-semialdehyde 2,1-aminomutase [Cand...    210   1e-60 
gb|AIS32442.1|  glutamate-1-semialdehyde-2,1-aminomutase HemL ...    210   1e-60 
emb|CDZ80543.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Chl...    210   1e-60 
ref|WP_019266835.1|  glutamate-1-semialdehyde aminotransferase...    210   2e-60 
ref|WP_023844443.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    210   2e-60 
gb|KGK97966.1|  glutamate-1-semialdehyde aminotransferase [Met...    209   2e-60 
gb|ETR72812.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Cand...    208   2e-60 
ref|WP_023991748.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    209   3e-60 
emb|CEA14701.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Met...    209   3e-60 
ref|WP_019262685.1|  glutamate-1-semialdehyde aminotransferase...    209   3e-60 
ref|WP_013799245.1|  glutamate-1-semialdehyde aminotransferase...    209   4e-60 
ref|WP_012981160.1|  glutamate-1-semialdehyde aminotransferase...    209   4e-60 
ref|WP_014041652.1|  glutamate-1-semialdehyde aminotransferase...    209   5e-60 
ref|WP_011306467.1|  glutamate-1-semialdehyde aminotransferase...    209   5e-60 
ref|WP_013998672.1|  glutamate-1-semialdehyde aminotransferase...    209   5e-60 
ref|WP_015732945.1|  glutamate-1-semialdehyde aminotransferase...    208   6e-60 
ref|WP_013413670.1|  glutamate-1-semialdehyde aminotransferase...    208   6e-60 
ref|WP_005536882.1|  glutamate-1-semialdehyde aminotransferase...    209   6e-60 
ref|WP_018154118.1|  glutamate-1-semialdehyde aminotransferase...    208   8e-60 
dbj|BAP60347.1|  glutamate-1-semialdehyde 2,1-aminomutase [Met...    208   1e-59 
ref|WP_004517656.1|  glutamate-1-semialdehyde aminotransferase...    208   1e-59 
sp|Q58020.2|GSA_METJA  RecName: Full=Glutamate-1-semialdehyde ...    207   1e-59 
ref|WP_010870107.1|  glutamate-1-semialdehyde aminotransferase...    207   1e-59 
ref|WP_013866989.1|  glutamate-1-semialdehyde aminotransferase...    207   1e-59 
ref|WP_013037900.1|  glutamate-1-semialdehyde aminotransferase...    207   2e-59 
ref|WP_004959755.1|  glutamate-1-semialdehyde aminotransferase...    207   2e-59 
ref|WP_021786245.1|  hypothetical protein [Ferroplasma sp. Typ...    207   2e-59 
ref|WP_007044152.1|  glutamate-1-semialdehyde aminotransferase...    207   2e-59 
ref|WP_013718726.1|  glutamate-1-semialdehyde aminotransferase...    207   2e-59 
dbj|BAM69439.1|  glutamate-1-semialdehyde aminotransferase [Me...    206   3e-59 
gb|AAB98593.1|  glutamate-1-semialdehyde aminotransferase (hem...    207   3e-59 
ref|WP_008419055.1|  glutamate-1-semialdehyde aminotransferase...    207   3e-59 
gb|ETX09144.1|  hypothetical protein ETSY2_01215 [Candidatus E...    207   3e-59 
ref|WP_008307246.1|  glutamate-1-semialdehyde aminotransferase...    207   3e-59 
gb|AIJ05673.1|  glutamate-1-semialdehyde-2,1-aminomutase [Meth...    206   4e-59 
ref|WP_012193583.1|  glutamate-1-semialdehyde aminotransferase...    206   4e-59 
ref|WP_007189527.1|  MULTISPECIES: glutamate-1-semialdehyde am...    207   4e-59 
gb|EJP71450.1|  glutamate-1-semialdehyde-2,1-aminomutase [SAR8...    206   4e-59 
ref|WP_011822006.1|  glutamate-1-semialdehyde aminotransferase...    206   5e-59 
ref|WP_013295496.1|  glutamate-1-semialdehyde aminotransferase...    206   5e-59 
ref|WP_013683205.1|  glutamate-1-semialdehyde aminotransferase...    206   8e-59 
ref|WP_004590403.1|  glutamate-1-semialdehyde aminotransferase...    206   1e-58 
ref|WP_006092586.1|  glutamate-1-semialdehyde aminotransferase...    206   1e-58 
ref|WP_011069877.1|  glutamate-1-semialdehyde aminotransferase...    205   1e-58 
gb|AAU82177.1|  glutamate-1-semialdehyde 21-aminomutase [uncul...    205   1e-58 
ref|WP_006432123.1|  glutamate-1-semialdehyde aminotransferase...    205   2e-58 
ref|WP_011406760.1|  glutamate-1-semialdehyde aminotransferase...    204   2e-58 
ref|WP_018257056.1|  glutamate-1-semialdehyde aminotransferase...    205   2e-58 
ref|WP_011499295.1|  glutamate-1-semialdehyde aminotransferase...    204   2e-58 
ref|WP_006672948.1|  glutamate-1-semialdehyde aminotransferase...    205   2e-58 
ref|WP_015761890.1|  glutamate-1-semialdehyde aminotransferase...    204   3e-58 
gb|KFF35719.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    204   3e-58 
ref|WP_031635767.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    204   3e-58 
ref|WP_006569199.1|  MULTISPECIES: glutamate-1-semialdehyde am...    204   3e-58 
ref|WP_023503696.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    204   4e-58 
ref|WP_014062281.1|  glutamate-1-semialdehyde aminotransferase...    204   4e-58 
ref|WP_011277654.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    203   4e-58 
ref|WP_015323114.1|  glutamate-1-semialdehyde aminotransferase...    204   4e-58 
ref|WP_005578947.1|  glutamate-1-semialdehyde aminotransferase...    203   5e-58 
ref|WP_011977597.1|  glutamate-1-semialdehyde aminotransferase...    203   5e-58 
ref|WP_011822572.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    204   5e-58 
ref|WP_021060075.1|  glutamate-1-semialdehyde aminotransferase...    203   8e-58 
ref|WP_011235472.1|  glutamate-1-semialdehyde aminotransferase...    203   8e-58 
ref|WP_010875867.1|  glutamate-1-semialdehyde aminotransferase...    202   8e-58 
ref|WP_013298073.1|  glutamate-1-semialdehyde aminotransferase...    203   9e-58 
ref|WP_011564937.1|  glutamate-1-semialdehyde aminotransferase...    203   9e-58 
ref|WP_015311778.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    203   9e-58 
ref|WP_013879045.1|  glutamate-1-semialdehyde aminotransferase...    202   9e-58 
ref|WP_006629068.1|  glutamate-1-semialdehyde aminotransferase...    203   1e-57 
ref|WP_013985161.1|  glutamate-1-semialdehyde aminotransferase...    202   1e-57 
ref|WP_011869215.1|  glutamate-1-semialdehyde aminotransferase...    202   1e-57 
ref|WP_003870857.1|  glutamate-1-semialdehyde aminotransferase...    202   1e-57 
gb|AHY47036.1|  hemL: glutamate-1-semialdehyde-2,1-aminomutase...    202   1e-57 
ref|WP_008652699.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    202   1e-57 
ref|WP_024083378.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    202   2e-57 
ref|WP_015302230.1|  glutamate-1-semialdehyde aminotransferase...    202   2e-57 
ref|WP_017980986.1|  glutamate-1-semialdehyde aminotransferase...    202   2e-57 
gb|ACF28631.1|  glutamate semialdehyde synthase [Amphidinium c...    202   2e-57 
ref|WP_013337133.1|  glutamate-1-semialdehyde aminotransferase...    202   2e-57 
ref|WP_031314338.1|  glutamate-1-semialdehyde aminotransferase...    202   2e-57 
ref|WP_008672102.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    202   2e-57 
ref|WP_012994510.1|  glutamate-1-semialdehyde aminotransferase...    202   3e-57 
ref|WP_012186457.1|  glutamate-1-semialdehyde aminotransferase...    201   3e-57 
ref|WP_006184915.1|  glutamate-1-semialdehyde aminotransferase...    202   3e-57 
ref|WP_014758524.1|  glutamate-1-semialdehyde aminotransferase...    201   3e-57 
ref|WP_012074441.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    201   3e-57 
ref|WP_007331929.1|  glutamate-1-semialdehyde aminotransferase...    201   4e-57 
ref|WP_028840984.1|  glutamate-1-semialdehyde aminotransferase...    201   4e-57 
ref|WP_013603819.1|  glutamate-1-semialdehyde aminotransferase...    201   4e-57 
ref|WP_015789709.1|  glutamate-1-semialdehyde aminotransferase...    201   4e-57 
ref|WP_003132522.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    201   4e-57 
ref|WP_007700890.1|  glutamate-1-semialdehyde aminotransferase...    201   4e-57 
ref|WP_009367098.1|  glutamate-1-semialdehyde aminotransferase...    201   4e-57 
ref|WP_031800083.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    201   5e-57 
gb|ERM90797.1|  glutamate-1-semialdehyde aminotransferase [Cal...    201   5e-57 
ref|WP_013536305.1|  glutamate-1-semialdehyde aminotransferase...    201   5e-57 
ref|WP_020031836.1|  hypothetical protein [gamma proteobacteri...    201   5e-57 
gb|ETW97388.1|  hypothetical protein ETSY1_22790 [Candidatus E...    201   5e-57 
ref|WP_014404932.1|  glutamate-1-semialdehyde aminotransferase...    201   6e-57 
ref|WP_006066081.1|  glutamate-1-semialdehyde aminotransferase...    201   6e-57 
ref|WP_024867673.1|  glutamate-1-semialdehyde aminotransferase...    201   6e-57 
ref|WP_010653650.1|  glutamate-1-semialdehyde aminotransferase...    201   6e-57 
emb|CAA57575.1|  glutamate 1-semialdehyde 2,1-aminomutase [Pse...    201   6e-57 
ref|WP_007327930.1|  glutamate-1-semialdehyde aminotransferase...    201   6e-57 
gb|AHL76991.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    201   7e-57 
ref|WP_026961141.1|  glutamate-1-semialdehyde aminotransferase...    201   7e-57 
ref|WP_009313381.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   8e-57 
ref|WP_021794920.1|  hypothetical protein [Thermoplasmatales a...    200   8e-57 
ref|WP_006648378.1|  glutamate-1-semialdehyde aminotransferase...    201   8e-57 
ref|WP_028920068.1|  glutamate-1-semialdehyde aminotransferase...    200   8e-57 
ref|WP_025271288.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   8e-57 
ref|WP_017148450.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   8e-57 
ref|WP_003093150.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    200   8e-57 
ref|WP_008421046.1|  glutamate-1-semialdehyde aminotransferase...    201   8e-57 
ref|WP_016263116.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   8e-57 
ref|WP_027385807.1|  glutamate-1-semialdehyde aminotransferase...    200   9e-57 
ref|WP_017001372.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   9e-57 
ref|WP_003100333.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   9e-57 
ref|WP_006871815.1|  glutamate-1-semialdehyde aminotransferase...    200   9e-57 
ref|WP_023104641.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   9e-57 
ref|WP_007110126.1|  glutamate-1-semialdehyde aminotransferase...    201   9e-57 
ref|WP_031768522.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   9e-57 
ref|WP_027221721.1|  glutamate-1-semialdehyde aminotransferase...    200   9e-57 
ref|WP_031690060.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   1e-56 
ref|WP_014127439.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_006183013.1|  glutamate-1-semialdehyde aminotransferase...    201   1e-56 
emb|CDK41129.1|  glutamate-1-semialdehyde 2,1-aminomutase [Hal...    200   1e-56 
ref|WP_012341659.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_012874242.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_024915636.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   1e-56 
ref|WP_013810236.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_029420090.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_014862810.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_028380621.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_011609384.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_008013677.1|  glutamate-1-semialdehyde aminotransferase...    200   1e-56 
ref|WP_015324232.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    199   1e-56 
ref|WP_023497358.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    200   1e-56 
ref|WP_024085038.1|  glutamate-1-semialdehyde aminotransferase...    199   2e-56 
ref|WP_003541142.1|  glutamate-1-semialdehyde aminotransferase...    199   2e-56 
gb|KEI35688.1|  glutamate-1-semialdehyde aminotransferase [Fra...    199   2e-56 
ref|WP_007141165.1|  glutamate-1-semialdehyde aminotransferase...    200   2e-56 
ref|WP_029688775.1|  glutamate-1-semialdehyde aminotransferase...    200   2e-56 
gb|AIH03430.1|  glutamate-1-semialdehyde aminotransferase [The...    199   2e-56 
ref|WP_028302921.1|  glutamate-1-semialdehyde aminotransferase...    199   2e-56 
ref|WP_008585288.1|  glutamate-1-semialdehyde aminotransferase...    200   2e-56 
ref|WP_027227033.1|  glutamate-1-semialdehyde aminotransferase...    199   2e-56 
ref|WP_008525982.1|  glutamate-1-semialdehyde aminotransferase...    200   2e-56 
ref|WP_026365032.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    199   2e-56 
ref|WP_007336369.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    198   2e-56 
ref|WP_016211033.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    199   2e-56 
ref|WP_028991557.1|  glutamate-1-semialdehyde aminotransferase...    199   2e-56 
ref|WP_004047522.1|  glutamate-1-semialdehyde aminotransferase...    199   2e-56 
ref|WP_023657036.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    200   3e-56 
ref|WP_013149818.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
ref|WP_019486578.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    199   3e-56 
ref|WP_008161184.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
ref|WP_007408567.1|  MULTISPECIES: glutamate-1-semialdehyde am...    199   3e-56 
ref|WP_028770499.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
ref|WP_032872421.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
gb|AHZ14851.1|  glutamate-1-semialdehyde aminotransferase [Bac...    199   3e-56 
ref|WP_024695645.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    199   3e-56 
ref|WP_003155467.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
ref|WP_015388520.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
ref|WP_028915107.1|  glutamate-1-semialdehyde aminotransferase...    199   3e-56 
dbj|BAP43298.1|  glutamate-1-semialdehyde aminotransferase [Ps...    199   3e-56 
ref|WP_029981017.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    199   3e-56 
gb|EZQ19134.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    199   3e-56 
gb|AIC17053.1|  glutamate-1-semialdehyde 2,1-aminomutase [Nitr...    199   3e-56 
ref|WP_009730887.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    199   3e-56 
ref|WP_015054398.1|  glutamate-1-semialdehyde aminotransferase...    198   3e-56 
ref|WP_017476237.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    199   4e-56 
gb|ERH12488.1|  glutamate-1-semialdehyde aminotransferase [hal...    201   4e-56 
ref|WP_007259424.1|  glutamate-1-semialdehyde aminotransferase...    198   4e-56 
ref|WP_023518003.1|  Glutamate-1-semialdehyde aminotransferase...    198   4e-56 
ref|WP_022855663.1|  glutamate-1-semialdehyde aminotransferase...    198   4e-56 
ref|WP_029610689.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   4e-56 
ref|WP_017521797.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   4e-56 
ref|WP_015778778.1|  glutamate-1-semialdehyde aminotransferase...    198   4e-56 
ref|WP_015897175.1|  glutamate-1-semialdehyde aminotransferase...    198   4e-56 
emb|CEA02044.1|  glutamate-1-semialdehyde aminotransferase [Ps...    198   4e-56 
ref|WP_033054177.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   5e-56 
ref|WP_026445871.1|  glutamate-1-semialdehyde aminotransferase...    199   5e-56 
ref|WP_014289324.1|  glutamate-1-semialdehyde aminotransferase...    198   5e-56 
ref|WP_003006970.1|  MULTISPECIES: glutamate-1-semialdehyde am...    198   5e-56 
ref|WP_010903735.1|  glutamate-1-semialdehyde aminotransferase...    199   5e-56 
ref|WP_026960886.1|  glutamate-1-semialdehyde aminotransferase...    198   5e-56 
emb|CEA03990.1|  Glutamate-1-semialdehyde 2,1-aminomutase 2 [J...    198   5e-56 
ref|WP_011213816.1|  glutamate-1-semialdehyde aminotransferase...    198   5e-56 
ref|WP_023023456.1|  glutamate-1-semialdehyde aminotransferase...    197   5e-56 
ref|WP_028917880.1|  glutamate-1-semialdehyde aminotransferase...    198   5e-56 
ref|WP_010866923.1|  glutamate-1-semialdehyde aminotransferase...    198   5e-56 
ref|WP_021210206.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   5e-56 
ref|WP_022552793.1|  glutamate-1-semialdehyde aminotransferase...    198   5e-56 
gb|AIT08746.1|  glutamate-1-semialdehyde aminotransferase [Fra...    198   6e-56 
gb|EWH08462.1|  glutamate-1-semialdehyde aminotransferase [Cat...    198   6e-56 
ref|WP_013277537.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
pdb|2EPJ|A  Chain A, Crystal Structure Of Glutamate-1-Semialde...    198   6e-56 
ref|WP_013662307.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   6e-56 
ref|WP_011322350.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
gb|KDN57044.1|  glutamate-1-semialdehyde aminotransferase [Exi...    198   6e-56 
ref|WP_026826509.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
ref|WP_008005761.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
ref|WP_028389498.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
ref|WP_029294957.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
ref|WP_019398859.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
ref|WP_027070114.1|  glutamate-1-semialdehyde aminotransferase...    198   6e-56 
gb|AHF69607.1|  glutamate-1-semialdehyde aminotransferase [Pse...    198   7e-56 
gb|EES53349.1|  glutamate-1-semialdehyde-2,1-aminomutase [Lept...    198   7e-56 
ref|WP_025167601.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   7e-56 
gb|AIF83087.1|  glutamate-1-semialdehyde aminotransferase [Can...    198   7e-56 
sp|Q9HKM6.2|GSA_THEAC  RecName: Full=Glutamate-1-semialdehyde ...    197   7e-56 
ref|WP_029244273.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   7e-56 
ref|WP_004599340.1|  glutamate-1-semialdehyde aminotransferase...    198   7e-56 
ref|WP_025994148.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   7e-56 
ref|WP_031565845.1|  glutamate-1-semialdehyde aminotransferase...    198   7e-56 
ref|WP_015722617.1|  glutamate-1-semialdehyde aminotransferase...    197   7e-56 
ref|WP_017675488.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   8e-56 
ref|WP_024369841.1|  glutamate-1-semialdehyde aminotransferase...    198   8e-56 
ref|WP_011941019.1|  glutamate-1-semialdehyde aminotransferase...    197   9e-56 
ref|WP_010562481.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   9e-56 
ref|WP_014843855.1|  glutamate-1-semialdehyde aminotransferase...    197   9e-56 
ref|WP_014841661.1|  glutamate-1-semialdehyde aminotransferase...    197   9e-56 
ref|WP_013351500.1|  glutamate-1-semialdehyde aminotransferase...    197   9e-56 
ref|WP_007982233.1|  glutamate-1-semialdehyde aminotransferase...    198   1e-55 
ref|WP_006882576.1|  glutamate-1-semialdehyde aminotransferase...    198   1e-55 
dbj|BAP32880.1|  glutamate-1-semialdehyde 2,1-aminomutase [Chr...    197   1e-55 
ref|WP_029375730.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   1e-55 
ref|WP_010900996.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_021790108.1|  hypothetical protein [Thermoplasmatales a...    197   1e-55 
gb|KDE61945.1|  glutamate-1-semialdehyde aminotransferase [Fus...    197   1e-55 
ref|WP_019176690.1|  hypothetical protein [Methanomassiliicocc...    197   1e-55 
ref|WP_027220098.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_026319870.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    198   1e-55 
gb|AIS51542.1|  glutamate-1-semialdehyde 2,1-aminomutase HemL ...    197   1e-55 
ref|WP_004051123.1|  glutamate-1-semialdehyde aminotransferase...    198   1e-55 
ref|WP_011946535.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_025949127.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_012066049.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_016955250.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_005040292.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_022542178.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_027265244.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_021041336.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_028379059.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_004885052.1|  glutamate-1-semialdehyde aminotransferase...    197   1e-55 
ref|WP_004424762.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   1e-55 
ref|WP_005554949.1|  glutamate-1-semialdehyde aminotransferase...    197   2e-55 
gb|ADI18862.1|  glutamate-1-semialdehyde aminotransferase [unc...    197   2e-55 
ref|WP_008386545.1|  glutamate-1-semialdehyde aminotransferase...    197   2e-55 
ref|WP_016482156.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   2e-55 
ref|WP_007345609.1|  MULTISPECIES: glutamate-1-semialdehyde am...    197   2e-55 
ref|WP_011339935.1|  glutamate-1-semialdehyde aminotransferase...    197   2e-55 
ref|WP_011215539.1|  glutamate-1-semialdehyde aminotransferase...    197   2e-55 
ref|WP_017136069.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   2e-55 
gb|AGG17612.1|  glutamate-1-semialdehyde aminotransferase [Pis...    197   2e-55 
ref|WP_024688007.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   2e-55 
ref|WP_008374701.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    197   2e-55 
ref|WP_014720064.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   2e-55 
ref|WP_027338865.1|  glutamate-1-semialdehyde aminotransferase...    197   2e-55 
ref|WP_012269639.1|  MULTISPECIES: potassium transporter Trk [...    201   2e-55 
ref|WP_031421390.1|  glutamate-1-semialdehyde aminotransferase...    197   2e-55 
ref|WP_014389227.1|  glutamate-1-semialdehyde aminotransferase...    196   2e-55 
ref|WP_009811150.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   2e-55 
ref|WP_025858227.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   2e-55 
