ORF WN16330

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160001.1
Annotathon code: ORF_WN16330
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : anno
Annotated on : 2008-03-19 18:52:37
  • GAZON helene
  • RODRIGUES-ELY alix

Synopsis

Genomic Sequence

>AACY01160001.1 ORF_WN16330 genomic DNA
CTTATCAATAGACGTAAACGTAAATTTTTTATCTTCTGGCGAACCAAAGTTGACAATTGCAGTAGCGAGAATTAATAAAATAGGGAAATCAATTGCATTC
TCTTCTGCCGATTTGTTTCAAGATGATGAGCTTATTGCAACTGCTAGTTCGTCAATTAAACTTAAAGACTTTGAATCCAGAAATTGGATCGACGACACGA
TAGGTAAAAACGTTAAAATAATAAGATAAGACTTTAAACTCCAAAATCCCAGGAAAGTCCGTCTTTATATTTTTTGAGAATTTGTTTAGCGATTAAAATT
CTGTGAACTTCATCTGGACCATCGGCTAGACGTAATGTCCTTGCTCCCTGATACATTCCAAATAAAGGTAAATCTGCAGAAACACCTTTCCAACCATAAA
CTTGGATAGCTCGATCAACAACACGATGCATAGCTGCAGGAACATAAATTTTGATTGCAGATATATCCACTCTTGGATCACCATCAGAGTCCATAACTTC
AGCACAATGTATTGTCATTAATCTTGCAGTTTGGATGTCTATGTATGAGTCGGCAATAAAACCTTGAATCATTTGCTTGCTTTCAAGAAGACCACCATGA
ACTTCTCTAGTTGTAGTTCTCTTAGACATAAGATCAAAAGCACGCCACATTTGACCTATACTGTTCATGCAATGAAAGACTCTTCCAGCACCTAATCTAT
CTTGAGCTGCAGCATGACCAGATCCTCTTGCACCTAGTTGATTTTCTAAAGGGACTCTCACGTTTTCGTATTTAATTTCTACGTGATCGCCTCCAGTATG
ACCCCAAATTGGTACTGATCTTATGATATTGAATCCTGGAGAATTTGTGGGGACTATAATTTGAGTCAT

Translation

[1 - 633/869]   indirect strand
>ORF_WN16330 Translation [1-633   indirect strand]
MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQM
IQGFIADSYIDIQTARLMTIHCAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLRLADGPDEVHRILIAKQILKK
YKDGLSWDFGV

Phylogeny

 11 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


      +---------Oihe  (firmicutes)    
      ! 
    +-7   +---------------Fbact   (bacteriodetes)  
    ! ! +-5 
    ! ! ! +-------------------Ptro (eucaryote metazoaire)    
    ! +-6 
    !   ! +----------------Blin (actinobacter)     
    !   ! ! 
    !   +-4            +--------Rferri (b-proteo)   
  +-9     ! +----------2 
  ! !     ! !          +----------Rpal (a-proteo)     
  ! !     +-3 
  ! !       !          +-----------------X2        
  ! !       +----------1 
  ! !                  +--------------------Haur (chloroflexi)     
  ! ! 
  ! +----------Pento (g-proteo)    
  ! 
  8----------Dradi (deinococcus)    
  ! 
  +-----------------Tther (euca alveo)    



Arbre(s) sous forme parenthésée issus de neighbor :

(((Oihe:0.33947,((Fbact:0.52163,Ptro:0.66047):0.05061,(Blin:0.55572,
((Rferri:0.28122,Rpal:0.36868):0.35171,(X2:0.59804,Haur:0.70006):0.36979):0.04948):0.06754):0.03351):0.03114,
Pento:0.37062):0.01078,Dradi:0.36618,Tther:0.57692);

Annotator commentaries

Extraction de l'orf: On a choisit l'orf 1 du cadre de lecture 1 sur le brin reverse car c'est le plus long.

Domaine protéique: A partir d'interproscan, on a obtenu 2 domaines protéiques avec la meme fonction donc notre protéine est peut etre une Acétyl CoA déshydrogénase permettant sans doute le transport des électrons dans la chaîne respiratoire.

Résultat du blast: Les premiers résultats du BLASTP montrent que la séquence est bien codante et possède une fonction Acétyl CoA déshydrogénase. Par ailleurs dans swissprot nos meilleurs hit se trouvent etre les humains, le nématode, le rat , la souris En regardant une des fiches ( celle de la soris), on s'est rendu compte que notre protéine fait partie de la respiration mitochondriale. Or l'on sait que la mitochondrie a une origine endosymbiotique donc notre séquence nous apporte une preuve de cette origine. Etant donné que les séquences ayant le plus petit E-value,dans la banque nr, sont des bactéries appartenant à des sous groupes différents, on a donc choisit de prendre comme groupe d'étude: les bactéries et comme groupe extérieur:eucaryotes (séquence 3). Cependant les eucaryotes ne se trouvent pas etre un bon groupe exterieur car trop proche du groupe d etude pour la séquence étudiée. Il faudrait peut etre faire une analyse nucléotidique. On pourrait aussi essayer de prendre les archées comme groupe exterieur cependant l'endosymbiose est trop ancienne.

Résultat du clustalw: Notre clustalw nous montre que la séquence en Nter de la protéine est incomplete. De plus notre proteine est très conservée.

Résultat de l'arbre phylogénétique: D'après, l'arbre obtenu, on peut dire que notre séquence fait partie des bactéries et plus précisément des chloroflexi. L'orthologue le plus proche est Herpetosiphon aurantiacus . On observe aussi la présence d'un eucaryote métazoaire (Ptro)au milieu des bactérie, ceci est anormal cependant cela s'explique par le fait que toutes ces séquences soient d'origine mitochondriale et donc très conservées au sein des espèces.




Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            MFQSCSAAHSVAAVLYATTLGPLFVRARGGKYQDTTGGRAKPARSRGGEAKARCCATRSA
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            RRGGAAGAGPGRCPAGWAPGGLLGASFKSTGSSVPELEYAAAEYERLKKEYEIFRVSKNQ
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            ELLSMGRREAKLDTENKRVRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDK
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            VKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGIQVFDPGESDSDDNCTDVTAAGT
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            QCEYWTGGALGSEPSIGSMIQLQQSFRGPEFAHSSIDVEGPFANVNRDDWDIAVASLLQV
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            TPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVEN
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            QYLTVRKWEIEKSSLVILFIHLTLPSLLLEDCEEAFLKNPEGKPRLIFHRLEDGKVISDS
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            VQQLIDQVSNLNKTSKAKIIDHSGDPAEGVYKTYICVEKIIKQDILGFENTDLETKDLGS
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            EDSIPEEDDFGDVLWDIHDEQEQMETFQQASNSAHELGFEKYYQRLNDLVAAPAPIPPLL
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            VSGGPGSGKSLLLSKWIQLQQKNSPNTLILSHFVGRPMSTSSESSLIIKRLTLKLMQHSW
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            SVSALTLDPAKLLEEFPRWLEKLSARHQGSIIIVIDSIDQVQQVEKHMKWLIDPLPVNVR
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            VIVSVNVETCPPAWRLWPTLHLDPLSPKDAKSIIIAECHSVDIKLSKEQEKKLERHCRSA
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            TTCNALYVTLFGKMIARAGRAGNLDKILHQCFQCQDTVSLYRLVLHSIQESMANDVDKEL
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            MKQILCLVNVSHNGVSESELMELYPEMSWTFLTSLIHSLYKMCLLTYGCGLLRFQHLQAW
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            ETVRLEYLEGPTVTSSYRQKLINYFTLQLSQDRVTWRSADELPWLFQQQGSKQKLHDCLL
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            NLFVSQNLYKRGHFAELLSYWQFVGKDKSAMATEYFDSLKQYEKNCEGEDNMSCLADLYE
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            TLGRFLKDLGLLSQAIVPLQRSLEIRETALDPDHPRVAQSLHQLASVYVQWKKFGNAEQL
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            YKQALEISENAYGADHPYTARELEALATLYQKQNKYEQAEHFRKKSFKIHQKAIKKKGNL
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            YGFALLRRRALQLEELTLGKDTPDNARTLNELGVLYYLQNNLETADQFLKRSLEMRERVL
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            GPDHPDCAQSLNNLAALCNEKKQYDKAEELYERALDIRRRALAPDHPSLAYTVKHLAILY
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ------------------------------------------------------------
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            KKMGKLDKAVPLYELAVEIRQKSFGPKHPSVATALVNLAVLYSQMKKHVEALPLYERALK
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           ----------------------------------------MDTTEVRKNHQFDSVQLRTY
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            IYEDSLGRMHPRVGETLKNLAVLSYEGGDFEKAAELYKRAMEIKEAETSLLGGKAPSSHS
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           FDKILYNENTNGQVHPIEIKQFSHGQSNPTFYINYRNEEYVLRKKPPGKLLKGAHLVDRE
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            SSGDTFSLKTAHSPNVFLQQGQRAGKSNPTFYLQKGFQTYVLRKKPPGSLLPKAHQIDRE
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           FKIISALHKANFPVAKPILYCSDPQIIGTEFYVMSYVRGRIFRADNIDLKGLIPDERREI
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            FKVQKALFSIGFPVPKPILYCSDTSVIGTEFYVMEHVQGRIFRDLTIPG--LSPAERSAI
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           YRELLDVLVRLHKLDPYQIGLGDLSANPEAYYDKQIETWSRNYKLAETDPIKDMDDVIEW
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            YVATVETLAQLHSLNIQSLQLEGYGIG-AGYCKRQVSTWTKQYQAAAHQDIPAMQQLSEW
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           LPNNKPVKTADNSKISIVHGDYRLDNVIFHPTEPRILAVLDWELTALGNPIADAAYTCMA
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            LMKNLPDN---DNEENLIHGDFRLDNIVFHPKECRVIAVLDWELSTIGHPLSDLAHFSLF
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           ------------------------------------------------------------
Dradi           ------------------------------------------------------------
Tther           YYSYPSILGFGKLDFTYHGIPHEFTIRQTYCEKMGLQEISDKDWYFYLCFSFFRLAAISQ
Oihe            ------------------------------------------------------------
Fbact           ------------------------------------------------------------
Ptro            YFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINSILPNWNFFLALSYFKMAGIAQ
Blin            ------------------------------------------------------------
Rferri          ------------------------------------------------------------
Rpal            ------------------------------------------------------------
X2              ------------------------------------------------------------
Haur            ------------------------------------------------------------
                                                                            

Pento           -------------------------------------------------MDFAYSPKVQA
Dradi           ------------------------------------------------MTMFDTTPRAQD
Tther           GVFRRSQLGNASSTNAGLYHKNAKFLANRCKLMIKKSTGEIPPNPKLQGIFNNFSAKYKE
Oihe            -------------------------------------------------MEFKYSDKVNS
Fbact           -------------------------------------------------MNFEYSEKSIA
Ptro            GVYSRYLLGNNSSEDSFLFANIVQPLAETGLQLSKRTFSTVLPQIDTTGQLFVQTRKGQE
Blin            --------------------------------------------------MLETTDRGRD
Rferri          -------------------------------------------------MDFGYTEKVSA
Rpal            -------------------------------------------------MDFEFSDKVER
X2              ------------------------------------------------------------
Haur            -------------------------------------------------MDFAIPSHIAA
                                                                            

Pento           LRERVSAFMDAYVYPAEPVFERQVAEGD----RWQPTAIVEELKAKARAEGLWNLFLP--
Dradi           LRERLLRFMDTYIYPNEAEFHRQVESGE----RWAPVELIEELKPKARAEGLWNLFLPPA
Tther           LERKLIIFMDKYIYPNEQTYYNQISEDKKLR-WQTVPPVLKQLQEKAKAQGLWNLFLP--
Oihe            YQEKLTSFMETYIYPNEKVYQEQLDPMDR---FSTIPPILEELKQKAKDEKLWNLFLP--
Fbact           LQEKLKLFIANNIHPFQEEVKAFHYNPVN---AWKKWPGLDTLKEKAKKEGLWNLFLPKN
Ptro            VLIKVKHFMKQHILPAEKEVTEFYVQNENSADKWGKPLVIDKLKEMAKVEGLWNLFLP--
Blin            YQERLTTFMEGFVYPAEPVYAQQMAAANS---PHTQPQILEDLKAEAKSRGLWNLFHPDP
Rferri          LQEKLLTFMDDHVLPANAEWVRITGQGEYP------MALIDDLKGKARAQGLWNLFLPGL
Rpal            LRAQLADFMRFHVEPANHAWHREIAAGRYP------LQLIERLKSRAFSEDLWNLFLPGL
X2              ------------------------------------------------------------
Haur            MREQISQFLREKVYPNEQAWFDYDEKAYPAC--SEDHPEIKQLQAEVKELGLWAGHLPRE
                                                                            

Pento           ---ESEYGAGLTNLEYAPLAEIMGR-SLLGPEPFNCSAPDTGNMEVLVRYGSEAQKRQWL
Dradi           SDPEGKFGAGLTNLEYAGLCEIMGR-VWWAPEVFNCNAPDTGNMEVIARYGTPEQQEQWL
Tther           ------SVSGLTNLEYAPLCEIMGR-SFLAPVVFNCSAPDTGNMEVLHLYGTKEQKKQWL
Oihe            ---DSEYGAGLTNLEYAPLCEVMGR-SSLAPEVFNCAAPDTGNMETIERYGTEEQKKAWL
Fbact           ---YGDLSPGLTNLEYAPLAEIMGR-ILWSSEVFNCSPPDTGNMEVLAKYGNQKQKDEWL
Ptro            ------AVSGLSHVDYALIAEETGK-CFFAPDVFNCQAPDTGNVEVLHLYGSEEQKKQWL
Blin            -----QWGPGLTNLEYAPLAEITGHSIEIAPESINCNAPDTGNMEVFTRFGTDEHKEKYL
Rferri          K--ADEPGVQLANLEYAPLAEIMGR-LSWASEIFNCNAPDTGNMELLHLFGTPEQKAAWL
Rpal            R--PDDPGQRLSNLDYAPLAEIMGR-NHWAPEVFNCSAPDTGNMELLQLFATPAQRAQWL
X2              ------------------------------------------------------------
Haur            AG-----GMGLSIMEYGLLNEIIGR-SYFAPRIFGSNAPDSGNAEILWHYGTAAQHEHFF
                                                                            

Pento           EPLLRGEIRSAFAMTEPDVASSDATNMAATAVRDGDQ----WLINGRKWWTSGACDPRCK
Dradi           LPLLNGEIRSAFSMTEPQVASSDATNIEAQIVRDGDE----YVINGRKWWSSGAGDSRCK
Tther           EPLLNGEIRSMYGMTEPAVASSDATNMSLQISRCPKEPENFYIVNGRKWWSSGAGDPHCK
Oihe            EPLLHGEIRSCFSMTEPDVASSDATNIKASIIRDGDD----YVINGTKWWSSGAGDPRCQ
Fbact           NPLMNGVIRSAFLMTEPDVASSDATNIETAIVADGDD----YVITGKKWWSSGAMDPNCK
Ptro            EPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDS----YVINGKKWWSSGAGNPKCK
Blin            GPLLDGTIASAFAMTEPAVASSDATNVEMRMEPTDDG----FVLNGRKWFASNGMHPNCR
Rferri          TPLLEGQVRSCFGMTEPDVASSDATNISTSIRRDGDH----YLINGRKWFTTGAIHPNCK
Rpal            EPLLLGEIRSCFAMSEPDAASSDARNIRTTIRRDGDH----YVINGRKWFITGALHPNCK
X2              ------------------------------------------------------------
Haur            WPLQQGAVRSFFSMTEPDVSGADPTLLQTTAELVDDQ----WVINGRKWYSTNANGAGFG
                                                                            