ref|WP_016936705.1|  glutamate-1-semialdehyde aminotransferase...    196   2e-55 
gb|AIG03127.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    196   2e-55 
ref|WP_017376532.1|  hypothetical protein [Piscirickettsia sal...    196   2e-55 
ref|WP_010174801.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   2e-55 
ref|WP_021792423.1|  hypothetical protein [Thermoplasmatales a...    196   2e-55 
ref|WP_019818059.1|  MULTISPECIES: glutamate-1-semialdehyde am...    196   2e-55 
gb|AIR89287.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    196   3e-55 
ref|WP_023378560.1|  MULTISPECIES: glutamate-1-semialdehyde am...    196   3e-55 
ref|WP_013620266.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_027981099.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   3e-55 
gb|KGF62579.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    196   3e-55 
ref|WP_027591583.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   3e-55 
ref|WP_005962706.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_008366826.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_009617350.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
gb|KES20403.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    196   3e-55 
ref|WP_027132232.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   3e-55 
gb|EYD69268.1|  glutamate-1-semialdehyde aminotransferase [Fus...    196   3e-55 
ref|WP_015911304.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_005958232.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_007842315.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_029997558.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_003399812.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   3e-55 
gb|KFF03789.1|  glutamate-1-semialdehyde aminotransferase [Chr...    196   3e-55 
ref|WP_008152864.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   3e-55 
ref|WP_031405600.1|  glutamate-1-semialdehyde aminotransferase...    196   3e-55 
ref|WP_027605259.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   3e-55 
ref|WP_007993997.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_005791703.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    196   4e-55 
dbj|BAJ46782.1|  glutamate-1-semialdehyde 2,1-aminomutase [Can...    194   4e-55 
ref|WP_009469868.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_012447589.1|  glutamate-1-semialdehyde aminotransferase...    196   4e-55 
ref|WP_010487268.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_003215470.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    196   4e-55 
ref|WP_029292220.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
gb|KGD69502.1|  glutamate-1-semialdehyde aminotransferase [Fla...    196   4e-55 
ref|WP_032895176.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_027896208.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_015806804.1|  glutamate-1-semialdehyde aminotransferase...    196   4e-55 
ref|WP_032086316.1|  glutamate-1-semialdehyde aminotransferase...    196   4e-55 
ref|WP_019364060.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_017340979.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   4e-55 
ref|WP_016973898.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    196   4e-55 
ref|WP_013146305.1|  MULTISPECIES: glutamate-1-semialdehyde am...    196   4e-55 
gb|KEY18570.1|  glutamate-1-semialdehyde aminotransferase [Chr...    196   4e-55 
gb|EGH33183.1|  glutamate-1-semialdehyde aminotransferase [Pse...    193   4e-55 
ref|WP_023634144.1|  glutamate-1-semialdehyde aminotransferase...    196   5e-55 
ref|WP_015886047.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   5e-55 
gb|EZP58694.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1 [Ex...    196   5e-55 
emb|CDF82103.1|  glutamate-1-semialdehyde aminotransferase [Ps...    196   5e-55 
ref|WP_015020070.1|  glutamate-1-semialdehyde aminotransferase...    196   5e-55 
ref|WP_017937493.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   5e-55 
ref|WP_008267215.1|  glutamate-1-semialdehyde aminotransferase...    196   5e-55 
ref|WP_032884612.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   5e-55 
ref|WP_011177049.1|  glutamate-1-semialdehyde aminotransferase...    195   5e-55 
ref|WP_029335645.1|  glutamate-1-semialdehyde aminotransferase...    196   5e-55 
emb|CCP13045.1|  glutamate-1-semialdehyde aminotransferase [St...    196   5e-55 
ref|WP_010170936.1|  glutamate-1-semialdehyde aminotransferase...    196   6e-55 
ref|WP_027850746.1|  hypothetical protein [Marinospirillum ins...    195   6e-55 
ref|WP_026690322.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   6e-55 
ref|WP_015410753.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    196   6e-55 
ref|WP_007739355.1|  glutamate-1-semialdehyde aminotransferase...    196   6e-55 
ref|WP_014052734.1|  glutamate-1-semialdehyde aminotransferase...    196   6e-55 
ref|WP_016393490.1|  glutamate-1-semialdehyde aminotransferase...    195   6e-55 
gb|KFF18541.1|  glutamate-1-semialdehyde aminotransferase [Chr...    195   6e-55 
gb|AIN61772.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    195   6e-55 
ref|WP_024671858.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   6e-55 
ref|WP_024077559.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   6e-55 
ref|WP_026713258.1|  glutamate-1-semialdehyde aminotransferase...    195   6e-55 
ref|WP_024691622.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   6e-55 
ref|WP_010878736.1|  glutamate-1-semialdehyde aminotransferase...    195   6e-55 
ref|WP_005419013.1|  glutamate-1-semialdehyde aminotransferase...    195   7e-55 
ref|WP_008440749.1|  glutamate-1-semialdehyde aminotransferase...    196   7e-55 
ref|WP_019338633.1|  glutamate-1-semialdehyde aminotransferase...    195   7e-55 
ref|WP_005888763.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   7e-55 
ref|WP_017343614.1|  glutamate-1-semialdehyde aminotransferase...    196   7e-55 
ref|WP_017131437.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   7e-55 
ref|WP_010427220.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   7e-55 
ref|WP_016490752.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   7e-55 
gb|AIF22987.1|  class III aminotransferase (hemL) [uncultured ...    185   7e-55 
ref|WP_024715665.1|  glutamate-1-semialdehyde aminotransferase...    195   7e-55 
ref|WP_003176272.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_024658834.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_033044583.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_021204575.1|  glutamate-1-semialdehyde aminotransferase...    195   8e-55 
gb|KFN45651.1|  glutamate-1-semialdehyde aminotransferase [Are...    195   8e-55 
ref|WP_027471869.1|  glutamate-1-semialdehyde aminotransferase...    195   8e-55 
ref|WP_018355754.1|  glutamate-1-semialdehyde aminotransferase...    195   8e-55 
ref|WP_008409697.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
gb|AHE67221.1|  glutamate-1-semialdehyde-2,1-aminomutase [Legi...    195   8e-55 
gb|KFF25376.1|  glutamate-1-semialdehyde aminotransferase [Chr...    195   8e-55 
ref|WP_008022969.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_010797117.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_027924278.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_024684187.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_022965313.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   8e-55 
ref|WP_013923063.1|  glutamate-1-semialdehyde aminotransferase...    195   8e-55 
ref|WP_015475442.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_010331495.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_019713696.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_006826982.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
gb|KGE66596.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    195   9e-55 
ref|WP_014038360.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_003223278.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_014548281.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_007975850.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   9e-55 
ref|WP_006665306.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_008092872.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   9e-55 
ref|WP_015444486.1|  Glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_006078389.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_028839193.1|  glutamate-1-semialdehyde aminotransferase...    195   9e-55 
ref|WP_008052405.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    195   1e-54 
ref|WP_007990649.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   1e-54 
ref|WP_028949560.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_021053046.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_008066019.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   1e-54 
ref|WP_024679746.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   1e-54 
ref|WP_005620644.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    195   1e-54 
ref|WP_011572639.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_003376595.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   1e-54 
ref|WP_003239678.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_007243834.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    195   1e-54 
ref|WP_032956047.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_010484019.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_027899835.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_025108710.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_017023784.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_024763970.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_021489473.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   1e-54 
ref|WP_015881121.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_024647649.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_003368783.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_024676388.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_014084839.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_010947263.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_007927075.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_006110902.1|  glutamate-1-semialdehyde aminotransferase...    195   1e-54 
ref|WP_006165603.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_032615563.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_032861718.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_003392017.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_019296328.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_032128374.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_024780851.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_024662587.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_007514216.1|  MULTISPECIES: glutamate-1-semialdehyde am...    194   1e-54 
ref|WP_020798736.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    194   1e-54 
ref|WP_004267439.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_011165781.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_003036338.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_009051021.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_027917754.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_007021154.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_011535823.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_027491428.1|  glutamate-1-semialdehyde aminotransferase...    194   1e-54 
ref|WP_019340055.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   1e-54 
ref|WP_006653473.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
gb|ETK25162.1|  glutamate-1-semialdehyde aminotransferase [Pse...    194   2e-54 
ref|WP_006389874.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_012019703.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_028695531.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_007909648.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    194   2e-54 
ref|WP_033009898.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
gb|EZH84370.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    194   2e-54 
ref|WP_019257845.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
gb|KFJ90315.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    194   2e-54 
ref|WP_029441293.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_012512012.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_026699911.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    195   2e-54 
ref|WP_033016710.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_010441737.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
gb|KDE61601.1|  glutamate-1-semialdehyde aminotransferase [Fus...    194   2e-54 
gb|KFF23215.1|  glutamate-1-semialdehyde aminotransferase [Chr...    194   2e-54 
ref|WP_013638992.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_003233535.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_006055533.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_017735647.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_027374479.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_026867202.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_017903151.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
gb|KDE61557.1|  glutamate-1-semialdehyde aminotransferase [Fus...    194   2e-54 
ref|WP_003194432.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_028620804.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_007960556.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
emb|CAB04811.1|  glutamate-1-semialdehyde aminotransferase [Ba...    194   2e-54 
ref|WP_012099319.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_025807668.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_007946646.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_015252511.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_018578261.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_011998717.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_007242506.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_014586826.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
gb|KGG49768.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    192   2e-54 
gb|EZP25536.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    194   2e-54 
ref|WP_009045779.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
gb|AHX15717.1|  glutamate-1-semialdehyde aminotransferase [Dye...    194   2e-54 
ref|WP_020295299.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_008035126.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_012829566.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_009685400.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    194   2e-54 
ref|WP_009329014.1|  MULTISPECIES: glutamate-1-semialdehyde am...    194   2e-54 
ref|WP_003347762.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_005997360.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_027617778.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_009051832.1|  MULTISPECIES: potassium transporter Trk [...    197   2e-54 
ref|WP_011878475.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_032976731.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_008081078.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    194   2e-54 
ref|WP_011229975.1|  glutamate-1-semialdehyde aminotransferase...    194   2e-54 
ref|WP_012053798.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    194   2e-54 
ref|WP_003249773.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   2e-54 
ref|WP_028683496.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   3e-54 
ref|WP_025874191.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
ref|WP_029340910.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
gb|ABU41515.1|  HemL [Heliophilum fasciatum]                         194   3e-54 
ref|WP_025570843.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
gb|AHZ71314.1|  glutamate-1-semialdehyde aminotransferase [Pse...    194   3e-54 
ref|WP_011508594.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   3e-54 
ref|WP_008475320.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
emb|CDI04807.1|  glutamate-1-semialdehyde 2,1-aminotransferase...    194   3e-54 
ref|WP_003236989.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
ref|WP_022847168.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
ref|WP_003185734.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   3e-54 
ref|WP_023467313.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
ref|WP_012281089.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
emb|CAJ74548.1|  strongly similar to glutamate-1-semialdehyde ...    194   3e-54 
ref|WP_027915243.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    194   3e-54 
ref|WP_003020957.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
ref|WP_003240243.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   3e-54 
gb|EXJ13816.1|  Glutamate-1-semialdehyde aminotransferase [Thi...    197   3e-54 
ref|WP_012312573.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    194   3e-54 
ref|WP_015373025.1|  glutamate-1-semialdehyde aminotransferase...    194   3e-54 
dbj|BAL53850.1|  aminotransferase class III [uncultured Acidob...    193   3e-54 
ref|WP_021114450.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    193   3e-54 
ref|WP_003228515.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    193   3e-54 
ref|WP_010955406.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   3e-54 
ref|WP_030140356.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   3e-54 
gb|KFF75453.1|  glutamate-1-semialdehyde aminotransferase [Chr...    193   3e-54 
ref|WP_022641183.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   3e-54 
ref|WP_003025999.1|  glutamate-1-semialdehyde aminotransferase...    193   3e-54 
ref|WP_017848323.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   3e-54 
gb|KDE24853.1|  glutamate-1-semialdehyde aminotransferase [Bac...    193   4e-54 
ref|WP_015715541.1|  MULTISPECIES: glutamate-1-semialdehyde am...    193   4e-54 
ref|WP_032630659.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_012939992.1|  glutamate-1-semialdehyde aminotransferase...    193   4e-54 
ref|WP_029317453.1|  MULTISPECIES: glutamate-1-semialdehyde am...    193   4e-54 
ref|WP_028690406.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_028631428.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
gb|AHF07200.1|  glutamate-1-semialdehyde aminotransferase [Des...    193   4e-54 
ref|WP_027321015.1|  glutamate-1-semialdehyde aminotransferase...    193   4e-54 
ref|WP_011188057.1|  glutamate-1-semialdehyde aminotransferase...    193   4e-54 
ref|WP_012274357.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_008757908.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_016838427.1|  glutamate-1-semialdehyde aminotransferase...    193   4e-54 
ref|WP_019691828.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_005753087.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_009471808.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_002555312.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    193   4e-54 
ref|WP_010222919.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_006930887.1|  glutamate-1-semialdehyde aminotransferase...    193   4e-54 
ref|WP_007690161.1|  glutamate-1-semialdehyde aminotransferase...    194   4e-54 
ref|WP_016508541.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    193   4e-54 
ref|WP_005745397.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_016773047.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   4e-54 
ref|WP_012532353.1|  glutamate-1-semialdehyde aminotransferase...    193   4e-54 
gb|KFF18794.1|  glutamate-1-semialdehyde aminotransferase [Fla...    193   5e-54 
ref|WP_013717154.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   5e-54 
ref|WP_018609887.1|  MULTISPECIES: glutamate-1-semialdehyde am...    193   5e-54 
ref|WP_020674547.1|  glutamate-1-semialdehyde aminotransferase...    193   5e-54 
ref|WP_007251061.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   5e-54 
ref|WP_010206765.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    193   5e-54 
ref|WP_007958695.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   5e-54 
ref|WP_021059718.1|  glutamate-1-semialdehyde aminotransferase...    193   5e-54 
ref|WP_021222006.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   5e-54 
gb|AHD16564.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    193   5e-54 
ref|WP_023969266.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   5e-54 
ref|WP_014113118.1|  glutamate-1-semialdehyde aminotransferase...    192   5e-54 
ref|WP_002977484.1|  glutamate-1-semialdehyde aminotransferase...    193   5e-54 
ref|WP_028614220.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   5e-54 
ref|WP_011018652.1|  glutamate-1-semialdehyde aminotransferase...    193   5e-54 
ref|WP_013974339.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    193   5e-54 
ref|WP_019098013.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    193   5e-54 
ref|WP_015326927.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    193   5e-54 
ref|WP_003205861.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    193   5e-54 
ref|WP_012481173.1|  glutamate-1-semialdehyde aminotransferase...    193   6e-54 
ref|WP_013571168.1|  glutamate-1-semialdehyde aminotransferase...    193   6e-54 
ref|WP_028698514.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   6e-54 
ref|WP_016489344.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    193   6e-54 
ref|WP_013694264.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   6e-54 
ref|WP_028944384.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   6e-54 
ref|WP_011151092.1|  glutamate-1-semialdehyde aminotransferase...    193   6e-54 
gb|KFK52367.1|  glutamate-1-semialdehyde aminotransferase [Vib...    193   6e-54 
ref|WP_004512582.1|  glutamate-1-semialdehyde aminotransferase...    192   6e-54 
ref|WP_013390445.1|  glutamate-1-semialdehyde aminotransferase...    192   6e-54 
gb|AIL71521.1|  glutamate-1-semialdehyde aminotransferase [Vib...    193   6e-54 
ref|WP_014549686.1|  glutamate-1-semialdehyde aminotransferase...    193   6e-54 
ref|WP_004420311.1|  Glutamate-1-semialdehyde aminotransferase...    192   6e-54 
gb|KFM93914.1|  glutamate-1-semialdehyde-2,1-aminomutase [Baci...    193   6e-54 
ref|WP_007894429.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    192   6e-54 
ref|WP_021444991.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   6e-54 
ref|WP_027379713.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
gb|KDB45440.1|  glutamate-1-semialdehyde aminotransferase [Hae...    192   7e-54 
ref|WP_021117669.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    192   7e-54 
gb|EWH22937.1|  glutamate-1-semialdehyde aminotransferase [Bac...    192   7e-54 
ref|WP_027235030.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   7e-54 
ref|WP_015383155.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_004430642.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_026060813.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_011079597.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_016832795.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   7e-54 
ref|WP_013329461.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_014479225.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_021114747.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    192   7e-54 
gb|KDD82183.1|  glutamate-1-semialdehyde aminotransferase [Hae...    192   7e-54 
ref|WP_020450638.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_007806974.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_028372946.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_028857385.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   7e-54 
ref|WP_018925769.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    192   7e-54 
ref|WP_031416893.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_005494046.1|  glutamate-1-semialdehyde aminotransferase...    192   7e-54 
ref|WP_003252795.1|  MULTISPECIES: glutamate-1-semialdehyde am...    192   7e-54 
ref|WP_007043143.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   7e-54 
gb|KFE44046.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    192   7e-54 
ref|WP_008044562.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   7e-54 
ref|WP_008322545.1|  glutamate-1-semialdehyde aminotransferase...    193   8e-54 
ref|WP_013538342.1|  glutamate-1-semialdehyde aminotransferase...    192   8e-54 
ref|WP_020290964.1|  glutamate-1-semialdehyde aminotransferase...    192   8e-54 
ref|WP_015903924.1|  glutamate-1-semialdehyde aminotransferase...    192   8e-54 
ref|WP_024089053.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   8e-54 
ref|WP_005410907.1|  glutamate-1-semialdehyde aminotransferase...    192   8e-54 
ref|WP_019662003.1|  glutamate-1-semialdehyde aminotransferase...    192   8e-54 
ref|WP_014715413.1|  glutamate-1-semialdehyde aminotransferase...    192   8e-54 
ref|WP_024957826.1|  glutamate-1-semialdehyde aminotransferase...    192   9e-54 
ref|WP_008438126.1|  glutamate-1-semialdehyde aminotransferase...    192   9e-54 
gb|AHL36082.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    192   9e-54 
emb|CDQ34390.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Vir...    192   9e-54 
ref|WP_023534530.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    192   9e-54 
ref|WP_014340358.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   9e-54 
ref|WP_029807354.1|  glutamate-1-semialdehyde aminotransferase...    192   9e-54 
ref|WP_025522982.1|  glutamate-1-semialdehyde aminotransferase...    192   9e-54 
gb|KDB45169.1|  glutamate-1-semialdehyde aminotransferase [Hae...    192   9e-54 
ref|WP_032551529.1|  glutamate-1-semialdehyde aminotransferase...    192   9e-54 
ref|WP_010880497.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_016501789.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_013906692.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_011963336.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_026829120.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_011200087.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_019471719.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    192   1e-53 
ref|WP_029530011.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_016090028.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    192   1e-53 
ref|WP_028632736.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_010786581.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_007221613.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_025523175.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_012429482.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_008486947.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_013120025.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_008012633.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_026589504.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_007544087.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_024309555.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_025510292.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_009020294.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_011063647.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    192   1e-53 
ref|WP_010445091.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_023855989.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_003039002.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
gb|AHG87415.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Bibe...    192   1e-53 
ref|WP_005414375.1|  Glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_014663281.1|  glutamate-1-semialdehyde aminotransferase...    191   1e-53 
ref|WP_027592629.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_011336081.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    192   1e-53 
ref|WP_026841070.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_003179959.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_031827726.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_015939911.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_032729924.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_029946392.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_006114039.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
dbj|BAC95492.1|  glutamate-1-semialdehyde aminotransferase [Vi...    192   1e-53 
ref|WP_026858741.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_004230434.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_013792535.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    192   1e-53 
ref|WP_017474122.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_029832823.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_008001772.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_004968835.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_008634940.1|  glutamate-1-semialdehyde aminotransferase...    192   1e-53 
ref|WP_020457583.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_011525345.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_013250775.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_008847311.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
gb|AIN73532.1|  glutamate-1-semialdehyde aminotransferase [Fla...    192   2e-53 
ref|WP_031845998.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_011139679.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_022961292.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_021701868.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_017528920.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_017916733.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_005770290.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_012901668.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_011996416.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_029092197.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
gb|KEY85780.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    191   2e-53 
ref|WP_012569676.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
ref|WP_030129524.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_015485497.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    192   2e-53 
gb|KFF13513.1|  glutamate-1-semialdehyde aminotransferase [Chr...    191   2e-53 
ref|WP_018952610.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_007525651.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_010128084.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_011711795.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_010958513.1|  glutamate-1-semialdehyde aminotransferase...    192   2e-53 
dbj|GAE64847.1|  glutamate-1-semialdehyde 2,1-aminomutase [Chr...    191   2e-53 
ref|WP_009371694.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_023377759.1|  Glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_020713141.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_026833776.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_014648296.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_026753900.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_025622017.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
gb|AIL59900.1|  glutamate-1-semialdehyde aminotransferase [Pse...    191   2e-53 
ref|WP_027696276.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_025783490.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
gb|KGG80312.1|  glutamate-1-semialdehyde aminotransferase [Cal...    191   2e-53 
gb|ADI17167.1|  glutamate-1-semialdehyde aminotransferase [unc...    191   2e-53 
ref|WP_027903519.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_017726704.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_029796496.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
gb|AHK14804.1|  glutamate-1-semialdehyde aminotransferase [Tha...    191   2e-53 
ref|WP_004919419.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_029803423.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_025546697.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_007937387.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
ref|WP_007159642.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
gb|KEZ47988.1|  glutamate-1-semialdehyde aminotransferase [Bac...    191   2e-53 
ref|WP_029595852.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_010342796.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_024699409.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_027484905.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_010677459.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
gb|AHH46647.1|  glutamate-1-semialdehyde aminotransferase [Fra...    191   2e-53 
ref|WP_023499222.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
gb|KFF00153.1|  glutamate-1-semialdehyde aminotransferase [Chr...    191   2e-53 
ref|WP_025533582.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_015590181.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   2e-53 
gb|AIS19404.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    191   2e-53 
ref|WP_029844684.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_029852591.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_005479079.1|  glutamate-1-semialdehyde aminotransferase...    191   2e-53 
ref|WP_025526622.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_010597870.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   3e-53 
gb|EXB54892.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1 [Mo...    192   3e-53 
ref|WP_009394938.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_016418307.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   3e-53 
ref|WP_015839202.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_005488434.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_004038422.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_022970444.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_022228802.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    191   3e-53 
ref|WP_028106877.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_007275867.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_022854399.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_020213674.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_012618352.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_031381251.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_005955637.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-53 
ref|WP_027375771.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_026985772.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
gb|KFN44335.1|  glutamate-1-semialdehyde aminotransferase [Are...    191   3e-53 
ref|WP_027516033.1|  class III aminotransferase [Bradyrhizobiu...    191   3e-53 
ref|WP_026580616.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_025129281.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   3e-53 
ref|WP_025810161.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
dbj|GAF67174.1|  glutamate-1-semialdehyde aminotransferase [Ba...    191   3e-53 
gb|EZX15060.1|  glutamate-1-semialdehyde 2,1-aminomutase 1 [St...    191   3e-53 
ref|WP_010788018.1|  Glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_029851925.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
ref|WP_014003627.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   3e-53 
emb|CEG25867.1|  glutamate-1-semialdehyde-2,1-aminomutase [Bac...    191   3e-53 
ref|WP_003444137.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    191   3e-53 
ref|WP_003631668.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
gb|EFR87923.1|  glutamate-1-semialdehyde 2,1-aminomutase 2 [Li...    191   3e-53 
ref|WP_018663879.1|  glutamate-1-semialdehyde aminotransferase...    191   3e-53 
gb|AIA56569.1|  Glutamate-1-semialdehyde aminotransferase [Aci...    191   4e-53 
ref|WP_005621250.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_002663540.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_012369563.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_012941416.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_007806535.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_015433534.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    191   4e-53 
ref|WP_004287828.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
gb|KDE57704.1|  glutamate-1-semialdehyde aminotransferase [Hal...    191   4e-53 
ref|WP_017642491.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   4e-53 
ref|WP_024495679.1|  glutamate-1-semialdehyde aminotransferase...    187   4e-53 
ref|WP_018133451.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_013841660.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_028938842.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   4e-53 
ref|WP_002688167.1|  glutamate-1-semialdehyde aminotransferase...    190   4e-53 
ref|WP_011914766.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   4e-53 
ref|WP_026975776.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_016913032.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
gb|KFC21673.1|  glutamate-1-semialdehyde aminotransferase [Epi...    190   4e-53 
ref|WP_011971215.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_012841437.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_012749208.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
ref|WP_003019099.1|  glutamate-1-semialdehyde aminotransferase...    191   4e-53 
gb|KFJ43969.1|  glutamate-1-semialdehyde-2,1-aminomutase [Fran...    191   4e-53 
ref|WP_008893039.1|  glutamate-1-semialdehyde aminotransferase...    191   5e-53 
ref|WP_025124938.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
ref|WP_025627770.1|  glutamate-1-semialdehyde aminotransferase...    191   5e-53 
ref|WP_014476216.1|  glutamate-1-semialdehyde aminotransferase...    189   5e-53 
ref|WP_013432493.1|  MULTISPECIES: glutamate-1-semialdehyde am...    190   5e-53 
gb|KDN54889.1|  glutamate-1-semialdehyde aminotransferase [Fla...    190   5e-53 
ref|WP_008091076.1|  glutamate-1-semialdehyde aminotransferase...    191   5e-53 
ref|WP_025907195.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
gb|KGB62526.1|  glutamate-1-semialdehyde aminotransferase [Pis...    190   5e-53 
ref|WP_004738229.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
ref|WP_008222171.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
ref|WP_015505132.1|  MULTISPECIES: Glutamate-1-semialdehyde am...    190   5e-53 
ref|WP_027597184.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    190   5e-53 
ref|WP_027849090.1|  hypothetical protein [Marinospirillum min...    190   5e-53 
gb|AHG04985.1|  glutamate-1-semialdehyde aminotransferase [Hal...    191   5e-53 
gb|KFC22226.1|  glutamate-1-semialdehyde aminotransferase [Epi...    190   5e-53 
ref|WP_019465031.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
ref|WP_008569665.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    190   5e-53 
ref|WP_025323877.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
ref|WP_013062195.1|  glutamate-1-semialdehyde aminotransferase...    190   5e-53 
ref|WP_024363199.1|  glutamate-1-semialdehyde aminotransferase...    190   6e-53 
ref|WP_006743284.1|  glutamate-1-semialdehyde aminotransferase...    191   6e-53 
ref|WP_023625544.1|  glutamate-1-semialdehyde aminotransferase...    190   6e-53 
ref|WP_005394685.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    190   6e-53 
gb|AHN22739.1|  glutamate-1-semialdehyde aminotransferase [Lys...    190   6e-53 
ref|WP_033076738.1|  glutamate-1-semialdehyde aminotransferase...    190   6e-53 
gb|KFO68095.1|  glutamate-1-semialdehyde aminotransferase [Smi...    190   6e-53 
gb|EZP78550.1|  glutamate-1-semialdehyde aminotransferase [Geo...    190   6e-53 
ref|WP_032087446.1|  glutamate-1-semialdehyde aminotransferase...    190   6e-53 
gb|ADI21595.1|  glutamate-1-semialdehyde aminotransferase [unc...    190   6e-53 
ref|WP_014937228.1|  glutamate-1-semialdehyde aminotransferase...    190   6e-53 
gb|ADI17727.1|  glutamate-1-semialdehyde aminotransferase [unc...    190   6e-53 
ref|WP_011404484.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_008866983.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_020082348.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    190   7e-53 
ref|WP_004058657.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_026130637.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_014805235.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    190   7e-53 
ref|WP_032822423.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_009795214.1|  MULTISPECIES: glutamate-1-semialdehyde am...    190   7e-53 
ref|WP_010899087.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    191   7e-53 
ref|WP_021066853.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_014065457.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
gb|KGI84872.1|  glutamate-1-semialdehyde aminotransferase [Exi...    190   7e-53 
gb|EUJ40688.1|  glutamate-1-semialdehyde aminotransferase [Bro...    190   7e-53 
gb|AAG10459.2|AF279106_21  predicted glutamate-1-semialdehyde ...    189   7e-53 
gb|KFI10156.1|  glutamate-1-semialdehyde aminotransferase [Vib...    190   7e-53 
ref|WP_014969655.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_006958083.1|  glutamate-1-semialdehyde aminotransferase...    190   7e-53 
ref|WP_032725573.1|  hypothetical protein [Salinispora arenicola]    189   7e-53 
ref|WP_004065761.1|  MULTISPECIES: glutamate-1-semialdehyde am...    190   7e-53 
gb|AIS53890.1|  glutamate-1-semialdehyde aminotransferase [Vib...    190   8e-53 
ref|WP_003867141.1|  glutamate-1-semialdehyde aminotransferase...    189   8e-53 
ref|WP_029097509.1|  glutamate-1-semialdehyde aminotransferase...    190   8e-53 
ref|WP_005474311.1|  glutamate-1-semialdehyde aminotransferase...    190   8e-53 
gb|KEQ16857.1|  hypothetical protein GZ78_19535 [Endozoicomona...    190   8e-53 
ref|WP_008465458.1|  glutamate-1-semialdehyde aminotransferase...    190   8e-53 
ref|WP_014232904.1|  MULTISPECIES: glutamate-1-semialdehyde am...    190   8e-53 
ref|WP_021819511.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    190   8e-53 
ref|WP_003350842.1|  glutamate-1-semialdehyde aminotransferase...    190   8e-53 
ref|WP_008612533.1|  glutamate-1-semialdehyde aminotransferase...    190   8e-53 