Pento           VMIFMGLS--NPDGQRHQQHSMILVPTDTPGVKIVRPLPVFGYDDAPHG-HAEVLFENVR
Dradi           VSIFMGKT--DPQAPRHLQQSMILVPFDAPGVKIERALQVFGFDDAPHG-HMEMSFDNVR
Tther           VAIVMGVTP-NPKKRRHEQHSQILVPMDAPGVKILRPLQVFGIDDAPHG-HMEIDFQNVR
Oihe            IAIVMGKN--DPAAQKHKQQSMILVPMDTPGVTIKRTLPVFGYDHAPHG-HAEIEYHNVR
Fbact           IAIVMGKT--DFEAPRHLQQSMILVPMDTPGLTIVRPLSVFGYNDSPEG-HAEIILDKVR
Ptro            IAIVLGRTQ-NTSLSRHKQHSMILVPMNTPGVEIIRPLSVFGYTDNFHGGHFEIHFNQVR
Blin            VLIVMGKT--SPDAEVHRQQSMLVVPIDAPGVTVVRNLPVFGYHDREGH--AEITFDNVR
Rferri          LCIVMGVTDSDPEANAHSRHSMVLVPMDTPGFSIVRNVPIMNHHAPEGH--CEVIFRNVR
Rpal            VAIVMGVTGEDLEPGSTERHSMVLVPMDAPGLSIVRNIPIMHYHSPEGH--CELLFRDVR
X2              -------------------MTQIIVPTNSPGFNIIR--SVPIWGHTGG-DHVEIKYENVR
Haur            IVMAMTDP----DAPTHLRYSQIIVPAETPGLTLVR--PISVMGHTTGGGHWEIEYTDVH
                                    : ::** ::**. : *   :            *:   .*:

Pento           VPYENVILGEGRGFEIAQGRLGPGRIHHCMRSIGMAERALELMCKRSVERTAFGRPLARL
Dradi           VPVTNMLLGEGRGFEIAQGRLGPGRIHHCMRLVGQAERALELMIERSAQRIAFGKPLALH
Tther           VPASNMILGEGRGFEISQGRLGPGRIHHCMRLIGLMERCYDSMCDRVGRRSTFGKQLKDN
Oihe            VPATNMLLGEGRGFEIAQGRLGPGRIHHCMRTIGAAERALELLCKRVLDRETFGKKLAEQ
Fbact           VPKANLILEEGKGFEIAQGRLGPGRIHHCMRLIGMAQKSMELMSQRASERSPFGRTLDTY
Ptro            VPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRTAFKKKLYAH
Blin            VPSKDILKGEGEGFAISQARLGPGRIHHCMRAIDAAERALELMVKRADERVTFGEKLSSR
Rferri          VPVSNLLGTEGKGFALAQARLGPGRVHHCMRTIGQCELALEMMCERALGRVAFGKHLSDF
Rpal            VPVANLLGAEGKGFKLAQDRLGPGRVHHCMRSIGQCELALELMCERALERKAFGKHLAEF
X2              VPLENQLGARGSGHAAAQDRLGAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESK
Haur            VPAENLLGKRGQGFAIAQTRLGPGRIHHCMRWLGQAQRAFDLMCEYSTKRVAFGGPLADK
                **  : :  .* *.  :* ***.**:.***. :.    . : : .    *  .   *   

Pento           GGNIDKIADSRMEIDMARLLTLKAAYMMDTVGNKVARSEIAQIKVVAPNVALKVIDRAIQ
Dradi           QHTRELIAQSRMEIDQARLLTLKAAHTMDTVGNKDAKGEIAAIKVVAPNMALRVIDRAIQ
Tther           DNVLQIIGDCRCKIDQARLLTLNAARMIDTVGAKNARIEISMIKIVAPRVACEVIDAAIQ
Oihe            GVIQEWIANARISIEQARLLTLKAAYMMDTVGNKEAKSEIAMIKVIAPNMALDVIDKAIQ
Fbact           SSIRQEIAQSRCEIEQTRLLVLSAADKMDKVGNKEAKDLIAMIKIVAPNMALNVIDRAIQ
Ptro            EVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQ
Blin            ANIQEWIAEARIEIDQARLLTLHAADMMDKHGNKVAKNEIAEIKVVAPAMALKIIDRAIQ
Rferri          ANVQDWIAQSRVEIDQARLLVLRAAWLMDQKGNAAARVDVSAIKLVAAQLQTKVVDRAIQ
Rpal            GNLQDWIADSRLEIDQARLLVLQAAHRMDRAGNAAARIDVSAIKVVVARLQTRVVDRAMQ
X2              QMIQGFIADSYIDIQTARLMTIHCAEVMDSDGDP--RVDISAIKIYVPAAMHRVVDRAIQ
Haur            QVVQHWIAESAAEIQAARLSVLHAAWQIDQAGAKSARIDISLIKFSVAAMLMNVLDRAIQ
                      *.:.   *:  ** .: .*  :*  *    :  :: **. ..     ::* *:*

Pento           IHGGAGVSGDFPLAYMYAMQRTLRLADGPDEVHRAAIGKYEIGKYVPKEMLRSSH-----
Dradi           VYGGAGVCQDTPLAMMYAQARTLRLADGPDIVHTETVAKEELRRQGVDLRALSKR-----
Tther           IHGGAGVSQDHHLAQAYINARTLRLADGPDEVHLMAVAKSELQRYHPRL-----------
Oihe            VLGAAGVSEDFPLAASWANIRTLRLADGPDEVHRKSIAKWELKKYQ--------------
Fbact           IMGGKGVCSDTPLAHFYASARTLRLADGPDEVHMSQLGKNTIKKYSNT------------
Ptro            VCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI-------
Blin            VHGGAGVTEDFPLASMWAHMRTLRLADGPDEVHKRSIARNEMKKYRK-------------
Rferri          VFGAMGLTPDTPLPDLWTWGRAMRFFDGPDEVHLRTIARQELSVVRKNLGRTALYYNLPT
Rpal            VFGAMGLTPDTPLSYLWTWGRAMRFLDGPDEVHLRVVSRAELAKARLALGNNAWYFVPPA
X2              VYGWKGVSADLPLFGMYQGARTLRLADGPDEVHRILIAKQILKKYKDGLSWDFGV-----
Haur            VHGGLGVSDDTPLAFMWRQGRASRIYDGPDEVHKMVVAREILKRYGYPERKV--------
                : *  *:  *  *   :   *. *: **** **   :.   :                  

Pento           ------
Dradi           ------
Tther           ------
Oihe            ------
Fbact           ------
Ptro            ------
Blin            ------
Rferri          R-----
Rpal            GLVAKH
X2              ------
Haur            ------

BLAST

BLASTP 2.2.15 [Oct-15-2006]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1164105642-10492-207712388663.BLASTQ4


Database: Non-redundant SwissProt sequences
           217,875 sequences; 82,042,039 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports
Query= Translation of ORF number 1 in reading frame 1 on the reverse strand. Length=211 


Sequences producing significant alignments:                        (Bits)  Value

gi|117949774|sp|Q709F0|ACD11_HUMAN  Acyl-CoA dehydrogenase family   159    5e-39
gi|2833314|sp|Q22347|ACADM_CAEEL  Probable medium-chain specif...  93.6    4e-19  Gene info
gi|37077871|sp|Q9KJE8|BBSG_THAAR  (R)-benzylsuccinyl-CoA dehydrog  92.4    1e-18
gi|1703065|sp|P41367|ACADM_PIG  Medium-chain specific acyl-CoA...  85.5    1e-16  Gene info
gi|1168286|sp|P15651|ACADS_RAT  Short-chain specific acyl-CoA ...  84.7    2e-16  Gene info
gi|584714|sp|Q07417|ACADS_MOUSE  Short-chain specific acyl-CoA...  84.0    3e-16  Gene info
gi|13878316|sp|P79273|ACADS_PIG  Short-chain specific acyl-CoA...  83.6    4e-16  Gene info
gi|113019|sp|P16219|ACADS_HUMAN  Short-chain specific acyl-CoA...  82.0    1e-15  Gene info
gi|25453062|sp|Q9FS88|IVD1_SOLTU  Isovaleryl-CoA dehydrogenase 1,  80.5    3e-15
gi|1168284|sp|P45952|ACADM_MOUSE  Medium-chain specific acyl-C...  80.1    4e-15  Gene info
gi|113018|sp|P08503|ACADM_RAT  Medium-chain specific acyl-CoA ...  80.1    5e-15  Gene info
gi|113017|sp|P11310|ACADM_HUMAN  Medium-chain specific acyl-Co...  78.6    1e-14  Gene info
gi|33518614|sp|P45857|ACDB_BACSU  Acyl-CoA dehydrogenase           74.7    2e-13
gi|62510496|sp|Q8HXY8|ACADM_MACFA  Medium-chain specific acyl-...  73.9    3e-13
gi|25453061|sp|Q9FS87|IVD2_SOLTU  Isovaleryl-CoA dehydrogenase 2,  73.6    4e-13
gi|1703066|sp|P52042|ACDS_CLOAB  Acyl-CoA dehydrogenase, short...  72.8    8e-13
gi|28376845|sp|Q9VSA3|ACADM_DROME  Probable medium-chain speci...  72.4    9e-13  Gene info
gi|32469593|sp|Q8JZN5|ACAD9_MOUSE  Acyl-CoA dehydrogenase fami...  72.0    1e-12  Gene info
gi|32469596|sp|Q9H845|ACAD9_HUMAN  Acyl-CoA dehydrogenase fami...  67.8    2e-11  Gene info
gi|54036658|sp|P63428|ACDP_MYCBO  Probable acyl-CoA dehydrogen...  67.8    2e-11
gi|68565360|sp|Q5RBD5|IVD_PONPY  Isovaleryl-CoA dehydrogenase, mi  67.8    3e-11
gi|125051|sp|P26440|IVD_HUMAN  Isovaleryl-CoA dehydrogenase, mito  67.0    4e-11  Gene info
gi|26006699|sp|Q9UKU7|ACAD8_HUMAN  Acyl-CoA dehydrogenase fami...  66.2    6e-11  Gene info
gi|1168281|sp|P45867|ACDA_BACSU  Acyl-CoA dehydrogenase            66.2    8e-11
gi|125052|sp|P12007|IVD_RAT  Isovaleryl-CoA dehydrogenase, mitoch  65.5    1e-10  Gene info
gi|1703067|sp|Q06319|ACDS_MEGEL  Acyl-CoA dehydrogenase, short...  65.1    2e-10
gi|110816334|sp|Q9SWG0|IVD_ARATH  Isovaleryl-CoA dehydrogenase, m  65.1    2e-10  Gene info
gi|66773808|sp|Q9JHI5|IVD_MOUSE  Isovaleryl-CoA dehydrogenase, mi  64.7    2e-10  Gene info
gi|30923365|sp|Q9D7B6|ACAD8_MOUSE  Acyl-CoA dehydrogenase fami...  63.9    3e-10  Gene info
gi|1168283|sp|P45954|ACDSB_HUMAN  Short/branched chain specifi...  63.9    4e-10  Gene info
gi|1168288|sp|P46703|ACDP_MYCLE  Probable acyl-CoA dehydrogenase   62.8    8e-10
gi|71164832|sp|P0A9V0|YDIO_ECO57  Hypothetical protein ydiO >g...  61.6    2e-09
gi|2492630|sp|P70584|ACDSB_RAT  Short/branched chain specific ...  60.1    5e-09  Gene info
gi|116242943|sp|Q0NXR6|ACAD8_BOVIN  Acyl-CoA dehydrogenase fam...  60.1    5e-09  Gene info
gi|29427813|sp|Q8GB20|CAIA_PROSL  Crotonobetainyl-CoA dehydrog...  59.7    7e-09
gi|26006698|sp|Q9DBL1|ACDSB_MOUSE  Short/branched chain specif...  59.3    8e-09  Gene info
gi|21542012|sp|Q8ZRX2|CAIA_SALTY  Crotonobetainyl-CoA dehydrog...  58.2    2e-08
gi|45593149|sp|P60584|CAIA_ECOLI  Crotonobetainyl-CoA dehydrog...  57.0    4e-08
gi|21542008|sp|Q8Z9L2|CAIA_SALTI  Crotonobetainyl-CoA dehydrog...  56.6    6e-08
gi|1703068|sp|P49748|ACADV_HUMAN  Very-long-chain specific acy...  50.8    3e-06  Gene info
gi|32469592|sp|Q8HXY7|ACADV_MACFA  Very-long-chain specific ac...  50.4    4e-06
gi|6648069|sp|P50544|ACADV_MOUSE  Very-long-chain specific acy...  50.4    4e-06  Gene info
gi|110282934|sp|P48818|ACADV_BOVIN  Very-long-chain specific a...  50.4    4e-06
gi|1168287|sp|P45953|ACADV_RAT  Very-long-chain specific acyl-...  49.7    7e-06  Gene info
gi|54039982|sp|P63430|Y897_MYCBO  Hypothetical protein Mb0897 ...  48.1    2e-05
gi|2829492|sp|P71539|ACDC_MYCTU  Acyl-CoA dehydrogenase fadE12     48.1    2e-05
gi|81712141|sp|Q7U0Y2|ACDC_MYCBO  Acyl-CoA dehydrogenase fadE12    47.8    2e-05
gi|113016|sp|P15650|ACADL_RAT  Long-chain specific acyl-CoA de...  47.8    3e-05  Gene info
gi|32130423|sp|P51174|ACADL_MOUSE  Long-chain specific acyl-Co...  47.0    4e-05  Gene info
gi|2829676|sp|P79274|ACADL_PIG  Long-chain specific acyl-CoA d...  43.9    4e-04  Gene info
gi|62510481|sp|Q60HI0|ACADL_MACFA  Long-chain specific acyl-Co...  43.5    5e-04
gi|113015|sp|P28330|ACADL_HUMAN  Long-chain specific acyl-CoA ...  43.5    5e-04  Gene info
gi|20141460|sp|P34275|IVD_CAEEL  Probable isovaleryl-CoA dehydrog  41.2    0.003  Gene info
gi|47605458|sp|Q82HE3|CAPP_STRAW  Phosphoenolpyruvate carboxylase  32.7    0.97 
gi|57012826|sp|Q8DEH6|GLNE_VIBVU  Glutamate-ammonia-ligase ade...  31.6    1.9  
gi|57012803|sp|Q7MNY4|GLNE_VIBVY  Glutamate-ammonia-ligase ade...  31.6    1.9    Gene info
gi|57012872|sp|Q9KPD4|GLNE_VIBCH  Glutamate-ammonia-ligase ade...  31.6    2.0  
gi|8928011|sp|O86170|C19BA_BACUH  Pesticidal crystal protein c...  29.3    8.7  


>gi|117949774|sp|Q709F0|ACD11_HUMAN  Acyl-CoA dehydrogenase family member 11 (ACAD-11)
Length=780

 Score =  159 bits (403),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 86/203 (42%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTG---GDHVEIKYENVRVPLENQLGARGSGHAAAQDR  58
            + I+VP N+PG  IIR + ++G+T    G H EI +  VRVP  N +   G G   +Q R
Sbjct  568  SMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFEIHFNQVRVPATNLILGEGRGFEISQGR  627

Query  59   LGAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLM  118
            LG GR+ HCM ++G   RA  +M +R T R      L + +++  +IA+S I I+  RL+
Sbjct  628  LGPGRIHHCMRTVGLAERALQIMCERATQRIAFKKKLYAHEVVAHWIAESRIAIEKIRLL  687

Query  119  TIHCAEVMDSDGD--PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGA  176
            T+  A  MD+ G    + +I+ IK+  P A+ ++VD AIQV G  GVS D PL  MY   
Sbjct  688  TLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAIT  747

Query  177  RTLRLADGPDEVHRILIAKQILK  199
            R LRLADGPDEVH   IA   L+
Sbjct  748  RVLRLADGPDEVHLSAIATMELR  770


>gi|2833314|sp|Q22347|ACADM_CAEEL Gene info Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial 
precursor (MCAD)
Length=417