ref|WP_008490990.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    190   8e-53 
ref|WP_026573521.1|  glutamate-1-semialdehyde aminotransferase...    190   8e-53 
ref|WP_006264662.1|  glutamate-1-semialdehyde aminotransferase...    189   9e-53 
gb|KES01276.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    190   9e-53 
ref|WP_012638974.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   9e-53 
ref|WP_008563036.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    190   9e-53 
ref|WP_011702485.1|  glutamate-1-semialdehyde aminotransferase...    190   9e-53 
ref|WP_012009345.1|  glutamate-1-semialdehyde aminotransferase...    190   9e-53 
gb|AIH01750.1|  glutamate-1-semialdehyde-2,1-aminomutase [Riem...    189   9e-53 
ref|WP_022823589.1|  glutamate-1-semialdehyde aminotransferase...    190   9e-53 
ref|WP_027384603.1|  glutamate-1-semialdehyde aminotransferase...    189   9e-53 
ref|WP_008111861.1|  glutamate-1-semialdehyde aminotransferase...    189   9e-53 
ref|WP_005697656.1|  glutamate-1-semialdehyde aminotransferase...    189   9e-53 
ref|WP_028117782.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_004973962.1|  glutamate-1-semialdehyde aminotransferase...    190   1e-52 
dbj|GAJ75361.1|  glutamate-1-semialdehyde aminotransferase [Vi...    190   1e-52 
ref|WP_012872280.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_012645559.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_015492713.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_021621699.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    190   1e-52 
ref|WP_017054123.1|  glutamate-1-semialdehyde aminotransferase...    190   1e-52 
gb|EGC71868.1|  glutamate-1-semialdehyde-2,1-aminomutase [Haem...    190   1e-52 
ref|WP_018972315.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_011640123.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
gb|KFE42275.1|  glutamate-1-semialdehyde aminotransferase [Sta...    189   1e-52 
ref|WP_010031613.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
gb|KEP25787.1|  glutamate-1-semialdehyde aminotransferase [Bac...    189   1e-52 
gb|KGK83156.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    189   1e-52 
ref|WP_008300586.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_006954303.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
gb|ESY33148.1|  glutamate-1-semialdehyde 2,1-aminomutase [Meso...    189   1e-52 
ref|WP_021020602.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
gb|EWG08653.1|  glutamate-1-semialdehyde aminotransferase [Bac...    189   1e-52 
ref|WP_006878297.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_015092444.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
gb|EXF44095.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    189   1e-52 
ref|WP_023405303.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_019242921.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_026990382.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_008739689.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_015262711.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_016390543.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    189   1e-52 
ref|WP_010391073.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
dbj|GAK23376.1|  glutamate-1-semialdehyde aminotransferase [Vi...    189   1e-52 
ref|WP_013756754.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_012798303.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_031245594.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_031421136.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_029761757.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_024702437.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_003285133.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
gb|KEZ47493.1|  glutamate-1-semialdehyde aminotransferase [Bac...    189   1e-52 
ref|WP_003286514.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_015006672.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_013496623.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_019824184.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_002490301.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_012685526.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_019815097.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_002487321.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_025768202.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_005461248.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|XP_003494808.1|  PREDICTED: glutamate-1-semialdehyde 2,1-a...    192   1e-52 
ref|WP_023578371.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    188   1e-52 
ref|WP_005700273.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
gb|KFD42485.1|  glutamate-1-semialdehyde aminotransferase [Pep...    189   1e-52 
ref|WP_017633268.1|  glutamate-1-semialdehyde aminotransferase...    189   1e-52 
ref|WP_012699590.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   1e-52 
ref|WP_005530363.1|  glutamate-1-semialdehyde aminotransferase...    188   2e-52 
ref|WP_019743190.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_026315851.1|  hypothetical protein [Actinokineospora en...    189   2e-52 
ref|WP_004045135.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_006259627.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_033092337.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_005825420.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
gb|EQD25468.1|  glutamate-1-semialdehyde-2,1-aminomutase [Lept...    188   2e-52 
ref|WP_022843183.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_018122616.1|  hypothetical protein [Wohlfahrtiimonas ch...    189   2e-52 
ref|WP_004088871.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    189   2e-52 
ref|WP_011929616.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   2e-52 
ref|WP_020006162.1|  hypothetical protein [Salinicoccus albus]       189   2e-52 
ref|WP_029033144.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_008881541.1|  MULTISPECIES: glutamate-1-semialdehyde am...    189   2e-52 
ref|WP_008893449.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_022574293.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
gb|KGK91752.1|  glutamate-1-semialdehyde aminotransferase [Des...    189   2e-52 
ref|WP_020221243.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
gb|KGA03200.1|  glutamate-1-semialdehyde aminotransferase [Cob...    189   2e-52 
ref|WP_004410127.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_020374305.1|  hypothetical protein [Sulfobacillus therm...    189   2e-52 
ref|WP_005380032.1|  MULTISPECIES: glutamate-1-semialdehyde am...    189   2e-52 
ref|WP_028832009.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_020401617.1|  hypothetical protein [Gracilimonas tropica]     189   2e-52 
ref|WP_032108642.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_017436543.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_014851316.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   2e-52 
ref|WP_008845833.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   2e-52 
ref|WP_021055138.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_020061209.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
emb|CDN77766.1|  glutamate-1-semialdehyde aminotransferase [El...    189   2e-52 
ref|WP_012537706.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   2e-52 
ref|WP_027858334.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_027073303.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
gb|KDE25674.1|  glutamate-1-semialdehyde aminotransferase [Bac...    189   2e-52 
gb|EGQ62577.1|  glutamate-1-semialdehyde aminotransferase [Aci...    189   2e-52 
ref|WP_031572672.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_008931065.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   2e-52 
ref|WP_029055683.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_011685967.1|  glutamate-1-semialdehyde aminotransferase...    188   2e-52 
ref|WP_006639843.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_002925755.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_028390305.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_005819005.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_013581888.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
gb|KGK18684.1|  glutamate-1-semialdehyde aminotransferase [Vib...    189   2e-52 
ref|WP_006262149.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_011736522.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_016988258.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_015403911.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    189   2e-52 
gb|AIA74450.1|  glutamate-1-semialdehyde aminotransferase [Hal...    188   2e-52 
gb|EEZ82680.1|  glutamate-1-semialdehyde aminotransferasee [Vi...    189   2e-52 
ref|WP_014254983.1|  glutamate-1-semialdehyde aminotransferase...    188   2e-52 
ref|WP_017247507.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_008405189.1|  MULTISPECIES: glutamate-1-semialdehyde am...    189   2e-52 
dbj|GAJ70880.1|  glutamate-1-semialdehyde aminotransferase [Vi...    189   2e-52 
ref|WP_026138217.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_005425271.1|  MULTISPECIES: glutamate-1-semialdehyde am...    189   2e-52 
ref|WP_019183848.1|  glutamate-1-semialdehyde aminotransferase...    188   2e-52 
ref|WP_013346615.1|  glutamate-1-semialdehyde aminotransferase...    188   2e-52 
ref|WP_026000215.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_028241742.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   2e-52 
ref|WP_003445878.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    189   2e-52 
ref|WP_033006013.1|  glutamate-1-semialdehyde aminotransferase...    189   2e-52 
ref|WP_009605434.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   3e-52 
gb|EWG09027.1|  glutamate-1-semialdehyde aminotransferase [Bac...    188   3e-52 
ref|WP_023372823.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   3e-52 
ref|WP_029053662.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_005449175.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   3e-52 
ref|WP_010322482.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    188   3e-52 
ref|WP_028986352.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_006248463.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
gb|KDE51179.1|  glutamate-1-semialdehyde aminotransferase [Bac...    188   3e-52 
ref|WP_003016437.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_009707535.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_029914961.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_028961912.1|  glutamate-1-semialdehyde aminotransferase...    189   3e-52 
ref|WP_013487600.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_002435979.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_027621504.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_018768002.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
gb|KGK09116.1|  glutamate-1-semialdehyde aminotransferase [Vib...    188   3e-52 
gb|AIM17271.1|  glutamate-1-semialdehyde aminotransferase [Geo...    188   3e-52 
ref|WP_008361047.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
gb|KGL25885.1|  glutamate-1-semialdehyde aminotransferase [Hel...    188   3e-52 
ref|WP_024951018.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_008130089.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_013464335.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_024894338.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_024718257.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_024601882.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   3e-52 
ref|WP_003477427.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_003768954.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_020711233.1|  hypothetical protein [Acidobacteriaceae b...    188   3e-52 
ref|WP_023575341.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    188   3e-52 
ref|WP_015880900.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
gb|KGK22730.1|  glutamate-1-semialdehyde aminotransferase [Vib...    188   3e-52 
ref|WP_014799797.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_026029021.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_008865214.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_021279161.1|  putative glutamate-1-semialdehyde-2,1-ami...    188   3e-52 
ref|WP_026724893.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_017106926.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_026592534.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_007087897.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_006251259.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_016899366.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_014779370.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   3e-52 
ref|WP_015249771.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_023743397.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   3e-52 
ref|WP_026027519.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
gb|KGI60298.1|  glutamate-1-semialdehyde aminotransferase [Pre...    188   3e-52 
gb|EEZ87389.1|  glutamate-1-semialdehyde aminotransferasee [Vi...    188   3e-52 
ref|WP_026028547.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_016739165.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
gb|AHJ98323.1|  glutamate-1-semialdehyde aminotransferase [Hym...    188   3e-52 
ref|WP_010941005.1|  glutamate-1-semialdehyde aminotransferase...    188   3e-52 
ref|WP_021710617.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   4e-52 
ref|WP_006281452.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   4e-52 
ref|WP_008320052.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_026028237.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   4e-52 
ref|WP_007726727.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_013257404.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
gb|AHZ83804.1|  glutamate-1-semialdehyde aminotransferase [Bde...    188   4e-52 
ref|WP_007496744.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_003301735.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_008576599.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   4e-52 
ref|WP_026564343.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_002504849.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_007505670.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   4e-52 
gb|KGK12771.1|  glutamate-1-semialdehyde aminotransferase [Vib...    188   4e-52 
ref|WP_008073304.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
gb|AHY41375.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pseu...    188   4e-52 
ref|WP_008341922.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   4e-52 
ref|WP_002456470.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   4e-52 
ref|WP_002496763.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_020367833.1|  glutamate-1-semialdehyde aminotransferase...    187   4e-52 
ref|WP_017356525.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_009874564.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_033101332.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_015050613.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_013489556.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    189   4e-52 
ref|WP_029332783.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_024425792.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
gb|EHQ77934.1|  glutamate-1-semialdehyde-2,1-aminomutase [Stap...    188   4e-52 
ref|WP_016779284.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   4e-52 
ref|WP_005618034.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_005598878.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_007137785.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_014067180.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_013407375.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_011140075.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
ref|WP_024982025.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
emb|CEE02210.1|  Glutamate-1-semialdehyde 2,1-aminomutase 2 [B...    188   4e-52 
ref|WP_013711008.1|  glutamate-1-semialdehyde aminotransferase...    188   4e-52 
gb|KEF30336.1|  Glutamate-1-semialdehyde aminotransferase [Mar...    188   4e-52 
ref|WP_002507390.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   4e-52 
ref|WP_019835435.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_006718541.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_024425202.1|  MULTISPECIES: glutamate-1-semialdehyde am...    188   5e-52 
ref|WP_001830745.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
gb|EFR90540.1|  glutamate-1-semialdehyde 2,1-aminomutase 2 [Li...    188   5e-52 
dbj|GAL61087.1|  glutamate-1-semialdehyde aminotransferase [Al...    187   5e-52 
emb|CDZ99806.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Lys...    188   5e-52 
ref|WP_017549268.1|  hypothetical protein [Salinicoccus carnic...    188   5e-52 
ref|WP_011467310.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   5e-52 
gb|KGL28557.1|  glutamate-1-semialdehyde aminotransferase [Hel...    187   5e-52 
ref|WP_012673760.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_018918416.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   5e-52 
ref|WP_003217823.1|  glutamate-1-semialdehyde aminotransferase...    188   5e-52 
ref|WP_009329296.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   5e-52 
ref|WP_019599195.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_002467134.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_002451781.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_028950984.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_010556989.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_014613706.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_012056936.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_013403410.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_031539763.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_006266895.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_016650354.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   5e-52 
ref|WP_027453776.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_022110241.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    187   5e-52 
ref|WP_021280334.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_032091929.1|  glutamate-1-semialdehyde aminotransferase...    187   5e-52 
ref|WP_002901111.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_025819539.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_027410678.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
gb|EUJ23070.1|  glutamate-1-semialdehyde aminotransferase [Lis...    187   6e-52 
ref|WP_002455233.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_023393304.1|  glutamate-1-semialdehyde aminotransferase...    188   6e-52 
ref|WP_016425291.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   6e-52 
ref|WP_004578839.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
emb|CDQ09784.1|  Glutamate-1-semialdehyde 2,1-aminomutase (GSA...    187   6e-52 
ref|WP_028177381.1|  class III aminotransferase [Bradyrhizobiu...    187   6e-52 
ref|WP_026710596.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_022628767.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_012082098.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_013857634.1|  glutamate-1-semialdehyde aminotransferase...    188   6e-52 
ref|WP_010362827.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_003353813.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_016885548.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_027886005.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_008959090.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   6e-52 
ref|WP_023505235.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    188   6e-52 
ref|WP_024568559.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_011983564.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_014030547.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   6e-52 
ref|WP_009335850.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_009708170.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_017638191.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_027071470.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_026860800.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_021339099.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_008288556.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_002502352.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_003767253.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
gb|KFL44107.1|  glutamate-1-semialdehyde aminotransferase [Lys...    187   6e-52 
ref|WP_013822610.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_012959928.1|  glutamate-1-semialdehyde aminotransferase...    187   6e-52 
ref|WP_015592522.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_015275525.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   7e-52 
ref|WP_009751002.1|  putative glutamate-1-semialdehyde-2,1-ami...    185   7e-52 
ref|WP_017724693.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