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 99/200 (49%), Gaps = 0/200 (0%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGA  61
            T  IV  ++PG    +     G    D   I +E+VRVP EN LGA G+G   A +    
Sbjct  210  TAFIVDGDTPGITRGKKEKNMGQRCSDTRVITFEDVRVPAENVLGAPGAGFKVAMEAFDM  269

Query  62   GRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTIH  121
             R      ++G  WR  D  +K    R+  G ++ + Q +Q  +AD  ++++ ARL+T  
Sbjct  270  TRPGVAAGALGLSWRCLDESAKYALERKAFGTVIANHQAVQFMLADMAVNLELARLITYK  329

Query  122  CAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLRL  181
             A  +D+      + S  K +     ++    A+Q++G  G +++ P+  + + A+  ++
Sbjct  330  SANDVDNKVRSSYNASIAKCFAADTANQAATNAVQIFGGNGFNSEYPVEKLMRDAKIYQI  389

Query  182  ADGPDEVHRILIAKQILKKY  201
             +G  ++ RI+I++ +L  +
Sbjct  390  YEGTSQIQRIVISRMLLGHF  409


>gi|37077871|sp|Q9KJE8|BBSG_THAAR  (R)-benzylsuccinyl-CoA dehydrogenase
Length=406

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 61/198 (30%), Positives = 100/198 (50%), Gaps = 3/198 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGA  61
            T  I+  ++PG  I   +P+ G      V +  +NVRV  E  LG  G      Q+R G 
Sbjct  199  TAFILDKDTPGLRIGAEIPVIGAMPTWSVYL--DNVRVGDEAVLGEVGDAFIPLQNRFGV  256

Query  62   GRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTIH  121
             R+    +  G   R   +M  +   R+  G  L  +Q +Q +IADS I+++  RL    
Sbjct  257  RRIELAAHCTGMAERLIQMMIDQANLRKTFGVALADRQTVQNWIADSTIELEQVRLQLYF  316

Query  122  CAEVMDS-DGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLR  180
             A   D    D R++ +++KI     + RV DRAIQ++G  G+S ++ +  + +  R  R
Sbjct  317  TAWKSDQGHKDLRLEAASLKIAATEMLTRVADRAIQLHGGLGLSREMGIEYVARMVRIWR  376

Query  181  LADGPDEVHRILIAKQIL  198
            + +G  E+HR+ IAK++L
Sbjct  377  VVEGASEIHRMSIAKKLL  394


>gi|1703065|sp|P41367|ACADM_PIG Gene info Medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(MCAD)
Length=421

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 58/202 (28%), Positives = 93/202 (46%), Gaps = 0/202 (0%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGA  61
            T  IV  ++PG  I R     G    D   I +E+VRVP EN L   G+G   A      
Sbjct  220  TGFIVEADTPGVQIGRKEINMGQRCSDTRGIVFEDVRVPKENVLTGEGAGFKIAMGTFDK  279

Query  62   GRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTIH  121
             R      ++G   RA D  +K    R+  G LL   Q I   +AD  + +  ARL    
Sbjct  280  TRPSVAAGAVGLAQRALDEATKYALGRKTFGKLLAEHQGISFLLADMAMKVDLARLSYQR  339

Query  122  CAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLRL  181
             A  +DS        S  K Y     +++   A+QV+G  G + + P+  + + A+  ++
Sbjct  340  AAWEIDSGRRNTYYASIAKAYAADIANQLATDAVQVFGGNGFNTEYPVEKLMRDAKIYQI  399

Query  182  ADGPDEVHRILIAKQILKKYKD  203
             +G  ++ RI+IA++ + +YK+
Sbjct  400  YEGTAQIQRIIIAREHIGRYKN  421


>gi|1168286|sp|P15651|ACADS_RAT Gene info Short-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(SCAD) (Butyryl-CoA dehydrogenase)
Length=412

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 92/202 (45%), Gaps = 0/202 (0%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            ++  +VP  +PG  + +     G        + +E+ R+P EN LG  G G   A   L 
Sbjct  210  ISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAMQTLD  269

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+     ++G    + D   K    R   G  L   Q IQ  +AD  + +++ARL+T 
Sbjct  270  MGRIGIASQALGIAQASLDCAVKYAENRHAFGAPLTKLQNIQFKLADMALALESARLLTW  329

Query  121  HCAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLR  180
              A + D+      + +  K+    A   +  +AIQ+ G  G   ++P    Y+ AR   
Sbjct  330  RAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERYYRDARITE  389

Query  181  LADGPDEVHRILIAKQILKKYK  202
            + +G  E+ R++IA  +L+ Y+
Sbjct  390  IYEGTSEIQRLVIAGHLLRSYR  411


>gi|584714|sp|Q07417|ACADS_MOUSE Gene info Short-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(SCAD) (Butyryl-CoA dehydrogenase)
Length=412

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 94/203 (46%), Gaps = 2/203 (0%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            ++  +VP  +PG  + +     G        + +E+ R+P EN LG  G G   A   L 
Sbjct  210  ISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAMQTLD  269

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+     ++G    + D   K    R   G  L   Q IQ  +AD  + +++ARL+T 
Sbjct  270  MGRIGIASQALGIAQASLDCAVKYAENRNAFGAPLTKLQNIQFKLADMALALESARLLTW  329

Query  121  HCAEVMDSDGDPRVDISAI-KIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTL  179
              A + D+   P    SA+ K+    A   +  +AIQ+ G  G   ++P    Y+ AR  
Sbjct  330  RAAMLKDNK-KPFTKESAMRKLAASEAATAISHQAIQILGSMGYVTEMPAERYYRDARIT  388

Query  180  RLADGPDEVHRILIAKQILKKYK  202
             + +G  E+ R++IA  +L+ Y+
Sbjct  389  EIYEGTSEIQRLVIAGHLLRSYR  411


>gi|13878316|sp|P79273|ACADS_PIG Gene info Short-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(SCAD) (Butyryl-CoA dehydrogenase)
Length=413

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 93/203 (45%), Gaps = 1/203 (0%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            ++  +VP  + G  + +     G        + +E+ R+P EN LG  G G   A   L 
Sbjct  210  ISAFLVPMPTAGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAMKTLD  269

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+     ++G    A D        R   G  L   Q IQ  +AD  + +++ARL+T 
Sbjct  270  MGRIGIASKALGISQAALDCAVNYAENRRAFGVPLTKLQGIQFKLADMALALESARLLTW  329

Query  121  HCAEVMDSDGDPRVDISAI-KIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTL  179
              A + D+  +P +   A+ K+    A   +  +AIQ+ G  G   ++P    Y+ AR  
Sbjct  330  RAAMLKDNKKNPFIKEPAMAKLAASEAATAITHQAIQILGGMGYVTEMPAERHYRDARIT  389

Query  180  RLADGPDEVHRILIAKQILKKYK  202
             + +G  E+ R++IA  +LK Y+
Sbjct  390  EIYEGTSEIQRLVIAGHLLKSYR  412


>gi|113019|sp|P16219|ACADS_HUMAN Gene info Short-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(SCAD) (Butyryl-CoA dehydrogenase)
Length=412

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 93/202 (46%), Gaps = 0/202 (0%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            ++  +VP  +PG  + +     G  G     + +E+ R+P ++ LG  G G   A   L 
Sbjct  210  ISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTLD  269

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+     ++G    A D        R   G  L   Q+IQ  +AD  + +++ARL+T 
Sbjct  270  MGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTW  329

Query  121  HCAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLR  180
              A + D+      + +  K+    A   +  +AIQ+ G  G   ++P    Y+ AR   
Sbjct  330  RAAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITE  389

Query  181  LADGPDEVHRILIAKQILKKYK  202
            + +G  E+ R++IA  +L+ Y+
Sbjct  390  IYEGTSEIQRLVIAGHLLRSYR  411


>gi|25453062|sp|Q9FS88|IVD1_SOLTU  Isovaleryl-CoA dehydrogenase 1, mitochondrial precursor (IVD 
1)
Length=412

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 90/200 (45%), Gaps = 2/200 (1%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            +T  I+    PGF+  + +   G  G D  E+ +EN  VP EN LG  G G       L 
Sbjct  212  ITAFIIEKEMPGFSTAQKLDKLGMRGSDTCELVFENCFVPKENVLGQEGKGVYVLMSGLD  271

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
              R+      +G M    D++      RE  G  +   Q+IQG +AD Y  +Q++R    
Sbjct  272  LERLVLAAGPVGIMQACMDIVIPYVRQREQFGRPIGEFQLIQGKLADMYTALQSSRSYVY  331

Query  121  HCAEVMDSDG-DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTL  179
              A+  D+   DP+ D S   +       +V  +AIQ  G  G   + P   + + A+  
Sbjct  332  AVAKDCDNGKIDPK-DCSGTILLAAERATQVALQAIQCLGGNGYINEYPTGRLLRDAKMY  390

Query  180  RLADGPDEVHRILIAKQILK  199
             +A G  E+ R++I +++ K
Sbjct  391  EIAAGTSEIRRLVIGRELFK  410


>gi|1168284|sp|P45952|ACADM_MOUSE Gene info Medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(MCAD)
Length=421

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 96/202 (47%), Gaps = 0/202 (0%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGA  61
            T  IV  ++PG +I +     G    D   I +E+VRVP EN L   G+G   A      
Sbjct  220  TGFIVEADTPGIHIGKKELNMGQRCSDTRGIAFEDVRVPKENVLIGEGAGFKIAMGAFDR  279

Query  62   GRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTIH  121
             R      ++G   RA D  +K    R+  G LL   Q +   +A+  + ++ ARL    
Sbjct  280  TRPTVAAGAVGLAQRALDEATKYALDRKTFGKLLVEHQGVSFLLAEMAMKVELARLSYQR  339

Query  122  CAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLRL  181
             A  +DS        S  K +     +++   A+Q++G  G + + P+  + + A+  ++
Sbjct  340  AAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQIFGGYGFNTEYPVEKLMRDAKIYQI  399

Query  182  ADGPDEVHRILIAKQILKKYKD  203
             +G  ++ R++IA++ ++KYK+
Sbjct  400  YEGTAQIQRLIIAREHIEKYKN  421


>gi|113018|sp|P08503|ACADM_RAT Gene info Medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(MCAD)
Length=421

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 96/202 (47%), Gaps = 0/202 (0%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGA  61
            T  IV  ++PG +I +     G    D   I +E+VRVP EN L   G+G   A      
Sbjct  220  TGFIVEADTPGIHIGKKELNMGQRCSDTRGITFEDVRVPKENVLIGEGAGFKIAMGAFDR  279

Query  62   GRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTIH  121
             R      ++G   RA D  +K    R+  G LL   Q +   +A+  + ++ ARL    
Sbjct  280  TRPTVAAGAVGLAQRALDEATKYALDRKTFGKLLVEHQGVSFLLAEMAMKVELARLSYQR  339

Query  122  CAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLRL  181
             A  +DS        S  K +     +++   A+Q++G  G + + P+  + + A+  ++
Sbjct  340  AAWEVDSGRRNTYFASIAKAFAGDIANQLATDAVQIFGGYGFNTEYPVEKLMRDAKIYQI  399

Query  182  ADGPDEVHRILIAKQILKKYKD  203
             +G  ++ R++IA++ ++KYK+
Sbjct  400  YEGTAQIQRLIIAREHIEKYKN  421


>gi|113017|sp|P11310|ACADM_HUMAN Gene info Medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor 
(MCAD)
Length=421

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 93/202 (46%), Gaps = 0/202 (0%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLGA  61
            T  IV  ++PG  I R     G    D   I +E+V+VP EN L   G+G   A      
Sbjct  220  TGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDK  279

Query  62   GRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTIH  121
             R      ++G   RA D  +K    R+  G LL   Q I   +A+  + ++ AR+    
Sbjct  280  TRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQR  339

Query  122  CAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLRL  181
             A  +DS        S  K +     +++   A+Q+ G  G + + P+  + + A+  ++
Sbjct  340  AAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQI  399

Query  182  ADGPDEVHRILIAKQILKKYKD  203
             +G  ++ R+++A++ + KYK+
Sbjct  400  YEGTSQIQRLIVAREHIDKYKN  421


>gi|33518614|sp|P45857|ACDB_BACSU  Acyl-CoA dehydrogenase
Length=378

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 51/198 (25%), Positives = 92/198 (46%), Gaps = 1/198 (0%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            ++  IV  N+PGF + +     G  G +  E+ ++N  VP  N LG  G G   A   L 
Sbjct  179  ISAFIVEKNTPGFTVGKKERKLGLYGSNTTELIFDNAEVPEANLLGKEGDGFHIAMANLN  238

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+     ++G    A +        R   G  + + Q I   +AD     + AR +  
Sbjct  239  VGRIGIAAQALGIAEAALEHAVDYAKQRVQFGRPIAANQGISFKLADMATRAEAARHLVY  298

Query  121  HCAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLR  180
            H A++ +   +   + S  K +   A  + +D A+Q+YG  G   D P+  + + A+  +
Sbjct  299  HAADLHNRGLNCGKEASMAKQFASDAAVKALD-AVQIYGGYGYMKDYPVERLLRDAKVTQ  357

Query  181  LADGPDEVHRILIAKQIL  198
            + +G +E+ R++I+K +L
Sbjct  358  IYEGTNEIQRLIISKYLL  375

**************************************************************************************

BLASTP 2.2.15 [Oct-15-2006]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1164106419-16596-82086932744.BLASTQ2


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,180,857 sequences; 1,439,539,050 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports
Query= Translation of ORF number 1 in reading frame 1 on the reverse strand. Length=211 