gb|KFC39295.1|  glutamate-1-semialdehyde aminotransferase [Eli...    187   7e-52 
ref|WP_009087858.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
gb|EUJ19420.1|  glutamate-1-semialdehyde aminotransferase [Lis...    187   7e-52 
ref|WP_005707935.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
gb|EGY37459.1|  glutamate-1-semialdehyde-2,1-aminomutase [Aggr...    186   7e-52 
ref|WP_018676800.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_029418695.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_019824359.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_014026915.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_008256539.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_010990959.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_023926899.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    187   7e-52 
ref|WP_012106784.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
emb|CDN99748.1|  glutamate-1-semialdehyde aminotransferase (am...    187   7e-52 
ref|WP_009659579.1|  glutamate-1-semialdehyde aminotransferase...    187   7e-52 
ref|WP_027893849.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_017079986.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_005561574.1|  glutamate-1-semialdehyde aminotransferase...    186   8e-52 
ref|WP_025811039.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   8e-52 
ref|WP_023855430.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_017820414.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_010640456.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   8e-52 
ref|WP_027337333.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_012843701.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_027881135.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_018414944.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   8e-52 
ref|WP_003297118.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_013008440.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_005544231.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
dbj|GAK83603.1|  glutamate-1-semialdehyde aminotransferase [Vi...    187   8e-52 
gb|KEZ21315.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Haem...    187   8e-52 
ref|WP_024030826.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_018706257.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_028887009.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_002495722.1|  glutamate-1-semialdehyde aminotransferase...    187   8e-52 
ref|WP_020877717.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    187   9e-52 
ref|WP_002500729.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_007725278.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   9e-52 
ref|WP_026933486.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
gb|KGI76643.1|  glutamate-1-semialdehyde aminotransferase [Xan...    187   9e-52 
ref|WP_002499444.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_012959821.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   9e-52 
ref|WP_013924848.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   9e-52 
ref|WP_018782727.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_017465261.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_003734664.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
dbj|GAE30204.1|  glutamate-1-semialdehyde aminotransferase [Ba...    187   9e-52 
gb|EES35844.1|  glutamate-1-semialdehyde-2,1-aminomutase [Stap...    187   9e-52 
gb|KFC12453.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Halo...    187   9e-52 
sp|A7MUU9.2|GSA_VIBCB  RecName: Full=Glutamate-1-semialdehyde ...    187   9e-52 
ref|WP_009333149.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   9e-52 
ref|WP_010180679.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
gb|KGA97637.1|  glutamate-1-semialdehyde aminotransferase [Bac...    187   9e-52 
ref|WP_002501582.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
gb|EFV89202.1|  glutamate-1-semialdehyde-2,1-aminomutase [Stap...    187   9e-52 
ref|WP_006093437.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_019383513.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_002499713.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
ref|WP_002447425.1|  glutamate-1-semialdehyde aminotransferase...    187   9e-52 
gb|EHR99872.1|  glutamate-1-semialdehyde-2,1-aminomutase [Stap...    187   9e-52 
ref|WP_017242576.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_002495056.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_002493933.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_032603007.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_004089531.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_016762870.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
gb|AHG78796.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Mann...    187   1e-51 
ref|WP_013680772.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_002910525.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_007202724.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_022972679.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_009723333.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
ref|WP_027053631.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
gb|ETN93720.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Gamm...    187   1e-51 
ref|WP_002494297.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_010372249.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_006791508.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_013598980.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_006637865.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_017910447.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_002496999.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_002475304.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_019004369.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
gb|KEK21693.1|  glutamate-1-semialdehyde aminotransferase [Bac...    187   1e-51 
ref|WP_028376473.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_020365542.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
gb|KEI46434.1|  glutamate-1-semialdehyde aminotransferase [Sta...    187   1e-51 
ref|WP_006705406.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-51 
ref|WP_028470809.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_019169483.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_017056655.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_013055166.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   1e-51 
ref|WP_026442908.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_005703317.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_002497969.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
emb|CDM13917.1|  Glutamate-1-semialdehyde aminotransferase [St...    187   1e-51 
ref|WP_013997951.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
gb|EWH23468.1|  glutamate-1-semialdehyde aminotransferase [Bac...    187   1e-51 
ref|WP_029168757.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
ref|WP_011850393.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_028412426.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_007642896.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
gb|ELT59827.1|  glutamate-1-semialdehyde-2,1-aminomutase [Aggr...    187   1e-51 
ref|WP_017216405.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_000167253.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   1e-51 
ref|WP_023276444.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    186   1e-51 
ref|WP_009847556.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_031374066.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_005554359.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
emb|CDQ42096.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1 [V...    187   1e-51 
ref|WP_020452460.1|  glutamate-1-semialdehyde 2,1-aminotransfe...    187   1e-51 
ref|WP_014099374.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_003194925.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_028877081.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_017080761.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_017552892.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_014957380.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
gb|KEY91490.1|  glutamate-1-semialdehyde 2,1-aminomutase [Cand...    187   1e-51 
gb|AHG72362.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Mann...    187   1e-51 
ref|WP_026031012.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
gb|KER10364.1|  glutamate-1-semialdehyde aminotransferase [Chl...    187   1e-51 
ref|WP_000167254.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
emb|CDQ29787.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Hal...    187   1e-51 
ref|WP_012581193.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_007112201.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   1e-51 
ref|WP_005565059.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_031930240.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_018652200.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_015674269.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_015454855.1|  1-aminomutase 2 [Listeria monocytogenes]        186   1e-51 
ref|WP_019943374.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_009581597.1|  Glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_024361716.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
gb|EHM64832.1|  glutamate-1-semialdehyde-2,1-aminomutase [Stap...    186   1e-51 
ref|WP_007230955.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
gb|KEO81168.1|  glutamate-1-semialdehyde aminotransferase [Tum...    186   1e-51 
ref|WP_028410116.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_026708553.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_013075110.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_017066958.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
emb|CEF18583.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1 [S...    186   1e-51 
ref|WP_008315710.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    186   1e-51 
ref|WP_017084255.1|  glutamate-1-semialdehyde aminotransferase...    187   1e-51 
ref|WP_010436060.1|  MULTISPECIES: glutamate-1-semialdehyde am...    187   1e-51 
ref|WP_009497513.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_015820971.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   1e-51 
gb|ADI16591.1|  glutamate-1-semialdehyde aminotransferase [unc...    186   1e-51 
ref|WP_009418191.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
emb|CDZ94553.1|  glutamate-1-semialdehyde 2,1-aminomutase [Pse...    186   1e-51 
ref|WP_007146837.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   1e-51 
ref|WP_016794561.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_014461821.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_003184061.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_029805009.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_020852621.1|  Glutamate-1-semialdehyde-2,1-aminomutase ...    187   1e-51 
ref|WP_027716337.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_010555199.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_006340940.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    187   1e-51 
ref|WP_012657495.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_033002624.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_017068898.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_005760614.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_029945533.1|  hypothetical protein [candidate division ...    184   1e-51 
gb|KDN09562.1|  Glutamate-1-semialdehyde aminotransferase [Gil...    186   1e-51 
ref|WP_002458539.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
ref|WP_008133947.1|  MULTISPECIES: glutamate-1-semialdehyde am...    186   1e-51 
ref|WP_024596268.1|  glutamate-1-semialdehyde aminotransferase...    186   1e-51 
gb|KDE57082.1|  glutamate-1-semialdehyde aminotransferase [Hal...    187   2e-51 
ref|WP_013780866.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_031464006.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_027083735.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_007376114.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   2e-51 
ref|WP_016112994.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   2e-51 
ref|WP_012128838.1|  glutamate-1-semialdehyde aminotransferase...    187   2e-51 
ref|WP_019411968.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   2e-51 
gb|EKG89933.1|  glutamate-1-semialdehyde-2,1-aminomutase [Vibr...    186   2e-51 
ref|WP_004085701.1|  glutamate-1-semialdehyde aminotransferase...    187   2e-51 
ref|WP_026581712.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_004734538.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_004587157.1|  MULTISPECIES: glutamate-1-semialdehyde am...    186   2e-51 
ref|WP_014510260.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_005992788.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_018921545.1|  hypothetical protein [Salsuginibacillus k...    187   2e-51 
ref|WP_026943071.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_017028371.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_002499841.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_026817339.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|AID42567.1|  Glutamate-1-semialdehyde aminotransferase [Sta...    186   2e-51 
ref|WP_024604975.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|EKD42474.1|  hypothetical protein ACD_73C00141G0003 [uncult...    186   2e-51 
gb|KFZ28514.1|  glutamate-1-semialdehyde aminotransferase [Idi...    186   2e-51 
ref|WP_002958915.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_031419306.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_028384657.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|EWH07554.1|  glutamate-1-semialdehyde aminotransferase [Pse...    186   2e-51 
ref|WP_029377096.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_010136823.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_005218261.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_019165128.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_006446703.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_024564882.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_025752755.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_011217305.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_000167256.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|KFL37377.1|  glutamate-1-semialdehyde aminotransferase [Are...    186   2e-51 
ref|WP_013860259.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_002922144.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_021290581.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_003726276.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_012579987.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|ABT18049.1|  glutamate-1-semialdehyde 2,1-aminotransferase ...    186   2e-51 
ref|WP_002452363.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_000167257.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|AHF02640.1|  glutamate-1-semialdehyde 2,1-aminomutase [Mari...    186   2e-51 
ref|WP_013455754.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|KFZ90613.1|  glutamate-1-semialdehyde aminotransferase [Thi...    186   2e-51 
ref|WP_029388440.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|AHN21859.1|  glutamate-1-semialdehyde aminotransferase [Lys...    186   2e-51 
ref|WP_006914970.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   2e-51 
ref|WP_026464848.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_002915866.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_000167251.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_012604713.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_017176147.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_026882174.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_017551390.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_017806117.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|KGL38456.1|  glutamate-1-semialdehyde aminotransferase [Lis...    186   2e-51 
ref|WP_014097386.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_029773855.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_022198442.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    186   2e-51 
ref|WP_031644150.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_012498581.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_000167260.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_020722397.1|  hypothetical protein [Acidobacteriaceae b...    186   2e-51 
gb|EGJ25222.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1 [Li...    186   2e-51 
ref|WP_020246637.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_003742344.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_005538683.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_003730562.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_021274048.1|  putative glutamate-1-semialdehyde-2,1-ami...    186   2e-51 
ref|WP_021723743.1|  Putative Glutamate-1-semialdehyde 2,1-ami...    186   2e-51 
ref|WP_015375523.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   2e-51 
ref|WP_002485874.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_016202773.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_010319612.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_027269814.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_013081551.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_031546717.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_005559029.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
ref|WP_012419470.1|  glutamate-1-semialdehyde aminotransferase...    186   2e-51 
gb|KEZ57432.1|  glutamate-1-semialdehyde aminotransferase [Bac...    186   3e-51 
ref|WP_027700579.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|EWG15316.1|  glutamate-1-semialdehyde aminotransferase [Xyl...    186   3e-51 
ref|WP_002449004.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_007103497.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_031407912.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|ADI16898.1|  glutamate-1-semialdehyde aminotransferase [unc...    186   3e-51 
gb|KDE38697.1|  Glutamate-1-semialdehyde aminotransferase [Nit...    186   3e-51 
ref|WP_013752821.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_008432151.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_010606085.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_008801499.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|AIS60091.1|  glutamate-1-semialdehyde aminotransferase [Lis...    186   3e-51 
ref|WP_015810651.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|KGD65053.1|  glutamate-1-semialdehyde 2,1-aminomutase [Alca...    186   3e-51 
ref|WP_022948419.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_029661659.1|  MULTISPECIES: hypothetical protein [Amini...    184   3e-51 
ref|WP_027085343.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_013909464.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_009286351.1|  MULTISPECIES: Tetrapyrrole biosynthesis, ...    186   3e-51 
ref|WP_018276410.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_024598294.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|KFZ40131.1|  glutamate-1-semialdehyde aminotransferase [The...    186   3e-51 
ref|WP_004742652.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_014902149.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_026826705.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_010989786.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_026693762.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_028122710.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_011836542.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_019235943.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_023444936.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_029325292.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_022950667.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_011047334.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_024872568.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_003723873.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_017000495.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_022628608.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_018391700.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|AHY57842.1|  glutamate-1-semialdehyde aminotransferase [Ste...    186   3e-51 
ref|WP_027310641.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|KFN03223.1|  glutamate-1-semialdehyde-2,1-aminomutase [Baci...    186   3e-51 
ref|WP_019602683.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_001011864.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_018232220.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_001270870.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|EPX96017.1|  glutamate-1-semialdehyde 2,1-aminomutase [Rals...    185   3e-51 