Sequences producing significant alignments:                        (Bits)  Value

gi|113937781|ref|ZP_01423654.1|  acyl-CoA dehydrogenase-like [...   198    1e-49
gi|62423268|ref|ZP_00378435.1|  COG1960: Acyl-CoA dehydrogenases    183    5e-45
gi|68535294|ref|YP_249999.1|  acyl-CoA dehydrogenase [Coryneba...   182    7e-45  Gene info
gi|23098129|ref|NP_691595.1|  acyl-CoA dehydrogenase [Oceanoba...   182    1e-44  Gene info
gi|89099721|ref|ZP_01172594.1|  acyl-CoA dehydrogenase [Bacill...   180    4e-44
gi|56419563|ref|YP_146881.1|  acyl-CoA dehydrogenase [Geobacil...   179    8e-44  Gene info
gi|108805220|ref|YP_645157.1|  acyl-CoA dehydrogenase-like pro...   178    1e-43  Gene info
gi|92914709|ref|ZP_01283335.1|  Acyl-CoA dehydrogenase-like:Ac...   178    1e-43
gi|111019333|ref|YP_702305.1|  acyl-CoA dehydrogenase [Rhodoco...   178    2e-43  Gene info
gi|118168739|gb|ABK69635.1|  putative acyl-CoA dehydrogenase [...   177    2e-43
gi|111018504|ref|YP_701476.1|  acyl-CoA dehydrogenase [Rhodoco...   177    2e-43  Gene info
gi|92908225|ref|ZP_01277004.1|  Acyl-CoA dehydrogenase-like:Ac...   177    3e-43
gi|90203150|ref|ZP_01205796.1|  Acyl-CoA dehydrogenase-like:Ac...   176    5e-43
gi|111019687|ref|YP_702659.1|  acyl-CoA dehydrogenase [Rhodoco...   176    7e-43  Gene info
gi|104782388|ref|YP_608886.1|  acyl-CoA dehydrogenase [Pseudom...   175    1e-42  Gene info
gi|77459873|ref|YP_349380.1|  Acyl-CoA dehydrogenase-like [Pse...   175    1e-42  Gene info
gi|68227750|ref|ZP_00566955.1|  Acyl-CoA dehydrogenase, C-term...   174    2e-42
gi|70731290|ref|YP_261031.1|  acyl-CoA dehydrogenase family pr...   174    2e-42  Gene info
gi|66045710|ref|YP_235551.1|  Acyl-CoA dehydrogenase, C-termin...   174    2e-42  Gene info
gi|29827922|ref|NP_822556.1|  acyl-CoA dehydrogenase [Streptom...   174    3e-42  Gene info
gi|89339798|ref|ZP_01192396.1|  Acyl-CoA dehydrogenase-like:Ac...   174    3e-42
gi|26989160|ref|NP_744585.1|  acyl-CoA dehydrogenase, putative...   173    4e-42  Gene info
gi|110833818|ref|YP_692677.1|  acyl-CoA dehydrogenase [Alcaniv...   172    7e-42  Gene info
gi|28869932|ref|NP_792551.1|  acyl-CoA dehydrogenase family pr...   172    9e-42  Gene info
gi|111025220|ref|YP_707640.1|  acyl-CoA dehydrogenase [Rhodoco...   172    1e-41  Gene info
gi|71733582|ref|YP_274823.1|  acyl-CoA dehydrogenase family pr...   172    1e-41  Gene info
gi|89899822|ref|YP_522293.1|  acyl-CoA dehydrogenase-like [Rho...   171    2e-41  Gene info
gi|82734989|ref|ZP_00897852.1|  acyl-CoA dehydrogenase, putati...   171    2e-41
gi|62426188|ref|ZP_00381317.1|  COG1960: Acyl-CoA dehydrogenases    170    4e-41
gi|90426170|ref|YP_534540.1|  acyl-CoA dehydrogenase-like [Rho...   170    4e-41  Gene info
gi|116050494|ref|YP_790687.1|  putative acyl-CoA dehydrogenase...   170    5e-41  Gene info
gi|15597746|ref|NP_251240.1|  probable acyl-CoA dehydrogenase ...   170    5e-41  Gene info
gi|39933857|ref|NP_946133.1|  possible acyl-CoA dehydrogenase ...   169    5e-41  Gene info
gi|94415006|ref|ZP_01294858.1|  hypothetical protein PaerP_010...   169    5e-41
gi|89902097|ref|YP_524568.1|  acyl-CoA dehydrogenase-like [Rho...   169    5e-41  Gene info
gi|94309913|ref|YP_583123.1|  acyl-CoA dehydrogenase-like prot...   169    7e-41  Gene info
gi|21220185|ref|NP_625964.1|  acyl-CoA dehydrogenase [Streptom...   169    1e-40  Gene info
gi|83649261|ref|YP_437696.1|  Acyl-CoA dehydrogenase [Hahella ...   168    1e-40  Gene info
gi|113867111|ref|YP_725600.1|  FadE2-like Acyl-CoA dehydrogena...   168    2e-40  Gene info
gi|84320720|ref|ZP_00969091.1|  COG1960: Acyl-CoA dehydrogenases    168    2e-40
gi|114563240|ref|YP_750753.1|  acyl-CoA dehydrogenase domain p...   167    2e-40  Gene info
gi|118058513|ref|ZP_01526974.1|  acyl-CoA dehydrogenase-like [...   167    2e-40
gi|110594979|ref|ZP_01383318.1|  Acyl-CoA dehydrogenase, type ...   167    2e-40
gi|15807862|ref|NP_285519.1|  acyl-CoA dehydrogenase, putative...   167    4e-40  Gene info
gi|83943365|ref|ZP_00955824.1|  acyl-CoA dehydrogenase [Sulfit...   166    5e-40
gi|73540705|ref|YP_295225.1|  Acyl-CoA dehydrogenase, C-termin...   166    5e-40  Gene info
gi|115953189|ref|XP_781501.2|  PREDICTED: hypothetical protein...   166    6e-40  Gene info
gi|91975247|ref|YP_567906.1|  acyl-CoA dehydrogenase-like [Rho...   166    6e-40  Gene info
gi|38637886|ref|NP_942860.1|  probable acyl-coa dehydrogenase ...   166    7e-40  Gene info
gi|115522914|ref|YP_779825.1|  acyl-CoA dehydrogenase domain p...   166    7e-40  Gene info
gi|87121451|ref|ZP_01077340.1|  acyl-CoA dehydrogenase, putati...   166    9e-40
gi|29833156|ref|NP_827790.1|  acyl-CoA dehydrogenase [Streptom...   166    1e-39  Gene info
gi|88705664|ref|ZP_01103374.1|  acyl-CoA dehydrogenase [gamma ...   165    1e-39
gi|94971867|ref|YP_593907.1|  acyl-CoA dehydrogenase-like [Dei...   164    2e-39  Gene info
gi|113942695|ref|ZP_01428399.1|  acyl-CoA dehydrogenase-like [...   164    3e-39
gi|71368122|ref|ZP_00658630.1|  Acyl-CoA dehydrogenase, C-term...   164    3e-39
gi|114646994|ref|XP_001146847.1|  PREDICTED: acyl-Coenzyme A d...   163    4e-39  Gene info
gi|115941654|ref|XP_001188381.1|  PREDICTED: similar to ACAD 10 [   163    4e-39  Gene info
gi|115673309|ref|XP_792854.2|  PREDICTED: similar to ACAD 10, ...   163    4e-39  Gene info
gi|114646976|ref|XP_001147201.1|  PREDICTED: acyl-Coenzyme A d...   163    6e-39  Gene info
gi|109098764|ref|XP_001109257.1|  PREDICTED: similar to acyl-C...   163    6e-39  Gene info
gi|114646982|ref|XP_001147274.1|  PREDICTED: acyl-Coenzyme A d...   162    7e-39  Gene info
gi|114646978|ref|XP_001147058.1|  PREDICTED: acyl-Coenzyme A d...   162    7e-39  Gene info
gi|30794396|ref|NP_082313.1|  acyl-Coenzyme A dehydrogenase fa...   162    7e-39  UniGene infoGene info
gi|48976061|ref|NP_079523.3|  acyl-Coenzyme A dehydrogenase fa...   162    7e-39  UniGene infoGene info
gi|114646992|ref|XP_001146923.1|  PREDICTED: acyl-Coenzyme A d...   162    8e-39  Gene info
gi|12846107|dbj|BAB27033.1|  unnamed protein product [Mus musculu   162    9e-39  UniGene infoGene info
gi|20379980|gb|AAH27825.1|  Acad10 protein [Mus musculus]           162    9e-39  UniGene infoGene info
gi|115736730|ref|XP_001201686.1|  PREDICTED: hypothetical prot...   162    9e-39  Gene info
gi|84500488|ref|ZP_00998737.1|  acyl-CoA dehydrogenase [Oceani...   162    1e-38
gi|68228590|ref|ZP_00567792.1|  Acyl-CoA dehydrogenase, C-term...   162    1e-38
gi|22137453|gb|AAH29047.1|  Acad10 protein [Mus musculus]           162    1e-38  UniGene infoGene info
gi|89289725|gb|EAR87713.1|  Acyl-CoA dehydrogenase, C-terminal...   162    1e-38
gi|114589447|ref|XP_516758.2|  PREDICTED: nephronophthisis 3 [Pan   161    2e-38  Gene info
gi|91788821|ref|YP_549773.1|  acyl-CoA dehydrogenase-like [Pol...   160    2e-38  Gene info
gi|54025377|ref|YP_119619.1|  putative acyl-CoA dehydrogenase ...   160    3e-38  Gene info
gi|89361575|ref|ZP_01199389.1|  possible acyl-CoA dehydrogenas...   160    3e-38
gi|72162884|ref|YP_290541.1|  acyl-CoA dehydrogenase [Thermobi...   160    4e-38  Gene info
gi|68403810|ref|XP_702243.1|  PREDICTED: hypothetical protein XP_   160    4e-38  Gene info
gi|73990088|ref|XP_863961.1|  PREDICTED: similar to nephronoph...   160    4e-38  UniGene infoGene info
gi|73990086|ref|XP_863943.1|  PREDICTED: similar to nephronoph...   160    4e-38  UniGene infoGene info
gi|73990084|ref|XP_863920.1|  PREDICTED: similar to putative a...   160    4e-38  UniGene infoGene info
gi|86751739|ref|YP_488235.1|  Acyl-CoA dehydrogenase-like [Rho...   160    5e-38  Gene info
gi|54024468|ref|YP_118710.1|  putative acyl-CoA dehydrogenase ...   160    5e-38  Gene info
gi|111620450|ref|ZP_01407433.1|  Acyl-CoA dehydrogenase, type ...   160    5e-38
gi|71366279|ref|ZP_00656823.1|  Acyl-CoA dehydrogenase, C-term...   160    5e-38
gi|55731336|emb|CAH92382.1|  hypothetical protein [Pongo pygmaeus   159    6e-38
gi|88712149|ref|ZP_01106236.1|  acyl-CoA dehydrogenase domain ...   159    6e-38
gi|117949774|sp|Q709F0|ACD11_HUMAN  Acyl-CoA dehydrogenase family   159    7e-38
gi|38490142|emb|CAE55233.1|  putative acyl-CoA dehydrogenase [Hom   159    7e-38  UniGene infoGene info
gi|38505218|ref|NP_115545.3|  putative acyl-CoA dehydrogenase ...   159    7e-38  UniGene infoGene info
gi|52545808|emb|CAH56228.1|  hypothetical protein [Homo sapiens]    159    7e-38  UniGene infoGene info
gi|115497350|ref|NP_001069361.1|  hypothetical protein LOC5269...   159    7e-38  Gene info
gi|48257226|gb|AAH19607.2|  ACAD11 protein [Homo sapiens]           159    7e-38  UniGene infoGene info
gi|111020948|ref|YP_703920.1|  acyl-CoA dehydrogenase [Rhodoco...   159    8e-38  Gene info
gi|55725322|emb|CAH89526.1|  hypothetical protein [Pongo pygmaeus   159    9e-38
gi|109483901|ref|XP_236582.4|  PREDICTED: similar to acyl-Coen...   159    9e-38  Gene info
gi|68231131|ref|ZP_00570304.1|  Acyl-CoA dehydrogenase, C-term...   159    1e-37
gi|114799393|ref|YP_761449.1|  acyl-CoA dehydrogenase family p...   159    1e-37  Gene info
gi|57530751|ref|NP_001006367.1|  acyl-Coenzyme A dehydrogenase...   159    1e-37  UniGene infoGene info
gi|17546739|ref|NP_520141.1|  PROBABLE ACYL-COA DEHYDROGENASE ...   158    1e-37  Gene info
gi|115359826|ref|YP_776964.1|  acyl-CoA dehydrogenase domain p...   158    1e-37  Gene info
gi|76639039|ref|XP_591198.2|  PREDICTED: similar to acyl-Coenz...   158    1e-37  Gene info
gi|114798453|ref|YP_761474.1|  putative acyl-CoA dehydrogenase...   158    1e-37  Gene info
gi|118028723|ref|ZP_01500185.1|  acyl-CoA dehydrogenase-like [...   158    2e-37
gi|117558449|gb|AAI25797.1|  Unknown (protein for IMAGE:7846976)    158    2e-37
gi|109495979|ref|XP_222190.4|  PREDICTED: similar to acyl-Coen...   158    2e-37  Gene info
gi|10434173|dbj|BAB14158.1|  unnamed protein product [Homo sapien   158    2e-37  UniGene infoGene info
gi|91780658|ref|YP_555865.1|  Putative acyl-CoA dehydrogenase ...   158    2e-37  Gene info
gi|83859472|ref|ZP_00952993.1|  acyl-CoA dehydrogenase family ...   158    2e-37
gi|76639041|ref|XP_588758.2|  PREDICTED: similar to acyl-Coenz...   158    2e-37  Gene info
gi|91782638|ref|YP_557844.1|  Putative acyl-CoA dehydrogenase ...   157    2e-37  Gene info
gi|41055756|ref|NP_956472.1|  hypothetical protein LOC393147 [...   157    2e-37  UniGene infoGene info
gi|68234716|ref|ZP_00573781.1|  Acyl-CoA dehydrogenase, C-term...   157    2e-37
gi|85704734|ref|ZP_01035835.1|  acyl-CoA dehydrogenase family ...   157    2e-37
gi|114570201|ref|YP_756881.1|  acyl-CoA dehydrogenase domain p...   157    2e-37  Gene info
gi|76671086|ref|XP_611873.2|  PREDICTED: similar to putative a...   157    3e-37  Gene info
gi|111222973|ref|YP_713767.1|  acyl-CoA dehydrogenase [Frankia...   157    4e-37  Gene info
gi|118039158|ref|ZP_01510560.1|  acyl-CoA dehydrogenase-like [...   157    4e-37
gi|83748057|ref|ZP_00945086.1|  Acyl-CoA dehydrogenase [Ralsto...   156    5e-37
gi|83955055|ref|ZP_00963711.1|  acyl-CoA dehydrogenase [Sulfit...   156    5e-37
gi|83944078|ref|ZP_00956534.1|  acyl-CoA dehydrogenase [Sulfit...   156    5e-37
gi|115528754|gb|AAI25206.1|  ACAD11 protein [Homo sapiens]          156    6e-37  Gene info
gi|109049352|ref|XP_001115440.1|  PREDICTED: similar to nephronop   156    6e-37  Gene info
gi|62825972|gb|AAH94170.1|  LOC733224 protein [Xenopus laevis]      156    6e-37  UniGene infoGene info
gi|67544465|ref|ZP_00422393.1|  Acyl-CoA dehydrogenase, C-term...   156    7e-37
gi|111611522|ref|ZP_01398611.1|  acyl-CoA dehydrogenase domain...   155    8e-37
gi|27378100|ref|NP_769629.1|  putative acyl-CoA dehydrogenase ...   155    9e-37  Gene info
gi|87200524|ref|YP_497781.1|  acyl-CoA dehydrogenase-like [Nov...   155    9e-37  Gene info
gi|16124943|ref|NP_419507.1|  acyl-CoA dehydrogenase family pr...   155    1e-36  Gene info
gi|86139185|ref|ZP_01057755.1|  acyl-CoA dehydrogenase family ...   155    1e-36
gi|89902449|ref|YP_524920.1|  acyl-CoA dehydrogenase-like [Rho...   155    1e-36  Gene info
gi|84712608|ref|ZP_01020488.1|  probable acyl-CoA dehydrogenas...   155    1e-36
gi|83718895|ref|YP_441636.1|  acyl-CoA dehydrogenase domain pr...   155    1e-36  Gene info
gi|85374751|ref|YP_458813.1|  acyl-CoA dehydrogenase family pr...   155    2e-36  Gene info
gi|84353392|ref|ZP_00978324.1|  COG1960: Acyl-CoA dehydrogenas...   155    2e-36
gi|118051301|ref|ZP_01519850.1|  acyl-CoA dehydrogenase-like [...   155    2e-36
gi|111021725|ref|YP_704697.1|  acyl-CoA dehydrogenase [Rhodoco...   154    2e-36  Gene info
gi|107027353|ref|YP_624864.1|  acyl-CoA dehydrogenase-like [Bu...   154    2e-36  Gene info
gi|89340406|ref|ZP_01192678.1|  Acyl-CoA dehydrogenase-like:Ac...   154    2e-36
gi|92911085|ref|ZP_01279859.1|  Acyl-CoA dehydrogenase-like:Ac...   154    2e-36
gi|94499124|ref|ZP_01305662.1|  Acyl-CoA dehydrogenase [Oceano...   154    3e-36
gi|111222473|ref|YP_713267.1|  acyl-CoA dehydrogenase [Frankia...   154    3e-36  Gene info
gi|78063881|ref|YP_373789.1|  Acyl-CoA dehydrogenase [Burkhold...   154    3e-36  Gene info
gi|77955634|ref|ZP_00819989.1|  acyl-CoA dehydrogenase domain ...   154    3e-36
gi|71366044|ref|ZP_00656591.1|  Acyl-CoA dehydrogenase, C-term...   153    4e-36
gi|88795132|ref|ZP_01110833.1|  putative acyl-CoA dehydrogenas...   153    5e-36
gi|108759582|ref|YP_634032.1|  acyl-CoA dehydrogenase family p...   153    6e-36  Gene info
gi|86134543|ref|ZP_01053125.1|  acyl-CoA dehydrogenase [Tenaci...   152    7e-36
gi|56695781|ref|YP_166132.1|  acyl-CoA dehydrogenase family pr...   152    8e-36  Gene info
gi|56697385|ref|YP_167753.1|  acyl-CoA dehydrogenase famiy pro...   152    8e-36  Gene info
gi|114797831|ref|YP_761451.1|  acyl-CoA dehydrogenase family p...   152    9e-36  Gene info
gi|47223424|emb|CAG04285.1|  unnamed protein product [Tetraodon n   152    1e-35
gi|109900082|ref|YP_663337.1|  acyl-CoA dehydrogenase-like [Ps...   152    1e-35  Gene info
gi|50085027|ref|YP_046537.1|  putative acyl-CoA dehydrogenase ...   151    1e-35  Gene info
gi|74271799|ref|NP_780533.2|  acyl-Coenzyme A dehydrogenase fa...   151    2e-35  UniGene infoGene info
gi|28280023|gb|AAH45199.1|  Acyl-Coenzyme A dehydrogenase family,   151    2e-35  UniGene infoGene info
gi|84701545|ref|ZP_01016120.1|  putative acyl-CoA dehydrogenas...   151    2e-35
gi|92909978|ref|ZP_01278755.1|  Acyl-CoA dehydrogenase-like:Ac...   151    2e-35
gi|39936352|ref|NP_948628.1|  acyl-CoA dehydrogenase [Rhodopse...   150    3e-35  Gene info
gi|103486350|ref|YP_615911.1|  acyl-CoA dehydrogenase-like pro...   150    3e-35  Gene info
gi|90417435|ref|ZP_01225359.1|  putative acyl-CoA dehydrogenas...   150    3e-35
gi|15607273|ref|NP_214645.1|  PROBABLE ACYL-CoA DEHYDROGENASE ...   150    3e-35  Gene info
gi|27378966|ref|NP_770495.1|  putative acyl-CoA dehydrogenase ...   150    4e-35  Gene info
gi|115372087|ref|ZP_01459398.1|  acyl-CoA dehydrogenase [Stigm...   150    4e-35
gi|113935586|ref|ZP_01421483.1|  Acyl-CoA dehydrogenase, type ...   150    4e-35
gi|78367585|ref|ZP_00837851.1|  Acyl-CoA dehydrogenase, C-term...   149    6e-35
gi|68228873|ref|ZP_00568073.1|  Aminoglycoside phosphotransfer...   149    7e-35
gi|54025514|ref|YP_119756.1|  putative acyl-CoA dehydrogenase ...   149    7e-35  Gene info
gi|15607296|ref|NP_214668.1|  PROBABLE ACYL-CoA DEHYDROGENASE ...   149    7e-35  Gene info
gi|15839536|ref|NP_334573.1|  acyl-CoA dehydrogenase, putative...   149    7e-35  Gene info
gi|90202103|ref|ZP_01204749.1|  Acyl-CoA dehydrogenase-like:Ac...   149    8e-35
gi|84684281|ref|ZP_01012183.1|  acyl-CoA dehydrogenase [Rhodob...   149    1e-34
gi|84515435|ref|ZP_01002797.1|  acyl-CoA dehydrogenase [Loktan...   148    1e-34
gi|100124156|ref|ZP_01329715.1|  hypothetical protein BpseS_03...   148    1e-34
gi|67736855|ref|ZP_00487688.1|  COG1960: Acyl-CoA dehydrogenas...   148    1e-34
gi|53725786|ref|YP_103412.1|  acyl-CoA dehydrogenase domain pr...   148    1e-34  Gene info
gi|53718869|ref|YP_107855.1|  putative acyl-CoA dehydrogenase ...   148    1e-34  Gene info
gi|118171837|gb|ABK72733.1|  putative acyl-CoA dehydrogenase [...   148    2e-34
gi|47575441|ref|ZP_00245476.1|  COG1960: Acyl-CoA dehydrogenases    148    2e-34
gi|54024237|ref|YP_118479.1|  putative acyl-CoA dehydrogenase ...   147    2e-34  Gene info
gi|27378051|ref|NP_769580.1|  acyl-CoA dehydrogenase [Bradyrhi...   147    3e-34  Gene info
gi|114770629|ref|ZP_01448119.1|  Acyl-CoA dehydrogenase [alpha...   147    3e-34
gi|87199018|ref|YP_496275.1|  acyl-CoA dehydrogenase-like [Nov...   147    3e-34  Gene info
gi|41409220|ref|NP_962056.1|  FadE1_2 [Mycobacterium avium sub...   147    4e-34  Gene info
gi|91977677|ref|YP_570336.1|  acyl-CoA dehydrogenase-like [Rho...   146    5e-34  Gene info
gi|113934274|ref|ZP_01420175.1|  Acyl-CoA dehydrogenase, type ...   146    5e-34
gi|118034810|ref|ZP_01506236.1|  acyl-CoA dehydrogenase-like [...   146    5e-34
gi|41409637|ref|NP_962473.1|  FadE1_3 [Mycobacterium avium sub...   146    7e-34  Gene info
gi|56460595|ref|YP_155876.1|  Acyl-CoA dehydrogenase [Idiomari...   145    1e-33  Gene info
gi|39937063|ref|NP_949339.1|  putative acyl-CoA dehydrogenase ...   145    1e-33  Gene info
gi|41409668|ref|NP_962504.1|  FadE2 [Mycobacterium avium subsp...   145    1e-33  Gene info
gi|118163680|gb|ABK64577.1|  putative acyl-CoA dehydrogenase [Myc   145    2e-33
gi|118168260|gb|ABK69157.1|  putative acyl-CoA dehydrogenase [Myc   144    2e-33
gi|91975728|ref|YP_568387.1|  acyl-CoA dehydrogenase-like [Rho...   144    3e-33  Gene info
gi|109898132|ref|YP_661387.1|  acyl-CoA dehydrogenase-like [Ps...   144    3e-33  Gene info
gi|116327431|ref|YP_797151.1|  Acyl-CoA dehydrogenase, carniti...   144    3e-33  Gene info
gi|24216062|ref|NP_713543.1|  Acyl-CoA dehydrogenase [Leptospi...   143    4e-33  Gene info
gi|85710745|ref|ZP_01041809.1|  acyl-CoA dehydrogenase [Erythr...   143    4e-33
gi|110679346|ref|YP_682353.1|  acyl-CoA dehydrogenase family p...   143    5e-33  Gene info
gi|88938696|ref|ZP_01144149.1|  Acyl-CoA dehydrogenases-like [...   142    8e-33
gi|115525618|ref|YP_782529.1|  acyl-CoA dehydrogenase domain p...   142    8e-33  Gene info
gi|78692751|ref|ZP_00857265.1|  putative acyl-CoA dehydrogenas...   142    9e-33
gi|90420433|ref|ZP_01228340.1|  acyl-CoA dehydrogenase [Aurant...   142    9e-33
gi|84499631|ref|ZP_00997919.1|  putative acyl-CoA dehydrogenas...   142    1e-32
gi|90417081|ref|ZP_01225009.1|  acyl-CoA dehydrogenase family ...   142    1e-32
gi|111026421|ref|YP_708704.1|  acyl-CoA dehydrogenase [Rhodoco...   141    2e-32  Gene info
gi|13472711|ref|NP_104278.1|  acyl-CoA dehydrogenase [Mesorhiz...   141    2e-32  Gene info
gi|27380566|ref|NP_772095.1|  putative acyl-CoA dehydrogenase ...   141    2e-32  Gene info
gi|93006013|ref|YP_580450.1|  acyl-CoA dehydrogenase-like [Psy...   141    2e-32  Gene info
gi|94497662|ref|ZP_01304230.1|  acyl-CoA dehydrogenase [Sphing...   141    2e-32
gi|86748271|ref|YP_484767.1|  Acyl-CoA dehydrogenase-like [Rho...   141    2e-32  Gene info
gi|116501672|gb|EAU84567.1|  hypothetical protein CC1G_00086 [...   140    3e-32
gi|91770552|ref|ZP_01272377.1|  Acyl-CoA dehydrogenase-like:Ac...   140    3e-32
gi|86749380|ref|YP_485876.1|  Acyl-CoA dehydrogenase-like [Rho...   140    4e-32  Gene info
gi|88706849|ref|ZP_01104549.1|  acyl-CoA dehydrogenase [gamma ...   140    4e-32
gi|114563385|ref|YP_750898.1|  acyl-CoA dehydrogenase domain p...   139    8e-32  Gene info
gi|90424971|ref|YP_533341.1|  acyl-CoA dehydrogenase-like [Rho...   138    1e-31  Gene info
gi|109896963|ref|YP_660218.1|  acyl-CoA dehydrogenase-like [Ps...   138    2e-31  Gene info
gi|114800028|ref|YP_759246.1|  acyl-CoA dehydrogenase [Hyphomo...   137    2e-31  Gene info
gi|89055302|ref|YP_510753.1|  acyl-CoA dehydrogenase-like [Jan...   136    5e-31  Gene info
gi|46121523|ref|XP_385316.1|  hypothetical protein FG05140.1 [...   136    6e-31  Gene info
gi|114765271|ref|ZP_01444403.1|  acyl-CoA dehydrogenase [Roseo...   136    6e-31
gi|114761377|ref|ZP_01441292.1|  acyl-CoA dehydrogenase [Roseo...   134    2e-30
gi|39948169|ref|XP_363077.1|  hypothetical protein MG08661.4 [Mag   134    2e-30  UniGene infoGene info
gi|85711258|ref|ZP_01042317.1|  Acyl-CoA dehydrogenase [Idioma...   134    3e-30
gi|84497450|ref|ZP_00996272.1|  acyl-CoA dehydrogenase domain ...   133    4e-30
gi|37963660|gb|AAR05956.1|  ORFH [Sphingomonas paucimobilis]        133    5e-30
gi|111020082|ref|YP_703054.1|  probable acyl-CoA dehydrogenase...   133    5e-30  Gene info
gi|76801526|ref|YP_326534.1|  acyl-CoA dehydrogenase 11 [Natro...   132    1e-29  Gene info
gi|103488550|ref|YP_618111.1|  acyl-CoA dehydrogenase-like pro...   132    1e-29  Gene info
gi|94310752|ref|YP_583962.1|  acyl-CoA dehydrogenase-like prot...   131    2e-29  Gene info
gi|17562446|ref|NP_504508.1|  K09H11.1 [Caenorhabditis elegans...   131    2e-29  UniGene infoGene info
gi|27378415|ref|NP_769944.1|  acyl-CoA dehydrogenase [Bradyrhi...   131    3e-29  Gene info
gi|39593107|emb|CAE64576.1|  Hypothetical protein CBG09328 [Caeno   130    3e-29
gi|67523617|ref|XP_659868.1|  hypothetical protein AN2264.2 [A...   130    3e-29  Gene info
gi|90300918|gb|EAS30549.1|  hypothetical protein CIMG_06028 [Cocc   130    4e-29
gi|111062010|gb|EAT83130.1|  hypothetical protein SNOG_09865 [Pha   130    4e-29
gi|115474041|ref|NP_001060619.1|  Os07g0675000 [Oryza sativa (...   129    8e-29  Gene info
gi|30680020|ref|NP_187337.2|  ATP binding / acyl-CoA dehydroge...   129    1e-28  UniGene infoGene info
gi|51970186|dbj|BAD43785.1|  unnamed protein product [Arabidopsis   129    1e-28  UniGene info
gi|110739702|dbj|BAF01758.1|  putative acetyl-coA dehydrogenase [   129    1e-28
gi|55978198|ref|YP_145254.1|  putative acyl-CoA dehydrogenase ...   129    1e-28  Gene info
gi|83719419|ref|YP_442883.1|  acyl-CoA dehydrogenase domain pr...   128    1e-28  Gene info
gi|88792769|ref|ZP_01108487.1|  Acyl-CoA dehydrogenase [Altero...   128    2e-28
gi|85103572|ref|XP_961547.1|  hypothetical protein [Neurospora...   127    3e-28  Gene info
gi|116199143|ref|XP_001225383.1|  conserved hypothetical prote...   127    3e-28  Gene info
gi|7549632|gb|AAF63817.1|  acetyl-coA dehydrogenase, putative [Ar   127    3e-28
gi|83717585|ref|YP_438720.1|  acyl-CoA dehydrogenase domain pr...   127    5e-28  Gene info
gi|111612240|ref|ZP_01399327.1|  putative acyl-CoA dehydrogena...   126    8e-28
gi|67540850|ref|XP_664199.1|  hypothetical protein AN6595.2 [A...   125    1e-27  Gene info
gi|41406363|ref|NP_959199.1|  FadE1_1 [Mycobacterium avium sub...   125    1e-27  Gene info
gi|71024635|ref|XP_762547.1|  hypothetical protein UM06400.1 [...   125    2e-27  Gene info
gi|88799823|ref|ZP_01115396.1|  Acyl-CoA dehydrogenase [Reinek...   124    2e-27
gi|83764883|dbj|BAE55027.1|  unnamed protein product [Aspergillus   124    3e-27
gi|70998522|ref|XP_753983.1|  hypothetical protein Afu5g06500 ...   124    3e-27  Gene info
gi|53722876|ref|YP_111861.1|  acyl-CoA dehydrogenase [Burkhold...   124    3e-27  Gene info
gi|53716458|ref|YP_105062.1|  acyl-CoA dehydrogenase domain pr...   124    3e-27  Gene info
gi|99910913|ref|ZP_01317852.1|  hypothetical protein Bpse1_030...   124    4e-27
gi|116694859|ref|YP_729070.1|  Acyl-CoA dehydrogenase [Ralston...   124    4e-27  Gene info
gi|67643146|ref|ZP_00441894.1|  COG1960: Acyl-CoA dehydrogenas...   124    4e-27
gi|90291016|ref|ZP_01210653.1|  hypothetical protein Bpse17_02...   124    4e-27
gi|115438178|ref|XP_001217999.1|  hypothetical protein ATEG_09...   123    7e-27  Gene info
gi|111614561|ref|ZP_01401636.1|  acyl-CoA dehydrogenase [Vermi...   122    9e-27
gi|78060999|ref|YP_370907.1|  Acyl-CoA dehydrogenase [Burkhold...   122    1e-26  Gene info
gi|26989512|ref|NP_744937.1|  acyl-CoA dehydrogenase family pr...   122    1e-26  Gene info
gi|110835394|ref|YP_694253.1|  acyl-CoA dehydrogenase, putativ...   122    1e-26  Gene info
gi|82898513|ref|XP_921248.1|  PREDICTED: similar to acyl-Coenz...   122    1e-26  Gene info
gi|26329583|dbj|BAC28530.1|  unnamed protein product [Mus musculu   122    1e-26  UniGene infoGene info
gi|84327517|ref|ZP_00975536.1|  COG1960: Acyl-CoA dehydrogenases    121    2e-26
gi|12698384|gb|AAK01498.1|  putative acyl-CoA dehydrogenase [Pseu   121    2e-26
gi|55378704|ref|YP_136554.1|  acyl-CoA dehydrogenase [Haloarcu...   121    2e-26  Gene info
gi|111062251|gb|EAT83371.1|  predicted protein [Phaeosphaeria nod   121    2e-26
gi|107101651|ref|ZP_01365569.1|  hypothetical protein PaerPA_0...   120    4e-26
gi|116050157|ref|YP_791026.1|  Probable Acyl-CoA dehydrogenase...   120    6e-26  Gene info
gi|118163730|gb|ABK64627.1|  acyl-CoA dehydrogenase [Mycobacteriu   119    6e-26
gi|116693605|ref|YP_839138.1|  acyl-CoA dehydrogenase domain p...   119    1e-25  Gene info
gi|116270196|ref|ZP_01494436.1|  acyl-CoA dehydrogenase-like [...   117    2e-25
gi|58260174|ref|XP_567497.1|  acyl-CoA dehydrogenase [Cryptoco...   117    2e-25  Gene info
gi|114646984|ref|XP_001146998.1|  PREDICTED: acyl-Coenzyme A d...   117    3e-25  Gene info
gi|116000264|emb|CAL49944.1|  unnamed protein product [Ostreococc   117    3e-25
gi|84353137|ref|ZP_00978074.1|  COG1960: Acyl-CoA dehydrogenas...   117    5e-25
gi|84502520|ref|ZP_01000656.1|  putative acyl-CoA dehydrogenas...   116    6e-25
gi|114705183|ref|ZP_01438091.1|  acyl-CoA dehydrogenase [Fulvi...   116    6e-25
gi|94497644|ref|ZP_01304212.1|  acyl-CoA dehydrogenase-like pr...   116    8e-25
gi|68228399|ref|ZP_00567602.1|  Acyl-CoA dehydrogenase, C-term...   116    8e-25
gi|111222799|ref|YP_713593.1|  putative acyl-CoA dehydrogenase...   115    2e-24  Gene info
gi|118165783|gb|ABK66680.1|  acyl-CoA dehydrogenase [Mycobacteriu   114    2e-24
gi|111019328|ref|YP_702300.1|  acyl-CoA dehydrogenase [Rhodoco...   114    4e-24  Gene info
gi|89359131|ref|ZP_01196952.1|  acyl-CoA dehydrogenase [Xantho...   112    1e-23
gi|84717150|ref|ZP_01023406.1|  acyl-CoA dehydrogenase [Polaro...   112    1e-23
gi|114797237|ref|YP_759009.1|  acyl-CoA dehydrogenase family p...   112    1e-23  Gene info
gi|73537985|ref|YP_298352.1|  Acyl-CoA dehydrogenase, C-termin...   112    1e-23  Gene info
gi|94313335|ref|YP_586544.1|  acyl-CoA dehydrogenase-like prot...   111    2e-23  Gene info
gi|88856944|ref|ZP_01131595.1|  Acyl-CoA dehydrogenase-like pr...   111    2e-23
gi|92910653|ref|ZP_01279428.1|  Acyl-CoA dehydrogenase-like:Ac...   111    2e-23
gi|82702096|ref|YP_411662.1|  Acyl-CoA dehydrogenase-like [Nit...   110    4e-23  Gene info
gi|50413286|ref|XP_457239.1|  hypothetical protein DEHA0B06424...   109    8e-23  Gene info
gi|83943337|ref|ZP_00955796.1|  putative acyl-CoA dehydrogenas...   109    8e-23
gi|94496709|ref|ZP_01303284.1|  acyl-CoA dehydrogenase-like pr...   109    9e-23
gi|111612250|ref|ZP_01399337.1|  acyl-CoA dehydrogenase-like [...   109    9e-23
gi|111224271|ref|YP_715065.1|  putative acyl-CoA dehydrogenase...   109    1e-22  Gene info
gi|106892841|ref|ZP_01359996.1|  Acyl-CoA dehydrogenase-like:A...   108    1e-22
gi|110592659|ref|ZP_01381015.1|  Acyl-CoA dehydrogenase, type ...   108    1e-22
gi|118065435|ref|ZP_01533733.1|  acyl-CoA dehydrogenase-like [...   108    1e-22
gi|94313535|ref|YP_586744.1|  acyl-CoA dehydrogenase-like prot...   108    2e-22  Gene info
gi|73538455|ref|YP_298822.1|  Acyl-CoA dehydrogenase, C-termin...   107    3e-22  Gene info
gi|84994031|gb|ABC68357.1|  pdtO' [Pseudomonas putida]              107    5e-22
gi|72162398|ref|YP_290055.1|  acyl-CoA dehydrogenase [Thermobi...   107    5e-22  Gene info
gi|72384172|ref|YP_293526.1|  Acyl-CoA dehydrogenase, C-termin...   106    6e-22  Gene info
gi|73539111|ref|YP_299478.1|  Acyl-CoA dehydrogenase, C-termin...   106    6e-22  Gene info
gi|87199722|ref|YP_496979.1|  acyl-CoA dehydrogenase-like [Nov...   106    8e-22  Gene info
gi|111620434|ref|ZP_01407418.1|  Acyl-CoA dehydrogenase, type ...   105    9e-22
gi|13310129|gb|AAK18172.1|AF290950_4  FadFx [Pseudomonas putida]    105    1e-21
gi|30250275|ref|NP_842345.1|  Acyl-CoA dehydrogenase [Nitrosom...   105    1e-21  Gene info
gi|83645613|ref|YP_434048.1|  Acyl-CoA dehydrogenase [Hahella ...   105    2e-21  Gene info
gi|104782574|ref|YP_609072.1|  acyl-CoA dehydrogenase protein ...   104    2e-21  Gene info
gi|78043397|ref|YP_360564.1|  acyl-CoA dehydrogenase, short-ch...   104    2e-21  Gene info
gi|116695762|ref|YP_841338.1|  Acyl-CoA dehydrogenase [Ralston...   104    2e-21  Gene info
gi|26988940|ref|NP_744365.1|  acyl-CoA dehydrogenase family pr...   104    3e-21  Gene info
gi|111222625|ref|YP_713419.1|  putative acyl-CoA dehydrogenase...   103    4e-21  Gene info
gi|54024207|ref|YP_118449.1|  putative acyl-CoA dehydrogenase ...   103    4e-21  Gene info
gi|16126042|ref|NP_420606.1|  acyl-CoA dehydrogenase [Caulobac...   103    4e-21  Gene info
gi|82737761|ref|ZP_00900606.1|  acyl-CoA dehydrogenase family ...   103    6e-21
gi|108805083|ref|YP_645020.1|  acyl-CoA dehydrogenase-like pro...   103    7e-21  Gene info
gi|26990204|ref|NP_745629.1|  acyl-CoA dehydrogenase [Pseudomo...   102    9e-21  Gene info
gi|113939105|ref|ZP_01424965.1|  acyl-CoA dehydrogenase-like [...   102    1e-20
gi|82735703|ref|ZP_00898565.1|  acyl-CoA dehydrogenase [Pseudo...   102    1e-20
gi|76259487|ref|ZP_00767135.1|  Acyl-CoA dehydrogenase, C-term...   102    1e-20
gi|68478978|ref|XP_716423.1|  putative acyl-CoA dehydrogenase ...   102    2e-20  Gene info
gi|104781960|ref|YP_608458.1|  acyl-CoA dehydrogenase [Pseudom...   101    2e-20  Gene info
gi|118048529|ref|ZP_01517130.1|  acyl-CoA dehydrogenase-like [...   101    2e-20