ref|WP_003739129.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_002919578.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_002896433.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_000673247.1|  MULTISPECIES: glutamate-1-semialdehyde am...    186   3e-51 
ref|WP_012963637.1|  glutamate-1-semialdehyde aminotransferase...    185   3e-51 
ref|WP_010860066.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_025782771.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
gb|AAP79194.1|  glutamate 1-semialdehyde 2,1-aminomutase [Bige...    187   3e-51 
ref|WP_028291912.1|  glutamate-1-semialdehyde aminotransferase...    185   3e-51 
ref|WP_027536417.1|  class III aminotransferase [Bradyrhizobiu...    186   3e-51 
ref|WP_004888911.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    186   3e-51 
ref|WP_008303658.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   3e-51 
ref|WP_019604412.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   3e-51 
ref|WP_020683594.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   3e-51 
ref|WP_002929365.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_017153978.1|  glutamate-1-semialdehyde aminotransferase...    186   3e-51 
ref|WP_012031336.1|  glutamate-1-semialdehyde aminotransferase...    185   3e-51 
ref|WP_002898245.1|  glutamate-1-semialdehyde aminotransferase...    186   4e-51 
ref|WP_000167259.1|  glutamate-1-semialdehyde aminotransferase...    186   4e-51 
gb|KDP13003.1|  glutamate-1-semialdehyde aminotransferase [Sta...    185   4e-51 
ref|WP_014818975.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   4e-51 
ref|WP_007990318.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    186   4e-51 
gb|KFC60477.1|  glutamate-1-semialdehyde aminotransferase [Fla...    185   4e-51 
ref|WP_017755986.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
gb|KFK28036.1|  hypothetical protein AALP_AA8G463600 [Arabis a...    186   4e-51 
ref|WP_002481144.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   4e-51 
ref|WP_020580891.1|  hypothetical protein [Endozoicomonas elys...    185   4e-51 
ref|WP_008169700.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_002932273.1|  glutamate-1-semialdehyde aminotransferase...    186   4e-51 
ref|WP_014553658.1|  glutamate-1-semialdehyde aminotransferase...    186   4e-51 
ref|WP_015255410.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    186   4e-51 
ref|WP_014602055.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_004101161.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_002151734.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_012528425.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_016915597.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   4e-51 
ref|WP_027353289.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_008210508.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_002477610.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   4e-51 
ref|WP_032131094.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_014600904.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_009832421.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   4e-51 
ref|WP_031329925.1|  glutamate-1-semialdehyde aminotransferase...    186   4e-51 
ref|WP_002911824.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_026973806.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_014462602.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_013489699.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_023930579.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    186   4e-51 
gb|ERH28201.1|  glutamate-1-semialdehyde-2,1-aminomutase [Aggr...    186   4e-51 
ref|WP_012951692.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_018279818.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
gb|KFC88151.1|  glutamate-1-semialdehyde aminotransferase [Haf...    185   4e-51 
ref|WP_004394180.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_024589288.1|  MULTISPECIES: glutamate-1-semialdehyde am...    185   4e-51 
ref|WP_027585768.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_018360339.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_014508850.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_002654873.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_019154961.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_006990057.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_014325926.1|  glutamate-1-semialdehyde aminotransferase...    185   4e-51 
ref|WP_009098067.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   4e-51 
ref|WP_011196909.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_011328912.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_026499716.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_020430498.1|  Glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_012295479.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
emb|CEA00571.1|  Glutamate-1-semialdehyde 2,1-aminomutase 1 [J...    185   5e-51 
ref|WP_021712201.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   5e-51 
ref|WP_020505284.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   5e-51 
ref|WP_009096263.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   5e-51 
ref|WP_017657157.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_028794662.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   5e-51 
ref|WP_007622566.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   5e-51 
ref|WP_007594549.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_029220565.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
dbj|GAF64103.1|  glutamate-1-semialdehyde aminotransferase [Ba...    185   5e-51 
ref|WP_000673238.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_027410866.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
gb|KGL45978.1|  glutamate-1-semialdehyde aminotransferase [Lis...    185   5e-51 
ref|WP_002473925.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_026211126.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_013745405.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_025981665.1|  glutamate-1-semialdehyde aminotransferase...    184   5e-51 
ref|WP_014826920.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
gb|EXJ09309.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Nitr...    185   5e-51 
ref|WP_031426108.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_010806598.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    185   5e-51 
gb|AIR83676.1|  glutamate-1-semialdehyde-2,1-aminomutase [Stap...    185   5e-51 
ref|WP_024334993.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_005721785.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_024608759.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_012036258.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
gb|EPR29510.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Geob...    184   5e-51 
ref|WP_013870274.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
gb|ETO96083.1|  glutamate-1-semialdehyde-2,1-aminomutase [Lach...    185   5e-51 
ref|WP_001830429.1|  MULTISPECIES: glutamate-1-semialdehyde am...    185   5e-51 
ref|WP_026581881.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_025909542.1|  glutamate-1-semialdehyde aminotransferase...    185   5e-51 
ref|WP_007877913.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   5e-51 
ref|WP_008180672.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_006918978.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    185   6e-51 
ref|WP_010679846.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_016478358.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   6e-51 
ref|WP_014606556.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
gb|EKD36882.1|  hypothetical protein ACD_75C01344G0001 [uncult...    185   6e-51 
ref|WP_018048844.1|  hypothetical protein [Nitrospina sp. AB-6...    185   6e-51 
ref|WP_015922076.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_024611926.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_021295726.1|  hypothetical protein [Alicyclobacillus ac...    185   6e-51 
ref|WP_025026992.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_026450281.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_009421422.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_026387567.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
gb|KGL38545.1|  glutamate-1-semialdehyde aminotransferase [Lis...    185   6e-51 
ref|WP_032101060.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_003473319.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_010330259.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_022990247.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   6e-51 
sp|B7GIK0.2|GSA1_ANOFW  RecName: Full=Glutamate-1-semialdehyde...    185   6e-51 
ref|WP_022396530.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    185   6e-51 
ref|WP_009814820.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   6e-51 
ref|WP_006230605.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_026850367.1|  glutamate-1-semialdehyde aminotransferase...    185   6e-51 
ref|WP_009360865.1|  MULTISPECIES: Glutamate-1-semialdehyde 2,...    185   6e-51 
ref|WP_008173155.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   6e-51 
ref|WP_009410779.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    185   7e-51 
ref|WP_014159521.1|  glutamate-1-semialdehyde aminotransferase...    185   7e-51 
ref|WP_003748173.1|  glutamate-1-semialdehyde aminotransferase...    185   7e-51 
ref|WP_021705704.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   7e-51 
ref|WP_020864134.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    185   7e-51 
ref|WP_002010346.1|  glutamate-1-semialdehyde aminotransferase...    185   7e-51 
ref|WP_023178236.1|  glutamate-1-semialdehyde aminotransferase...    185   7e-51 
ref|WP_010547878.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   7e-51 
ref|WP_002907171.1|  glutamate-1-semialdehyde aminotransferase...    185   7e-51 
gb|KFF49100.1|  glutamate-1-semialdehyde aminotransferase [Gam...    184   7e-51 
ref|WP_002510274.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   7e-51 
gb|AHG78456.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Mann...    184   7e-51 
ref|WP_024094776.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    185   7e-51 
ref|WP_030071629.1|  glutamate-1-semialdehyde aminotransferase...    184   7e-51 
ref|WP_028779763.1|  glutamate-1-semialdehyde aminotransferase...    184   7e-51 
gb|KGG62500.1|  glutamate-1-semialdehyde aminotransferase [Tol...    184   7e-51 
ref|WP_016509393.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    185   7e-51 
ref|WP_027079083.1|  glutamate-1-semialdehyde aminotransferase...    184   7e-51 
ref|WP_023373085.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   7e-51 
gb|KES19282.1|  Glutamate-1-semialdehyde aminotransferase [Gil...    184   8e-51 
ref|WP_026561736.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_028990289.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
gb|ETX10760.1|  glutamate-1-semialdehyde 2,1-aminomutase [Mari...    184   8e-51 
ref|WP_017728943.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
gb|KFI37456.1|  glutamate-1-semialdehyde aminotransferase [Pep...    184   8e-51 
ref|WP_008497127.1|  Glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_012728807.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_002468085.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_009106477.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_028161520.1|  class III aminotransferase [Bradyrhizobiu...    185   8e-51 
ref|WP_021322176.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_033018891.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_011480880.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   8e-51 
ref|WP_012073490.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_027724719.1|  glutamate-1-semialdehyde aminotransferase...    185   8e-51 
ref|WP_028290579.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
emb|CBJ27347.1|  glutamate-1-semialdehyde 2,1-aminomutase, put...    186   8e-51 
ref|WP_012191082.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_028561867.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
gb|KFA59215.1|  Glutamate-1-semialdehyde aminotransferase [Gil...    184   8e-51 
ref|WP_027707696.1|  glutamate-1-semialdehyde aminotransferase...    184   8e-51 
ref|WP_021067735.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
dbj|GAE54637.1|  glutamate-1-semialdehyde aminotransferase [Xa...    184   9e-51 
ref|WP_015845995.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_011758956.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_009837571.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_026679129.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
gb|KGK56561.1|  glutamate-1-semialdehyde aminotransferase [Xan...    184   9e-51 
ref|WP_000673235.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_002443297.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_028464322.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   9e-51 
ref|WP_000673233.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_014450497.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_001011863.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   9e-51 
ref|WP_025027440.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_003728266.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_026588132.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_009181745.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_000167261.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
ref|WP_002113869.1|  glutamate-1-semialdehyde aminotransferase...    184   9e-51 
gb|KFZ42833.1|  glutamate-1-semialdehyde aminotransferase [Ano...    184   1e-50 
ref|WP_017073091.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_004913690.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_009627774.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_014592952.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_021348878.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
emb|CDR66177.1|  Glutamate-1-semialdehyde aminotransferase [St...    184   1e-50 
ref|WP_002115962.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_023399549.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    184   1e-50 
ref|WP_007184722.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
dbj|BAJ49548.1|  glutamate-1-semialdehyde-2,1-aminomutase [Can...    184   1e-50 
ref|WP_000167255.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_007584860.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_025710266.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_005301305.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|XP_005645853.1|  glutamate-1-semialdehyde 2,1-aminomutase,...    185   1e-50 
ref|WP_024889396.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_001983844.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_000673240.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_020006445.1|  hypothetical protein [Salinicoccus albus]       184   1e-50 
ref|WP_008283947.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_020395229.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_017429166.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_016078604.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_006322066.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_012811137.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_000260533.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_000260528.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_000673241.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_023508600.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_009420528.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    184   1e-50 
gb|ETK30096.1|  glutamate-1-semialdehyde 2,1-aminomutase 2 [Pa...    184   1e-50 
ref|WP_002201844.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_014481568.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_000397252.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_029596003.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_002191859.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_033001097.1|  glutamate-1-semialdehyde aminotransferase...    183   1e-50 
ref|WP_000673239.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_003486103.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_020287246.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_011846147.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_028387069.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_027554685.1|  class III aminotransferase [Bradyrhizobiu...    184   1e-50 
ref|WP_000260534.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_000673242.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_010859550.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_001011875.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011038374.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011052264.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_012574076.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_010561801.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_014093045.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_006836305.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_000260527.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_026055247.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
gb|EUJ51675.1|  glutamate-1-semialdehyde aminotransferase [Lis...    184   1e-50 
ref|WP_014435970.1|  glutamate-1-semialdehyde aminotransferase...    185   1e-50 
ref|WP_027066339.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
gb|KDB38915.1|  glutamate-1-semialdehyde aminotransferase [Bac...    184   1e-50 
ref|WP_000673245.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_002987599.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_011502780.1|  class III aminotransferase [Rhodopseudomo...    184   1e-50 
ref|WP_009578295.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_005911957.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011181462.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_003299918.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_002159373.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_027356307.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_029037924.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_000260532.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_000259704.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011423389.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
emb|CCG00529.1|  glutamate-1-semialdehyde-2,1-aminomutase [unc...    184   1e-50 
gb|KES10264.1|  Glutamate-1-semialdehyde aminotransferase [Sno...    184   1e-50 
gb|ETT88102.1|  glutamate-1-semialdehyde aminotransferase [Bac...    184   1e-50 
gb|AHW91903.1|  glutamate-1-semialdehyde aminotransferase [Cam...    184   1e-50 
ref|WP_029437352.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_012985855.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_000673244.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_027364230.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_007974477.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_029093164.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_012069042.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_017162241.1|  glutamate-1-semialdehyde aminotransferase...    183   1e-50 
ref|WP_016716392.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
gb|EYR65390.1|  glutamate-1-semialdehyde aminotransferase [Lys...    184   1e-50 
ref|WP_000260529.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_017220197.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_019242783.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_012616565.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_002162941.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_028607265.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_001974515.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_002017418.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_003469468.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_007967682.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_013524255.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_010625969.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_025672076.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_025949387.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_012676480.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_005569221.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   1e-50 
ref|WP_015731628.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_025887823.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011039977.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_007018806.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_015900519.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011232118.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   1e-50 
ref|WP_025800444.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_015027675.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_022558547.1|  probable glutamate-1-semialdehyde aminotr...    184   1e-50 