gi|91781589|ref|YP_556795.1|  Putative acyl-CoA dehydrogenase ...   100    4e-20  Gene info
gi|6683569|dbj|BAA89254.1|  OrfD [Leptospira interrogans serovar    100    4e-20
gi|118053887|ref|ZP_01522429.1|  acyl-CoA dehydrogenase-like [...   100    5e-20
gi|68230857|ref|ZP_00570034.1|  Isovaleryl-CoA dehydrogenase [...   100    6e-20
gi|56130784|ref|YP_145687.1|  Acyl-CoA dehydrogenase [Ralstoni...   100    6e-20  Gene info
gi|111020601|ref|YP_703573.1|  probable butyryl-CoA dehydrogen...  99.8    7e-20  Gene info
gi|68228780|ref|ZP_00567980.1|  Acyl-CoA dehydrogenase, C-term...  99.8    7e-20
gi|56709185|ref|YP_165230.1|  acyl-CoA dehydrogenase family pr...  99.8    8e-20  Gene info
gi|70730430|ref|YP_260171.1|  acyl-CoA dehydrogenase family pr...  99.4    9e-20  Gene info
gi|115421704|emb|CAJ48215.1|  acyl-CoA dehydrogenase [Bordetella   99.4    9e-20
gi|27381488|ref|NP_773017.1|  putative acyl-CoA dehydrogenase ...  99.0    1e-19  Gene info
gi|110594756|ref|ZP_01383098.1|  Acyl-CoA dehydrogenase, type ...  99.0    1e-19
gi|118061914|ref|ZP_01530266.1|  acyl-CoA dehydrogenase-like [...  98.6    2e-19
gi|113934017|ref|ZP_01419918.1|  Acyl-CoA dehydrogenase, type ...  98.6    2e-19
gi|118043225|ref|ZP_01511958.1|  acyl-CoA dehydrogenase-like [...  98.2    2e-19
gi|16124682|ref|NP_419246.1|  acyl-CoA dehydrogenase, putative...  97.8    3e-19  Gene info
gi|106890184|ref|ZP_01357380.1|  Acyl-CoA dehydrogenase-like:A...  97.4    3e-19
gi|50084728|ref|YP_046238.1|  putative acyl-CoA dehydrogenase ...  97.4    3e-19  Gene info
gi|94309053|ref|YP_582263.1|  acyl-CoA dehydrogenase-like prot...  97.4    4e-19  Gene info
gi|23098125|ref|NP_691591.1|  acyl-CoA dehydrogenase [Oceanoba...  97.4    4e-19  Gene info
gi|77459092|ref|YP_348598.1|  Acyl-CoA dehydrogenase-like [Pse...  97.4    4e-19  Gene info
gi|56420189|ref|YP_147507.1|  acyl-CoA dehydrogenase [Geobacil...  97.1    4e-19  Gene info
gi|89053818|ref|YP_509269.1|  acyl-CoA dehydrogenase-like [Jan...  97.1    5e-19  Gene info
gi|6959522|gb|AAF33139.1|AF196567_15  putative acyl-CoA dehydroge  97.1    5e-19
gi|114762746|ref|ZP_01442180.1|  Acyl-CoA dehydrogenase [Roseo...  96.7    6e-19
gi|70730080|ref|YP_259819.1|  acyl-CoA dehydrogenase [Pseudomo...  96.7    6e-19  Gene info
gi|46199085|ref|YP_004752.1|  putative acyl-CoA dehydrogenase ...  96.7    6e-19  Gene info
gi|116254744|ref|YP_770580.1|  putative acyl-CoA dehydrogenase...  96.7    7e-19  Gene info
gi|15805946|ref|NP_294646.1|  acyl-CoA dehydrogenase [Deinococ...  96.7    7e-19  Gene info
gi|62317682|ref|YP_223535.1|  acyl-CoA dehydrogenase [Brucella...  96.3    7e-19  Gene info
gi|82735467|ref|ZP_00898329.1|  acyl-CoA dehydrogenase, putati...  96.3    8e-19
gi|110347269|ref|YP_666086.1|  acyl-CoA dehydrogenase-like [Me...  96.3    8e-19  Gene info
gi|26990432|ref|NP_745857.1|  acyl-CoA dehydrogenase, putative...  96.3    8e-19  Gene info
gi|86751210|ref|YP_487706.1|  Acyl-CoA dehydrogenase-like [Rho...  96.3    8e-19  Gene info
gi|56966249|pdb|1UKW|A  Chain A, Crystal Structure Of Medium-C...  96.3    9e-19  Related structures
gi|107104078|ref|ZP_01367996.1|  hypothetical protein PaerPA_0...  95.9    1e-18
gi|15600172|ref|NP_253666.1|  probable acyl-CoA dehydrogenase ...  95.9    1e-18  Gene info
gi|94413286|ref|ZP_01293173.1|  hypothetical protein PaerP_010...  95.9    1e-18
gi|110600092|ref|ZP_01388320.1|  Acyl-CoA dehydrogenase-like:A...  95.9    1e-18
gi|15966004|ref|NP_386357.1|  PUTATIVE ACYL-COA DEHYDROGENASE ...  95.9    1e-18  Gene info
gi|83748719|ref|ZP_00945735.1|  Acyl-CoA dehydrogenase [Ralsto...  95.9    1e-18
gi|55981113|ref|YP_144410.1|  acetyl-Coenzyme A dehydrogenase,...  95.9    1e-18  Gene info
gi|118028227|ref|ZP_01499690.1|  acyl-CoA dehydrogenase-like [...  95.5    1e-18
gi|73539108|ref|YP_299475.1|  Acyl-CoA dehydrogenase, C-termin...  95.5    1e-18  Gene info
gi|94314052|ref|YP_587261.1|  acyl-CoA dehydrogenase-like prot...  95.5    2e-18  Gene info
gi|114797804|ref|YP_761489.1|  acyl-CoA dehydrogenase [Hyphomo...  95.1    2e-18  Gene info
gi|113874081|ref|ZP_01414209.1|  Isovaleryl-CoA dehydrogenase ...  95.1    2e-18
gi|52421827|gb|AAU45408.1|  BbsG [Azoarcus sp. T]                  95.1    2e-18
gi|56476483|ref|YP_158072.1|  benzylsuccinyl-CoA dehydrogenase...  94.7    2e-18  Gene info
gi|118057872|ref|ZP_01526335.1|  acyl-CoA dehydrogenase-like [...  94.7    2e-18
gi|84359403|ref|ZP_00984150.1|  COG1960: Acyl-CoA dehydrogenases   94.7    2e-18
gi|115359133|ref|YP_776271.1|  acyl-CoA dehydrogenase domain p...  94.7    2e-18  Gene info
gi|73539846|ref|YP_294366.1|  Acyl-CoA dehydrogenase, C-termin...  94.7    3e-18  Gene info
gi|84714590|ref|ZP_01021986.1|  putative acyl CoA dehydrogenas...  94.7    3e-18
gi|94984536|ref|YP_603900.1|  acyl-CoA dehydrogenase-like prot...  94.7    3e-18  Gene info
gi|78061564|ref|YP_371472.1|  Acyl-CoA dehydrogenase [Burkhold...  94.4    3e-18  Gene info
gi|84352610|ref|ZP_00977563.1|  COG1960: Acyl-CoA dehydrogenas...  94.4    3e-18
gi|54022406|ref|YP_116648.1|  putative acyl-CoA dehydrogenase ...  94.4    3e-18  Gene info
gi|116268863|ref|ZP_01493109.1|  acyl-CoA dehydrogenase-like [...  94.4    3e-18
gi|78222735|ref|YP_384482.1|  Acyl-CoA dehydrogenase-like [Geo...  94.4    3e-18  Gene info
gi|113937337|ref|ZP_01423213.1|  acyl-CoA dehydrogenase-like [...  94.4    3e-18
gi|86360114|ref|YP_472003.1|  probable acyl-CoA dehydrogenase ...  94.4    3e-18  Gene info
gi|107025761|ref|YP_623272.1|  acyl-CoA dehydrogenase-like [Bu...  94.4    3e-18  Gene info
gi|84317578|ref|ZP_00966017.1|  COG1960: Acyl-CoA dehydrogenas...  94.0    4e-18
gi|113931726|ref|ZP_01417628.1|  Acyl-CoA dehydrogenase, type ...  94.0    4e-18
gi|69938401|ref|ZP_00632879.1|  Acyl-CoA dehydrogenase, C-term...  94.0    4e-18
gi|108866505|gb|EAT32290.1|  acyl-coa dehydrogenase [Aedes aegypt  93.6    5e-18
gi|67538234|ref|XP_662891.1|  hypothetical protein AN5287.2 [A...  93.6    5e-18  Gene info
gi|56477494|ref|YP_159083.1|  putative acyl CoA dehydrogenase ...  93.6    5e-18  Gene info
gi|89902597|ref|YP_525068.1|  acyl-CoA dehydrogenase-like [Rho...  93.6    5e-18  Gene info
gi|17569725|ref|NP_510788.1|  T08G2.3 [Caenorhabditis elegans]...  93.6    6e-18  UniGene infoGene info
gi|115379923|ref|ZP_01466981.1|  acyl-CoA dehydrogenase, C-ter...  93.2    6e-18
gi|113866203|ref|YP_724692.1|  Acyl-CoA dehydrogenase, short-c...  93.2    6e-18  Gene info
gi|118170234|gb|ABK71130.1|  butyryl-CoA dehydrogenase [Mycoba...  93.2    6e-18
gi|94311535|ref|YP_584745.1|  acyl-CoA dehydrogenase-like prot...  92.8    9e-18  Gene info
gi|110600013|ref|ZP_01388243.1|  Acyl-CoA dehydrogenase-like:A...  92.8    1e-17
gi|94310754|ref|YP_583964.1|  acyl-CoA dehydrogenase-like prot...  92.4    1e-17  Gene info
gi|77459090|ref|YP_348596.1|  Acyl-CoA dehydrogenase-like [Pse...  92.4    1e-17  Gene info
gi|86136638|ref|ZP_01055217.1|  acyl-CoA dehydrogenase family ...  92.4    1e-17
gi|116694855|ref|YP_729066.1|  Acyl-CoA dehydrogenase [Ralston...  92.4    1e-17  Gene info
gi|15891463|ref|NP_357135.1|  hypothetical protein AGR_L_2714 ...  92.4    1e-17  Gene info
gi|37077871|sp|Q9KJE8|BBSG_THAAR  (R)-benzylsuccinyl-CoA dehyd...  92.4    1e-17
gi|110600010|ref|ZP_01388240.1|  Acyl-CoA dehydrogenase-like:A...  92.4    1e-17
gi|89068383|ref|ZP_01155786.1|  acyl-CoA dehydrogenase family ...  92.0    1e-17
gi|88937388|ref|ZP_01142958.1|  acyl-CoA dehydrogenase; RBL016...  92.0    2e-17
gi|118029770|ref|ZP_01501229.1|  acyl-CoA dehydrogenase-like [...  92.0    2e-17
gi|115360683|ref|YP_777820.1|  acyl-CoA dehydrogenase domain p...  92.0    2e-17  Gene info
gi|91790023|ref|YP_550975.1|  acyl-CoA dehydrogenase-like [Pol...  91.7    2e-17  Gene info
gi|68227867|ref|ZP_00567072.1|  Acyl-CoA dehydrogenase [Franki...  91.7    2e-17
gi|39596055|emb|CAE69691.1|  Hypothetical protein CBG15946 [Caeno  91.7    2e-17
gi|23500196|ref|NP_699636.1|  acyl-CoA dehydrogenase [Brucella...  91.7    2e-17  Gene info
gi|91977574|ref|YP_570233.1|  acyl-CoA dehydrogenase-like [Rho...  91.7    2e-17  Gene info
gi|89359940|ref|ZP_01197760.1|  acyl-CoA dehydrogenase [Xantho...  91.7    2e-17
gi|94984843|ref|YP_604207.1|  acyl-CoA dehydrogenase-like prot...  91.3    2e-17  Gene info
gi|89307302|gb|EAS05290.1|  Acyl-CoA dehydrogenase, middle dom...  90.9    3e-17
gi|113940354|ref|ZP_01426189.1|  Butyryl-CoA dehydrogenase [He...  90.9    3e-17
gi|111224159|ref|YP_714953.1|  Putative medium-chain Acyl-CoA ...  90.9    4e-17  Gene info
gi|55377709|ref|YP_135559.1|  acyl-CoA dehydrogenase [Haloarcu...  90.9    4e-17  Gene info
gi|118059418|ref|ZP_01527875.1|  acyl-CoA dehydrogenase-like [...  90.9    4e-17
gi|71905738|ref|YP_283325.1|  Acyl-CoA dehydrogenase, C-termin...  90.9    4e-17  Gene info
gi|118034030|ref|ZP_01505468.1|  acyl-CoA dehydrogenase-like [...  90.9    4e-17
gi|115372660|ref|ZP_01459967.1|  acyl-CoA dehydrogenase, mediu...  90.5    4e-17
gi|17534899|ref|NP_495142.1|  K05F1.3 [Caenorhabditis elegans]...  90.5    5e-17  UniGene infoGene info
gi|83312698|ref|YP_422962.1|  Acyl-CoA dehydrogenase [Magnetos...  90.5    5e-17  Gene info
gi|85704082|ref|ZP_01035185.1|  acyl-CoA dehydrogenase [Roseov...  90.5    5e-17
gi|67156733|ref|ZP_00418230.1|  Butyryl-CoA dehydrogenase [Azo...  90.5    5e-17
gi|84501856|ref|ZP_01000014.1|  Acyl-CoA dehydrogenase [Oceani...  90.5    5e-17
gi|78044080|ref|YP_360183.1|  butyryl-CoA dehydrogenase [Carbo...  90.1    5e-17  Gene info
gi|78042819|ref|YP_360157.1|  butyryl-CoA dehydrogenase [Carbo...  90.1    6e-17  Gene info
gi|23014530|ref|ZP_00054341.1|  COG1960: Acyl-CoA dehydrogenas...  90.1    6e-17
gi|47228564|emb|CAG05384.1|  unnamed protein product [Tetraodon n  90.1    7e-17
gi|84687656|ref|ZP_01015530.1|  FadE25_4 [Rhodobacterales bact...  89.7    7e-17
gi|91782260|ref|YP_557466.1|  Putative acyl-CoA dehydrogenase ...  89.7    8e-17  Gene info
gi|29833142|ref|NP_827776.1|  acyl-CoA dehydrogenase [Streptom...  89.7    8e-17  Gene info
gi|82737060|ref|ZP_00899913.1|  acyl-CoA dehydrogenase, putati...  89.7    8e-17
gi|51230630|ref|NP_001003743.1|  acyl-Coenzyme A dehydrogenase...  89.4    9e-17  UniGene infoGene info
gi|91780314|ref|YP_555521.1|  Acyl-CoA dehydrogenase [Burkhold...  89.4    9e-17  Gene info
gi|118174436|gb|ABK75332.1|  butyryl-CoA dehydrogenase [Mycoba...  89.4    1e-16
gi|118051844|ref|ZP_01520392.1|  acyl-CoA dehydrogenase-like [...  89.0    1e-16
gi|83746441|ref|ZP_00943493.1|  Acyl-CoA dehydrogenase, short-...  89.0    1e-16
gi|87199246|ref|YP_496503.1|  acyl-CoA dehydrogenase-like [Nov...  89.0    1e-16  Gene info
gi|13541951|ref|NP_111639.1|  Acyl-CoA dehydrogenase [Thermopl...  89.0    1e-16  Gene info
gi|9965284|gb|AAG10019.1|AF282240_3  acyl-CoA dehydrogenase [A...  89.0    1e-16
gi|90575682|ref|ZP_01232159.1|  hypothetical protein CdifQ_020...  89.0    1e-16
gi|35186984|gb|AAQ84159.1|  PlmL [Streptomyces sp. HK803]          89.0    1e-16
gi|94314827|ref|YP_588036.1|  acyl-CoA dehydrogenase-like prot...  89.0    1e-16  Gene info
gi|15806336|ref|NP_295042.1|  acyl-CoA dehydrogenase [Deinococ...  89.0    1e-16  Gene info
gi|26988764|ref|NP_744189.1|  acyl-CoA dehydrogenase, putative...  89.0    1e-16  Gene info
gi|84517024|ref|ZP_01004381.1|  acyl-CoA dehydrogenase [Loktan...  89.0    1e-16
gi|106893170|ref|ZP_01360296.1|  Butyryl-CoA dehydrogenase [Cl...  88.6    2e-16
gi|23100466|ref|NP_693933.1|  acyl-CoA dehydrogenase [Oceanoba...  88.6    2e-16  Gene info
gi|116254816|ref|YP_770652.1|  putative acyl-CoA dehydrogenase...  88.6    2e-16  Gene info
gi|66045014|ref|YP_234855.1|  Acyl-CoA dehydrogenase, C-termin...  88.6    2e-16  Gene info
gi|83950248|ref|ZP_00958981.1|  acyl-CoA dehydrogenase family ...  88.6    2e-16
gi|116193399|ref|XP_001222512.1|  conserved hypothetical prote...  88.6    2e-16  Gene info
gi|52545715|emb|CAH56354.1|  hypothetical protein [Homo sapiens]   88.6    2e-16  UniGene infoGene info
gi|30023372|ref|NP_835003.1|  Acyl-CoA dehydrogenase, short-ch...  88.6    2e-16  Gene info
gi|67543197|ref|ZP_00421130.1|  Acyl-CoA dehydrogenase, C-term...  88.6    2e-16
gi|99082079|ref|YP_614233.1|  acyl-CoA dehydrogenase-like [Sil...  88.2    2e-16  Gene info
gi|39596963|emb|CAE59190.1|  Hypothetical protein CBG02501 [Caeno  88.2    2e-16
gi|27366926|ref|NP_762453.1|  Acyl-CoA dehydrogenase [Vibrio v...  88.2    2e-16  Gene info
gi|47569766|ref|ZP_00240438.1|  acyl-CoA dehydrogenase, short-...  88.2    2e-16
gi|116695137|ref|YP_840713.1|  Acyl-CoA dehydrogenase [Ralston...  88.2    2e-16  Gene info
gi|42491133|emb|CAE11270.1|  YngJ protein [Bacillus amyloliquefac  88.2    2e-16
gi|118171080|gb|ABK71976.1|  acyl-CoA dehydrogenase [Mycobacteriu  88.2    2e-16
gi|114771220|ref|ZP_01448640.1|  acyl-CoA dehydrogenase [alpha...  88.2    2e-16
gi|108760804|ref|YP_634058.1|  acyl-CoA dehydrogenase [Myxococ...  88.2    2e-16  Gene info
gi|23013421|ref|ZP_00053318.1|  COG1960: Acyl-CoA dehydrogenas...  88.2    2e-16
gi|78222924|ref|YP_384671.1|  Acyl-CoA dehydrogenase-like [Geo...  87.8    3e-16  Gene info
gi|39935374|ref|NP_947650.1|  acyl-CoA dehydrogenase [Rhodopse...  87.8    3e-16  Gene info
gi|115249820|emb|CAJ67637.1|  putative acyl-CoA dehydrogenase [Cl  87.8    3e-16
gi|94969396|ref|YP_591444.1|  acyl-CoA dehydrogenase-like [Aci...  87.8    3e-16  Gene info
gi|50084774|ref|YP_046284.1|  putative acyl-CoA dehydrogenase ...  87.8    3e-16  Gene info
gi|78043643|ref|YP_360430.1|  butyryl-CoA dehydrogenase [Carbo...  87.4    3e-16  Gene info
gi|33599601|ref|NP_887161.1|  acyl-CoA dehydrogenase [Bordetel...  87.4    4e-16  Gene info
gi|49480422|ref|YP_039334.1|  butyryl-CoA dehydrogenase (short...  87.4    4e-16  Gene info
gi|42784517|ref|NP_981764.1|  acyl-CoA dehydrogenase [Bacillus...  87.0    5e-16  Gene info
gi|83372818|ref|ZP_00917597.1|  probable acyl-CoA dehydrogenas...  87.0    5e-16
gi|52140219|ref|YP_086610.1|  acyl-CoA dehydrogenase [Bacillus...  87.0    5e-16  Gene info
gi|78063331|ref|YP_373239.1|  Acyl-CoA dehydrogenase [Burkhold...  87.0    5e-16  Gene info
gi|77465195|ref|YP_354698.1|  Acyl-CoA dehydrogenase [Rhodobac...  87.0    5e-16  Gene info
gi|78224498|ref|YP_386245.1|  Acyl-CoA dehydrogenase-like [Geo...  87.0    6e-16  Gene info
gi|16078887|ref|NP_389708.1|  hypothetical protein BSU18260 [B...  87.0    6e-16  Gene info
gi|30265365|ref|NP_847742.1|  acyl-CoA dehydrogenase [Bacillus...  87.0    6e-16  Gene info
gi|94415008|ref|ZP_01294860.1|  hypothetical protein PaerP_010...  87.0    6e-16
gi|51703486|gb|AAH81056.1|  MGC81873 protein [Xenopus laevis]      86.7    6e-16  UniGene infoGene info
gi|90423555|ref|YP_531925.1|  acyl-CoA dehydrogenase-like [Rho...  86.7    6e-16  Gene info
gi|86360171|ref|YP_472060.1|  probable acyl-CoA dehydrogenase ...  86.7    6e-16  Gene info