ref|WP_020598228.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_014291263.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_012969348.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   1e-50 
ref|WP_032587370.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
ref|WP_011262582.1|  glutamate-1-semialdehyde aminotransferase...    184   1e-50 
gb|EKD52257.1|  hypothetical protein ACD_62C00075G0013 [uncult...    184   1e-50 
ref|WP_000260535.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
gb|EGY47563.1|  glutamate-1-semialdehyde-2,1-aminomutase [Aggr...    183   2e-50 
gb|EJP73427.1|  glutamate-1-semialdehyde-2,1-aminomutase [SAR8...    184   2e-50 
ref|WP_019376794.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_017443702.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_003733106.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_012283031.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_018465514.1|  hypothetical protein [Meiothermus timidus]      184   2e-50 
ref|WP_025148684.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_002174756.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_013144589.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|XP_006394261.1|  hypothetical protein EUTSA_v10004138mg [E...    184   2e-50 
ref|WP_025038965.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   2e-50 
ref|WP_033025934.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_011917179.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_021095991.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    184   2e-50 
ref|WP_015935494.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_002483076.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_010581695.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_027306053.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_028399862.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
emb|CDQ36891.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Vir...    184   2e-50 
ref|WP_028110984.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_014706095.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   2e-50 
ref|WP_005613104.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_011573409.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_005420798.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_015115338.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   2e-50 
ref|WP_000673236.1|  MULTISPECIES: glutamate-1-semialdehyde am...    184   2e-50 
ref|WP_020332029.1|  Glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_004401934.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_013164711.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_025114605.1|  glutamate-1-semialdehyde aminotransferase...    184   2e-50 
ref|WP_015617327.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    184   2e-50 
ref|WP_028987477.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_019623165.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
ref|WP_028863836.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_011348479.1|  MULTISPECIES: glutamate-1-semialdehyde am...    183   2e-50 
gb|AHF98327.1|  glutamate-1-semialdehyde aminotransferase [Hal...    184   2e-50 
ref|WP_005490937.1|  Glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_004847413.1|  MULTISPECIES: glutamate-1-semialdehyde am...    183   2e-50 
ref|WP_028782472.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   2e-50 
gb|AIF43295.1|  glutamate-1-semialdehyde aminotransferase [Vir...    183   2e-50 
ref|WP_031449113.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_020406091.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
ref|WP_026074646.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_032082210.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
gb|EUJ29814.1|  glutamate-1-semialdehyde aminotransferase [Lis...    183   2e-50 
ref|WP_002674576.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_019518221.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
gb|AII50441.1|  hypothetical protein N008_00395 [Hymenobacter ...    184   2e-50 
ref|WP_019301566.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
gb|KGD60799.1|  glutamate-1-semialdehyde 2,1-aminomutase [Alca...    183   2e-50 
ref|WP_005547170.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_029522147.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_019948497.1|  hypothetical protein [Hymenobacter aeroph...    184   2e-50 
ref|WP_014204485.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_022589647.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
ref|WP_000673237.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_000167258.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_029521437.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_022551474.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
gb|KER42025.1|  glutamate-1-semialdehyde aminotransferase [Lys...    183   2e-50 
ref|WP_015782184.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_002903871.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_012534220.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_001270860.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_017156848.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_015364865.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_027395355.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_002680390.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
gb|KEI33150.1|  glutamate-1-semialdehyde aminotransferase [Ral...    183   2e-50 
ref|WP_025280756.1|  MULTISPECIES: glutamate-1-semialdehyde am...    183   2e-50 
ref|WP_012088581.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_011708166.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_019717633.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
gb|KGI84139.1|  glutamate-1-semialdehyde aminotransferase [Exi...    183   2e-50 
ref|WP_009670465.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
ref|WP_011045357.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_014770870.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_027256326.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
gb|EUJ25462.1|  glutamate-1-semialdehyde aminotransferase [Lis...    183   2e-50 
ref|WP_024938103.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_010198137.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_022736032.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_014575935.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
ref|WP_005587753.1|  glutamate-1-semialdehyde 2,1-aminotransfe...    183   2e-50 
ref|WP_032997380.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_005978217.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   2e-50 
ref|WP_026994142.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_004728988.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_011638428.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
gb|EFS02955.1|  glutamate-1-semialdehyde-2,1-aminomutase [List...    183   2e-50 
ref|WP_014782423.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
ref|WP_023174470.1|  glutamate-1-semialdehyde aminotransferase...    183   2e-50 
gb|KGA81368.1|  glutamate-1-semialdehyde aminotransferase [Lys...    183   2e-50 
ref|WP_016420886.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   3e-50 
ref|WP_017038645.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_019235968.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_028668697.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_018401265.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   3e-50 
ref|WP_013388799.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_010419444.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_008431455.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_031534677.1|  MULTISPECIES: glutamate-1-semialdehyde am...    183   3e-50 
ref|WP_014811518.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
gb|KES18684.1|  Glutamate-1-semialdehyde aminotransferase [Gil...    183   3e-50 
ref|WP_020148377.1|  hypothetical protein [Verrucomicrobia bac...    183   3e-50 
ref|WP_026693438.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_001011865.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_017754312.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_008456297.1|  glutamate-1-semialdehyde aminotransferase...    184   3e-50 
ref|WP_001011869.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_017040793.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_024743490.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_002812487.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_017113674.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
gb|EDZ39959.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Lept...    183   3e-50 
gb|AHN25659.1|  Glutamate-1-semialdehyde aminotransferase [Gil...    183   3e-50 
ref|WP_016991878.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_031872114.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_017762766.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_011843826.1|  glutamate-1-semialdehyde aminotransferase...    182   3e-50 
gb|KGL30688.1|  glutamate-1-semialdehyde aminotransferase [Hel...    183   3e-50 
ref|WP_006080738.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_015907695.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_033010145.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_006667310.1|  glutamate-1-semialdehyde aminotransferase...    184   3e-50 
ref|WP_007649977.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_004226632.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_031912487.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_019390623.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_005502103.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_013191567.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_000673249.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_031384951.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_010676494.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    184   3e-50 
gb|KEA64886.1|  Glutamate-1-semialdehyde aminotransferase [Mar...    183   3e-50 
ref|WP_023178041.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_007191428.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   3e-50 
ref|WP_016089411.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   3e-50 
ref|WP_029420878.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_000673251.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_028397035.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
dbj|GAE37641.1|  glutamate-1-semialdehyde aminotransferase [Ba...    183   3e-50 
ref|WP_014090977.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
emb|CED61454.1|  glutamate-1-semialdehyde 2,1-aminomutase [Mor...    183   3e-50 
ref|WP_022944586.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
gb|KGE51330.1|  glutamate-1-semialdehyde aminotransferase [Xan...    183   3e-50 
ref|WP_003437116.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_019978522.1|  hypothetical protein [Verrucomicrobia bac...    182   3e-50 
ref|WP_009381860.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_010050037.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_024831710.1|  glutamate-1-semialdehyde aminotransferase...    183   3e-50 
ref|WP_009710053.1|  glutamate-1-semialdehyde aminotransferase...    184   3e-50 
gb|EEZ79957.1|  glutamate-1-semialdehyde aminotransferase [unc...    182   4e-50 
ref|WP_007081075.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_027855375.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_003355540.1|  glutamate-1-semialdehyde aminotransferase...    183   4e-50 
ref|WP_008573122.1|  MULTISPECIES: glutamate-1-semialdehyde am...    183   4e-50 
ref|WP_019974050.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_000673250.1|  glutamate-1-semialdehyde aminotransferase...    183   4e-50 
emb|CED70554.1|  glutamate-1-semialdehyde 2,1-aminomutase [Ali...    183   4e-50 
ref|WP_032513943.1|  glutamate-1-semialdehyde aminotransferase...    183   4e-50 
ref|WP_026814540.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_001270871.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_011626913.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_019668793.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_027414865.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_031867136.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_012241775.1|  glutamate-1-semialdehyde aminotransferase...    183   4e-50 
ref|WP_015285824.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    182   4e-50 
ref|WP_013797079.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   4e-50 
ref|WP_005706126.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_017112971.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_031870371.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_007420274.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_002125067.1|  MULTISPECIES: glutamate-1-semialdehyde am...    182   4e-50 
ref|WP_010894749.1|  glutamate-1-semialdehyde aminotransferase...    183   4e-50 
ref|WP_015752837.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_007502559.1|  glutamate-1-semialdehyde aminotransferase...    183   4e-50 
ref|WP_033010614.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_012915305.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_016708671.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
gb|KGD95130.1|  hypothetical protein JL39_20140 [Rhizobium sp....    183   4e-50 
ref|WP_031797684.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_023904983.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   4e-50 
ref|WP_012749803.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_026718416.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_012120545.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
gb|EUJ44122.1|  glutamate-1-semialdehyde aminotransferase [Lis...    182   4e-50 
gb|KFC50477.1|  glutamate-1-semialdehyde aminotransferase [Hal...    182   4e-50 
ref|WP_005926880.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
gb|AAC45836.1|  GSA-1-aminotransferase [Staphylococcus aureus]       182   4e-50 
ref|WP_000260531.1|  MULTISPECIES: glutamate-1-semialdehyde am...    182   4e-50 
ref|WP_001270868.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_011173009.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
gb|KFM90446.1|  glutamate-1-semialdehyde-2,1-aminomutase [Baci...    182   4e-50 
ref|WP_027253151.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
gb|KER84914.1|  glutamate-1-semialdehyde aminotransferase [Xan...    182   4e-50 
ref|WP_016903024.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
gb|EUJ36778.1|  glutamate-1-semialdehyde aminotransferase [Lis...    182   4e-50 
ref|WP_008353021.1|  glutamate-1-semialdehyde aminotransferase...    182   4e-50 
ref|WP_029499352.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_018931412.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
emb|CCK74391.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Ole...    182   5e-50 
ref|WP_024711488.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_014221867.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_023555014.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
emb|CDR27799.1|  Glutamate-1-semialdehyde aminotransferase [St...    182   5e-50 
ref|WP_017186496.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_005921716.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_031301775.1|  hypothetical protein [Sphingobacterium pa...    182   5e-50 
ref|WP_005578698.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_022410294.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    182   5e-50 
ref|WP_008916509.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_019027353.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_014312599.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_003269245.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   5e-50 
ref|WP_015264015.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    182   5e-50 
ref|WP_007547491.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_003397944.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_011584330.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
emb|CDN58454.1|  Glutamate-1-semialdehyde aminotransferase 2 [...    182   5e-50 
ref|WP_010505926.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   5e-50 
ref|WP_028284399.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
gb|EUD11232.1|  glutamate-1-semialdehyde-2,1-aminomutase [Prov...    182   5e-50 
gb|KDP22577.1|  hypothetical protein JCGZ_26408 [Jatropha curcas]    183   5e-50 
ref|WP_006072683.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_027830850.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_009640918.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_017697207.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_014610101.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_020471739.1|  hypothetical protein [Zavarzinella formosa]     182   5e-50 
ref|WP_033166775.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
gb|AHG76463.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Mann...    182   5e-50 
ref|WP_014790472.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_008909208.1|  glutamate-1-semialdehyde aminotransferase...    182   5e-50 
ref|WP_005997185.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_027678030.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
gb|KFZ30358.1|  glutamate-1-semialdehyde aminotransferase [Idi...    182   6e-50 
ref|WP_003755607.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_013353072.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_023266755.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_016854198.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   6e-50 
ref|WP_006836788.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_016504302.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_031903193.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
gb|EKD71664.1|  hypothetical protein ACD_46C00130G0003 [uncult...    182   6e-50 
ref|WP_019529809.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   6e-50 
ref|WP_004922511.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_008249741.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   6e-50 
ref|WP_013681856.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_022735673.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_010382961.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
gb|AIQ76171.1|  glutamate-1-semialdehyde aminotransferase [Pae...    182   6e-50 
ref|WP_020749519.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    182   6e-50 
ref|WP_028081717.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_013213320.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   6e-50 
gb|ETT51779.1|  glutamate-1-semialdehyde-2,1-aminomutase [Paen...    182   6e-50 
ref|WP_019533467.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_012957597.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
gb|KER87382.1|  glutamate-1-semialdehyde aminotransferase [Xan...    182   6e-50 
dbj|BAM17296.1|  glutamate-1-semialdehyde-2,1-aminomutase [unc...    182   6e-50 
gb|KGA97682.1|  glutamate-1-semialdehyde aminotransferase [Bac...    182   6e-50 
ref|WP_013306435.1|  glutamate-1-semialdehyde aminotransferase...    182   6e-50 
ref|WP_011133622.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   6e-50 
gb|ADI21616.1|  glutamate-1-semialdehyde aminotransferase [unc...    182   7e-50 
ref|WP_026572283.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_032587027.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_026634879.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_019614658.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_016200188.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_022440676.1|  glutamate-1-semialdehyde 2 1-aminomutase ...    182   7e-50 
ref|WP_011769270.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_011790314.1|  MULTISPECIES: glutamate-1-semialdehyde am...    182   7e-50 
ref|WP_005904325.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_006825286.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_013943432.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   7e-50 
ref|WP_011717912.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_010899187.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_018127598.1|  hypothetical protein [Balneola vulgaris]        182   7e-50 
ref|WP_031076952.1|  hypothetical protein [Streptomyces sp. NR...    182   7e-50 
gb|ERF78099.1|  glutamate-1-semialdehyde aminotransferase [Gal...    182   7e-50 
ref|WP_001011608.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_005369735.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_012435016.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    182   7e-50 
ref|WP_016513801.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   7e-50 
ref|WP_001011866.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
gb|KGL34430.1|  glutamate-1-semialdehyde aminotransferase [Hel...    182   7e-50 
ref|WP_010132289.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   7e-50 
ref|WP_031824599.1|  glutamate-1-semialdehyde aminotransferase...    182   7e-50 
ref|WP_001011870.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_009602158.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_028778966.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_014267543.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_011497248.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
dbj|GAK10313.1|  glutamate-1-semialdehyde aminotransferase [Ge...    182   8e-50 
gb|ERJ59182.1|  hypothetical protein M472_10400 [Sphingobacter...    182   8e-50 
ref|WP_018248720.1|  hypothetical protein [Orenia marismortui]       182   8e-50 
ref|WP_006451213.1|  glutamate-1-semialdehyde aminotransferase...    183   8e-50 
ref|WP_002471529.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_013777587.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_014629666.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_020958702.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
gb|AHG91810.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Gemm...    182   8e-50 
ref|WP_013388975.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   8e-50 
ref|WP_019259079.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
gb|KFE58287.1|  Glutamate-1-semialdehyde aminotransferase [Bac...    182   8e-50 
emb|CDR25962.1|  Glutamate-1-semialdehyde aminotransferase [St...    182   8e-50 
ref|WP_006992697.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   8e-50 
ref|WP_007780696.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_001011871.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_011407853.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_027703881.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_010231334.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_010364452.1|  glutamate-1-semialdehyde aminotransferase...    182   8e-50 
ref|WP_020957408.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    183   9e-50 
ref|WP_031204943.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_026486909.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_022629917.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_003723237.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_012445824.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
gb|EUJ14115.1|  glutamate-1-semialdehyde 2,1-aminomutase [Rals...    182   9e-50 
ref|WP_005593243.1|  MULTISPECIES: glutamate-1-semialdehyde am...    182   9e-50 
emb|CDR24221.1|  Glutamate-1-semialdehyde aminotransferase [St...    182   9e-50 
ref|WP_001075138.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_024973423.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_031769924.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_012276143.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_031513671.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_001270891.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
ref|WP_012471169.1|  glutamate-1-semialdehyde aminotransferase...    182   9e-50 
gb|KGL44363.1|  glutamate-1-semialdehyde aminotransferase [Lis...    182   9e-50 
ref|WP_025926126.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_001011874.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
emb|CDR62331.1|  Glutamate-1-semialdehyde aminotransferase [St...    181   1e-49 
ref|WP_011246169.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_009060195.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_019469636.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_017118855.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_011431185.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_006646134.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
ref|WP_013658612.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    182   1e-49 
ref|WP_031932351.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_010255911.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_026690548.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_020210829.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_014183798.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_003513104.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001576808.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_015167166.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    182   1e-49 
gb|KFA99941.1|  glutamate-1-semialdehyde aminotransferase [Vib...    181   1e-49 
ref|WP_012824109.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_023273860.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_009931591.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_014504466.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001011873.1|  MULTISPECIES: glutamate-1-semialdehyde am...    181   1e-49 
emb|CDL87509.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Xen...    181   1e-49 
ref|WP_014703963.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_003387653.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_002181903.1|  putative glutamate-1-semialdehyde-2,1-ami...    180   1e-49 
ref|WP_008710803.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    182   1e-49 
ref|WP_013024673.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
gb|EPZ52951.1|  glutamate-1-semialdehyde aminotransferase [Ali...    181   1e-49 
ref|WP_013085130.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001794340.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_029320080.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_014931455.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001011872.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001610534.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_028760858.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_014602015.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_019934441.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001270863.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_013059357.1|  MULTISPECIES: glutamate-1-semialdehyde am...    181   1e-49 
ref|WP_029631644.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_013221361.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_022851009.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_028307184.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
gb|ETT00112.1|  glutamate-1-semialdehyde-2,1-aminomutase [Prov...    181   1e-49 
ref|WP_001270858.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_031495019.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
gb|KEK19366.1|  glutamate-1-semialdehyde aminotransferase [Bac...    181   1e-49 
ref|WP_018394072.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_015130597.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
dbj|GAL24013.1|  glutamate-1-semialdehyde aminotransferase [Vi...    181   1e-49 
ref|WP_013567074.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_031217728.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_029549626.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_029654499.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_008340907.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_017187454.1|  hypothetical protein [Alkalibacillus halo...    182   1e-49 
ref|WP_008484537.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001075127.1|  glutamate-1-semialdehyde aminotransferase...    182   1e-49 
emb|CCA89043.1|  glutamate-1-semialdehyde 2,1-aminomutase (ami...    181   1e-49 
ref|WP_003747869.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_024025200.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_012080808.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_013275154.1|  potassium transporter Trk [Thermosedimini...    184   1e-49 
ref|WP_031788209.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
gb|KEF39495.1|  glutamate-1-semialdehyde 2,1-aminomutase [Baci...    181   1e-49 
ref|WP_017168391.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_019499129.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_002083596.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_005503952.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_031787563.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_003725680.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_012966252.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
gb|KES15627.1|  Glutamate-1-semialdehyde aminotransferase [Gil...    181   1e-49 
ref|WP_011275558.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_020960769.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_021624843.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    181   1e-49 
ref|WP_006815153.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_018932593.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001270875.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_013785690.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_015206647.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   1e-49 
ref|WP_003727392.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_001011868.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_008357941.1|  glutamate-1-semialdehyde aminotransferase...    181   1e-49 
ref|WP_004260487.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
emb|CDR50464.1|  Glutamate-1-semialdehyde aminotransferase [St...    181   2e-49 
ref|NP_201162.1|  glutamate-1-semialdehyde-2,1-aminomutase [Ar...    182   2e-49 
ref|WP_024976429.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_016999288.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_006659316.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_002465194.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_028724737.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_014477558.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_010991602.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
dbj|BAO74893.1|  glutamate-1-semialdehyde aminotransferase [Wi...    181   2e-49 
ref|WP_003752635.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_028325778.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_007087314.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|XP_002864856.1|  glutamate-1-semialdehyde-2,1-aminomutase ...    182   2e-49 
ref|WP_023036581.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_002540441.1|  Glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_015595150.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|EWS79140.1|  glutamate-1-semialdehyde aminotransferase [Xyl...    181   2e-49 
ref|WP_019979257.1|  hypothetical protein [Verrucomicrobia bac...    181   2e-49 
gb|KEK29280.1|  glutamate-1-semialdehyde aminotransferase [She...    181   2e-49 
ref|WP_001667584.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_031886649.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_006910529.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|ETT07326.1|  glutamate-1-semialdehyde-2,1-aminomutase [Prov...    181   2e-49 
ref|XP_002526835.1|  glutamate-1-semialdehyde 2,1-aminomutase,...    182   2e-49 
ref|WP_031876468.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_001270855.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_029946082.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_031674647.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_007475148.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_028890957.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_001270861.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_029276008.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_032922261.1|  hypothetical protein [Mesorhizobium sp. L...    181   2e-49 
ref|WP_016837850.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_012545461.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_012139322.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|KDE25220.1|  glutamate-1-semialdehyde aminotransferase [Bac...    181   2e-49 
ref|WP_015384279.1|  MULTISPECIES: glutamate-1-semialdehyde am...    181   2e-49 
ref|WP_031878770.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_031807794.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_027965671.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|EUD03033.1|  glutamate-1-semialdehyde-2,1-aminomutase [Prov...    181   2e-49 
ref|WP_020767505.1|  putative glutamate-1-semialdehyde-2,1-ami...    181   2e-49 
ref|WP_001270865.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_014480464.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_003229633.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_011737633.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_029598334.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_029318189.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_025727984.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_002448312.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|KFB02433.1|  glutamate-1-semialdehyde aminotransferase [Man...    181   2e-49 
ref|WP_008287248.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|XP_006359299.1|  PREDICTED: glutamate-1-semialdehyde 2,1-a...    182   2e-49 
ref|WP_028842182.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_031645212.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_008910167.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_008496523.1|  Glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_009521441.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
dbj|GAE31146.1|  glutamate-1-semialdehyde aminotransferase [Ba...    181   2e-49 
ref|WP_015251539.1|  Glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_003347595.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|EFR90667.1|  glutamate-1-semialdehyde-2,1-aminomutase [List...    181   2e-49 
ref|WP_003200815.1|  MULTISPECIES: glutamate-1-semialdehyde am...    181   2e-49 
ref|WP_001622232.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_009803725.1|  putative [Oceanicola batsensis]                 181   2e-49 
ref|WP_017017268.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_024792092.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_020763416.1|  putative glutamate-1-semialdehyde-2,1-ami...    181   2e-49 
ref|WP_017382118.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_033136490.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_001270856.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_027627923.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_010572204.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_029968576.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_012154234.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_011864816.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_031835970.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_001270874.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_001618404.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
pdb|3BS8|A  Chain A, Crystal Structure Of Glutamate 1-Semialde...    181   2e-49 
ref|WP_017012317.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
emb|CDL85602.1|  Glutamate-1-semialdehyde 2,1-aminomutase [Xen...    181   2e-49 
ref|WP_009238905.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    181   2e-49 
ref|WP_003464208.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_003237593.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_003736696.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
gb|EUJ26766.1|  glutamate-1-semialdehyde aminotransferase [Lis...    181   2e-49 
ref|WP_024714845.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_026673740.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_019440764.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_004398699.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_014664858.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_021271353.1|  putative glutamate-1-semialdehyde-2,1-ami...    181   2e-49 
ref|WP_020530563.1|  hypothetical protein [Flexithrix dorotheae]     181   2e-49 
ref|WP_025929909.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_027415593.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_026261200.1|  hypothetical protein [Kiloniella laminariae]    181   2e-49 
pdb|2CFB|A  Chain A, Glutamate-1-Semialdehyde 2,1-Aminomutase ...    180   2e-49 
ref|WP_012434065.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_012460091.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_019388278.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_024029394.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_011176293.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
dbj|GAE46432.1|  glutamate-1-semialdehyde aminotransferase [Ba...    179   2e-49 
ref|WP_011071513.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_008988488.1|  glutamate-1-semialdehyde aminotransferase...    181   2e-49 
ref|WP_013334218.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_011819863.1|  glutamate-1-semialdehyde aminotransferase...    180   2e-49 
ref|WP_011872124.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   2e-49 
ref|WP_008940640.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_011016463.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
gb|KGG12909.1|  Glutamate-1-semialdehyde aminotransferase [Pro...    181   3e-49 
ref|WP_019715269.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
ref|WP_010303597.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
ref|WP_026802195.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
ref|WP_024427834.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_011784216.1|  MULTISPECIES: glutamate-1-semialdehyde 2,...    180   3e-49 
gb|EUC67993.1|  glutamate-1-semialdehyde 2,1-aminomutase [Alca...    180   3e-49 
ref|WP_017036707.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_014114667.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_003732576.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_003222583.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
gb|ADI23760.1|  glutamate-1-semialdehyde aminotransferase [unc...    180   3e-49 
ref|WP_023041050.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   3e-49 
ref|WP_028762272.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_011228305.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_014962119.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
ref|WP_003329301.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_001075137.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
ref|WP_028114504.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
dbj|GAL36409.1|  glutamate-1-semialdehyde aminotransferase [Vi...    180   3e-49 
ref|WP_015023109.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_001075126.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
gb|KGJ29660.1|  glutamate-1-semialdehyde aminotransferase [Sta...    180   3e-49 
ref|WP_020558087.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    180   3e-49 
ref|WP_002106447.1|  putative glutamate-1-semialdehyde-2,1-ami...    181   3e-49 
ref|WP_014244631.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_026979476.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_026690849.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_008927825.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    180   3e-49 
ref|WP_001270872.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_011056330.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_024718408.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_003730228.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_002466123.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_006096071.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
sp|Q8DLK8.2|GSA_THEEB  RecName: Full=Glutamate-1-semialdehyde ...    180   3e-49 
ref|WP_031902890.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_001270857.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
gb|KDE55494.1|  glutamate-1-semialdehyde aminotransferase [Met...    180   3e-49 
ref|WP_010856606.1|  Glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_023948894.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_009675067.1|  MULTISPECIES: glutamate-1-semialdehyde am...    180   3e-49 
ref|WP_002455138.1|  MULTISPECIES: glutamate-1-semialdehyde am...    180   3e-49 
ref|WP_001075129.1|  glutamate-1-semialdehyde aminotransferase...    181   3e-49 
ref|WP_007180794.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    180   3e-49 
ref|WP_011258053.1|  glutamate-1-semialdehyde aminotransferase...    182   3e-49 
ref|XP_008455106.1|  PREDICTED: glutamate-1-semialdehyde 2,1-a...    181   3e-49 
ref|WP_001270859.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_005898427.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_014092911.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_028765970.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
ref|WP_014464699.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
gb|KEZ88955.1|  glutamate-1-semialdehyde aminotransferase [ [ ...    180   3e-49 
ref|WP_009725755.1|  glutamate-1-semialdehyde aminotransferase...    180   3e-49 
emb|CBI15708.3|  unnamed protein product [Vitis vinifera]            179   3e-49 
ref|WP_025730643.1|  glutamate-1-semialdehyde 2,1-aminomutase ...    181   4e-49 
ref|WP_006008956.1|  glutamate-1-semialdehyde aminot