>gi|113937781|ref|ZP_01423654.1|  acyl-CoA dehydrogenase-like [Herpetosiphon aurantiacus ATCC 23779]
 gi|113900484|gb|EAU19473.1|  acyl-CoA dehydrogenase-like [Herpetosiphon aurantiacus ATCC 23779]
Length=405

 Score =  198 bits (504),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 103/203 (50%), Positives = 136/203 (66%), Gaps = 3/203 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHT-GGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            +QIIVP  +PG  ++R + + GHT GG H EI+Y +V VP EN LG RG G A AQ RLG
Sbjct  196  SQIIVPAETPGLTLVRPISVMGHTTGGGHWEIEYTDVHVPAENLLGKRGQGFAIAQTRLG  255

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+ HCM  +GQ  RAFDLM + +T R   GG L  KQ++Q +IA+S  +IQ ARL  +
Sbjct  256  PGRIHHCMRWLGQAQRAFDLMCEYSTKRVAFGGPLADKQVVQHWIAESAAEIQAARLSVL  315

Query  121  HCAEVMDSDG--DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGART  178
            H A  +D  G    R+DIS IK  V A +  V+DRAIQV+G  GVS D PL  M++  R 
Sbjct  316  HAAWQIDQAGAKSARIDISLIKFSVAAMLMNVLDRAIQVHGGLGVSDDTPLAFMWRQGRA  375

Query  179  LRLADGPDEVHRILIAKQILKKY  201
             R+ DGPDEVH++++A++ILK+Y
Sbjct  376  SRIYDGPDEVHKMVVAREILKRY  398


>gi|62423268|ref|ZP_00378435.1|  COG1960: Acyl-CoA dehydrogenases [Brevibacterium linens BL2]
Length=401

 Score =  183 bits (464),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 91/204 (44%), Positives = 134/204 (65%), Gaps = 3/204 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWG-HTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            + ++VP ++PG  ++R++P++G H    H EI ++NVRVP ++ L   G G A +Q RLG
Sbjct  197  SMLVVPIDAPGVTVVRNLPVFGYHDREGHAEITFDNVRVPSKDILKGEGEGFAISQARLG  256

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+ HCM +I    RA +LM KR   R   G  L S+  IQ +IA++ I+I  ARL+T+
Sbjct  257  PGRIHHCMRAIDAAERALELMVKRADERVTFGEKLSSRANIQEWIAEARIEIDQARLLTL  316

Query  121  HCAEVMDSDGD--PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGART  178
            H A++MD  G+   + +I+ IK+  PA   +++DRAIQV+G  GV+ D PL  M+   RT
Sbjct  317  HAADMMDKHGNKVAKNEIAEIKVVAPAMALKIIDRAIQVHGGAGVTEDFPLASMWAHMRT  376

Query  179  LRLADGPDEVHRILIAKQILKKYK  202
            LRLADGPDEVH+  IA+  +KKY+
Sbjct  377  LRLADGPDEVHKRSIARNEMKKYR  400


>gi|68535294|ref|YP_249999.1| Gene info acyl-CoA dehydrogenase [Corynebacterium jeikeium K411]
 gi|68262893|emb|CAI36381.1| Gene info acyl-CoA dehydrogenase [Corynebacterium jeikeium K411]
Length=420

 Score =  182 bits (463),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 93/205 (45%), Positives = 136/205 (66%), Gaps = 3/205 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWG-HTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            + + VP ++PG  I+R++P++G H    H E+ +++V VP ++ LG  G G   +QDRLG
Sbjct  215  SMLAVPADAPGVTIVRNLPVFGYHDREGHAEVHFKDVFVPDKDILGGEGMGFKISQDRLG  274

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+ HCM +IG   RA +LM  R  +R   G  L ++  I+  IA + IDI+ ARL+T+
Sbjct  275  PGRIHHCMRAIGMAERALELMCTRAMSRTAFGKPLANRDNIRDQIAQARIDIEQARLLTM  334

Query  121  HCAEVMDSDGD--PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGART  178
              A +MD+ G+   R +I+AIK+  P    R+VD+AIQV+G +GV+ D PL  M+ G RT
Sbjct  335  KAAWMMDTVGNKAARQEIAAIKVAAPTMALRIVDQAIQVHGGEGVTDDTPLAAMWAGLRT  394

Query  179  LRLADGPDEVHRILIAKQILKKYKD  203
            LRLADGPDEVHR+ IA+  L+KY+D
Sbjct  395  LRLADGPDEVHRMTIARAELRKYRD  419


>gi|23098129|ref|NP_691595.1| Gene info acyl-CoA dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22776354|dbj|BAC12630.1| Gene info acyl-CoA dehydrogenase [Oceanobacillus iheyensis HTE831]
Length=401

 Score =  182 bits (461),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 96/205 (46%), Positives = 128/205 (62%), Gaps = 4/205 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWG--HTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRL  59
            + I+VP ++PG  I R++P++G  H    H EI+Y NVRVP  N L   G G   AQ RL
Sbjct  197  SMILVPMDTPGVTIKRTLPVFGYDHAPHGHAEIEYHNVRVPATNMLLGEGRGFEIAQGRL  256

Query  60   GAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMT  119
            G GR+ HCM +IG   RA +L+ KR   RE  G  L  + +IQ +IA++ I I+ ARL+T
Sbjct  257  GPGRIHHCMRTIGAAERALELLCKRVLDRETFGKKLAEQGVIQEWIANARISIEQARLLT  316

Query  120  IHCAEVMDSDG--DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGAR  177
            +  A +MD+ G  + + +I+ IK+  P     V+D+AIQV G  GVS D PL   +   R
Sbjct  317  LKAAYMMDTVGNKEAKSEIAMIKVIAPNMALDVIDKAIQVLGAAGVSEDFPLAASWANIR  376

Query  178  TLRLADGPDEVHRILIAKQILKKYK  202
            TLRLADGPDEVHR  IAK  LKKY+
Sbjct  377  TLRLADGPDEVHRKSIAKWELKKYQ  401


>gi|89099721|ref|ZP_01172594.1|  acyl-CoA dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89085468|gb|EAR64596.1|  acyl-CoA dehydrogenase [Bacillus sp. NRRL B-14911]
Length=333

 Score =  180 bits (456),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 97/205 (47%), Positives = 132/205 (64%), Gaps = 4/205 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWG--HTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRL  59
            + I+VP ++PG +I R +P++G  H    H EI Y+NVRVP EN +   G G A AQ RL
Sbjct  129  SMILVPLDAPGVSIERMLPVFGYDHAPHGHAEITYKNVRVPKENIIWGEGKGFAIAQGRL  188

Query  60   GAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMT  119
            G GR+ HCM  IG   RA ++M +R  TR   G  L S+ +I  +IADS I+I+ ARL+T
Sbjct  189  GPGRIHHCMRLIGAAERALEIMCRRVQTRTAFGKPLSSQGVIGEWIADSRIEIEQARLLT  248

Query  120  IHCAEVMDSDG--DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGAR  177
            +  A +MD+ G  + + +I+ IK+  P+   RV+DR+IQ  G  GVS D PL   +  AR
Sbjct  249  LKAAYMMDTVGNKEAKAEIAMIKVTAPSMALRVLDRSIQAMGGAGVSDDYPLAAQWANAR  308

Query  178  TLRLADGPDEVHRILIAKQILKKYK  202
            TLRLADGPDEVHR  IAK  L+K++
Sbjct  309  TLRLADGPDEVHRAQIAKLELRKHQ  333


>gi|56419563|ref|YP_146881.1| Gene info acyl-CoA dehydrogenase [Geobacillus kaustophilus HTA426]
 gi|56379405|dbj|BAD75313.1| Gene info acyl-CoA dehydrogenase [Geobacillus kaustophilus HTA426]
Length=403

 Score =  179 bits (454),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 130/205 (63%), Gaps = 4/205 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWG--HTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRL  59
            + IIVP ++PG  I R +P++G  H    H EI Y++VRVP EN +   G G A AQ RL
Sbjct  198  SMIIVPLDTPGVKIERMLPVFGFDHAPHGHAEITYDHVRVPKENIIWGEGKGFAIAQGRL  257

Query  60   GAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMT  119
            G GR+ HCM  IG   RA +LM +R  +R   G  L    +I+ +IA S I+I+ ARL+T
Sbjct  258  GPGRIHHCMRLIGAAERALELMCRRVQSRVAFGKPLAEHGVIREWIAQSRIEIEQARLLT  317

Query  120  IHCAEVMDSDGD--PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGAR  177
            +  A +MD+ G+   R +I+ IK+  P    +V+DRAIQ +G  GVS D PL  M+  +R
Sbjct  318  LKAAYMMDTVGNKAARKEIAMIKVVAPNVALKVIDRAIQAFGAAGVSNDFPLAAMWANSR  377

Query  178  TLRLADGPDEVHRILIAKQILKKYK  202
            TLRLADGPDEVH+  +AK  L++Y+
Sbjct  378  TLRLADGPDEVHKEQVAKLELRQYQ  402


>gi|108805220|ref|YP_645157.1| Gene info acyl-CoA dehydrogenase-like protein [Rubrobacter xylanophilus 
DSM 9941]
 gi|108766463|gb|ABG05345.1| Gene info acyl-CoA dehydrogenase-like protein [Rubrobacter xylanophilus 
DSM 9941]
Length=412

 Score =  178 bits (452),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 95/205 (46%), Positives = 130/205 (63%), Gaps = 4/205 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGG--DHVEIKYENVRVPLENQLGARGSGHAAAQDRL  59
            + I+VP ++PG  + R++P++G+      H E+ +ENVRVP EN +   G G A AQ RL
Sbjct  200  SMILVPMDTPGVRVERTLPVFGYDDAPHGHAELVFENVRVPRENIIWGEGKGFAIAQGRL  259

Query  60   GAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMT  119
            G GR+ HCM  IG   RA DLM +R   R   G  L  + +IQ +IADS ++I+ ARL+T
Sbjct  260  GPGRIHHCMRLIGVAERALDLMCERVKGRVAFGKPLSEQGVIQQWIADSRMEIEQARLLT  319

Query  120  IHCAEVMDSDG--DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGAR  177
            +  A +MD  G  + R +I+ IK+  P    RV+DRAIQ +G  GVS D PL  ++  +R
Sbjct  320  LKAAYMMDHVGNKEARSEIAQIKVVAPNVALRVLDRAIQAHGGGGVSDDFPLAYLWASSR  379

Query  178  TLRLADGPDEVHRILIAKQILKKYK  202
            TLRLADGPDEVHR  IA+  LKK +
Sbjct  380  TLRLADGPDEVHRAQIARLELKKER  404


>gi|92914709|ref|ZP_01283335.1|  Acyl-CoA dehydrogenase-like:Acyl-CoA dehydrogenase, central region 
[Mycobacterium sp. KMS]
 gi|108800700|ref|YP_640897.1| Gene info acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]
 gi|92441087|gb|EAS98928.1|  Acyl-CoA dehydrogenase-like:Acyl-CoA dehydrogenase, central region 
[Mycobacterium sp. KMS]
 gi|108771119|gb|ABG09841.1| Gene info acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]
Length=433

 Score =  178 bits (452),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 88/207 (42%), Positives = 128/207 (61%), Gaps = 5/207 (2%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGD--HVEIKYENVRVPLENQLGARGSGHAAAQDR  58
            M+  +VPT++PG NI+R + ++G   G   H  I Y+NVRVP +  LG  G   A AQ R
Sbjct  194  MSMFLVPTDTPGVNIVRDIGLYGEAEGHGGHALIHYDNVRVPADALLGGEGQAFAIAQTR  253

Query  59   LGAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLM  118
            LG GR+ H M +IG   +A D+M +R  +R+  G  L  KQ +QG+IADSY  +   RLM
Sbjct  254  LGGGRIHHAMRTIGLSRKALDMMCERALSRQTQGSRLSDKQFVQGYIADSYAQLLQFRLM  313

Query  119  TIHCAEVMDSDGD---PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQG  175
             ++ A  +D   D    R DI+A+K+ +P  +H +  RA+QV+G  GV+ ++P  GM  G
Sbjct  314  VLYTAWEIDKYNDYKKVRKDIAAVKVVMPTVLHDIAWRAMQVHGALGVTNEMPFMGMVTG  373

Query  176  ARTLRLADGPDEVHRILIAKQILKKYK  202
            A  + LADGP EVH+  +AKQ+L+ Y+
Sbjct  374  AAVMGLADGPTEVHKTTVAKQVLRDYR  400


>gi|111019333|ref|YP_702305.1| Gene info acyl-CoA dehydrogenase [Rhodococcus sp. RHA1]
 gi|110818863|gb|ABG94147.1| Gene info acyl-CoA dehydrogenase [Rhodococcus sp. RHA1]
Length=413

 Score =  178 bits (451),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 134/204 (65%), Gaps = 3/204 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGD-HVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            + ++VP ++PG  ++R +P++G+   + H EI + +VRVP+E+ L   G G A +Q RLG
Sbjct  198  SMMVVPIDAPGVTVMRGLPVFGYQDREGHAEIDFADVRVPVEDVLKGEGEGFAISQARLG  257

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+ HCM +IG   RA +LM +R ++R   G  +     +Q +IA++ I+I+  RL+T+
Sbjct  258  PGRIHHCMRAIGMAERALELMCRRASSRVTFGKPVSENANVQDWIAEARIEIEMIRLLTL  317

Query  121  HCAEVMDSDG--DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGART  178
              A +MD+ G  + R +I+AIK+  P     +VDRAIQV+G  GV+ D PL  MY   R 
Sbjct  318  KAAYLMDTVGNKEARTEIAAIKVAAPNIALEIVDRAIQVHGGAGVTDDFPLAMMYAHLRA  377

Query  179  LRLADGPDEVHRILIAKQILKKYK  202
            LRLADGPDEVH++ IA++ L+KY+
Sbjct  378  LRLADGPDEVHKMSIARRELRKYR  401


>gi|118168739|gb|ABK69635.1|  putative acyl-CoA dehydrogenase [Mycobacterium smegmatis str. 
MC2 155]
Length=433

 Score =  177 bits (450),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 88/207 (42%), Positives = 127/207 (61%), Gaps = 5/207 (2%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGH--TGGDHVEIKYENVRVPLENQLGARGSGHAAAQDR  58
            M+  +VPT++PG  I+R+V ++G     G H  I Y+NVRVP E  LG  G     AQ R
Sbjct  194  MSMFLVPTDTPGVEIVRNVGLYGERDNEGSHALIHYDNVRVPAEALLGGEGQAFVIAQTR  253

Query  59   LGAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLM  118
            LG GR+ H M +IG   +A D+M +R  +R+  G  L  KQ +QG+IADSY  +   RLM
Sbjct  254  LGGGRIHHAMRTIGLARKALDMMCERALSRKTQGSRLSDKQFVQGYIADSYAQLLQFRLM  313

Query  119  TIHCAEVMDSDGD---PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQG  175
             ++ A  +D   D    R DI+A+K+ +P  +H +  RA+QV+G  GV+ ++P  GM  G
Sbjct  314  VLYTAWEIDKYNDYKLVRKDIAAVKVVMPTVLHDIAWRAMQVHGALGVTNEMPFLGMVTG  373

Query  176  ARTLRLADGPDEVHRILIAKQILKKYK  202
            A  + LADGP EVH+  +AKQ+L+ Y+
Sbjct  374  AAVMGLADGPTEVHKTTVAKQVLRDYQ  400


>gi|111018504|ref|YP_701476.1| Gene info acyl-CoA dehydrogenase [Rhodococcus sp. RHA1]
 gi|110818034|gb|ABG93318.1| Gene info acyl-CoA dehydrogenase [Rhodococcus sp. RHA1]
Length=417

 Score =  177 bits (450),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/206 (42%), Positives = 135/206 (65%), Gaps = 3/206 (1%)

Query  2    TQIIVPTNSPGFNIIRSVPIWGHTGGD-HVEIKYENVRVPLENQLGARGSGHAAAQDRLG  60
            + ++VP ++PG  ++R +P++G+   + H EI + +VRVP+E+ L   G G A +Q RLG
Sbjct  198  SMMVVPIDAPGVTVMRGLPVFGYQDREGHAEIDFADVRVPVEDVLKGEGEGFAISQARLG  257

Query  61   AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI  120
             GR+ HCM +IG   RA +LM +R ++R   G  +     +Q +IA++ I+I+  RL+T+
Sbjct  258  PGRIHHCMRAIGMAERALELMCRRASSRVTFGKPVSENANVQDWIAEARIEIEMIRLLTL  317

Query  121  HCAEVMDSDG--DPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGART  178
              A +MD+ G  + R +I+AIK+  P    ++VDRAIQV+G  GV+ D PL   +   RT
Sbjct  318  KAAYLMDTVGNKEARTEIAAIKVAAPNIALKIVDRAIQVHGGAGVTDDFPLAMAWAHLRT  377

Query  179  LRLADGPDEVHRILIAKQILKKYKDG  204
            LRLADGPDEVH+  IA+Q L++Y+D 
Sbjct  378  LRLADGPDEVHKRAIARQELRQYRDA  403


>gi|92908225|ref|ZP_01277004.1|  Acyl-CoA dehydrogenase-like:Acyl-CoA dehydrogenase, central region 
[Mycobacterium sp. JLS]
 gi|92434245|gb|EAS93577.1|  Acyl-CoA dehydrogenase-like:Acyl-CoA dehydrogenase, central region 
[Mycobacterium sp. JLS]
Length=433

 Score =  177 bits (449),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 88/207 (42%), Positives = 127/207 (61%), Gaps = 5/207 (2%)

Query  1    MTQIIVPTNSPGFNIIRSVPIWGHTGGD--HVEIKYENVRVPLENQLGARGSGHAAAQDR  58
            M+  +VPT++PG NI+R + ++G   G   H  I Y+NVRVP +  LG  G   A AQ R
Sbjct  194  MSMFLVPTDTPGVNIVRDIGLYGEAEGHGGHALIHYDNVRVPADALLGGEGQAFAIAQTR  253

Query  59   LGAGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLM  118
            LG GR+ H M +IG   +A D+M +R  +R   G  L  KQ +QG+IADSY  +   RLM
Sbjct  254  LGGGRIHHAMRTIGLSRKALDMMCERALSRRTQGSRLSDKQFVQGYIADSYAQLLQFRLM  313

Query  119  TIHCAEVMDSDGD---PRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQG  175
             ++ A  +D   D    R DI+A+K+ +P  +H +  RA+QV+G  GV+ ++P  GM  G
Sbjct  314  VLYTAWEIDKYNDYKKVRKDIAAVKVVMPTVLHDIAWRAMQVHGALGVTNEMPFMGMVTG  373

Query  176  ARTLRLADGPDEVHRILIAKQILKKYK  202
            A  + LADGP EVH+  +AKQ+L+ Y+
Sbjct  374  AAVMGLADGPTEVHKTTVAKQVLRDYR  400

	
	
	

ORF finding

Résultats de  recherche de l'ORF:SMS, any codon, reverse
>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 636.
ATGACTCAAATTATAGTCCCCACAAATTCTCCAGGATTCAATATCATAAGATCAGTACCA
ATTTGGGGTCATACTGGAGGCGATCACGTAGAAATTAAATACGAAAACGTGAGAGTCCCT
TTAGAAAATCAACTAGGTGCAAGAGGATCTGGTCATGCTGCAGCTCAAGATAGATTAGGT
GCTGGAAGAGTCTTTCATTGCATGAACAGTATAGGTCAAATGTGGCGTGCTTTTGATCTT
ATGTCTAAGAGAACTACAACTAGAGAAGTTCATGGTGGTCTTCTTGAAAGCAAGCAAATG
ATTCAAGGTTTTATTGCCGACTCATACATAGACATCCAAACTGCAAGATTAATGACAATA
CATTGTGCTGAAGTTATGGACTCTGATGGTGATCCAAGAGTGGATATATCTGCAATCAAA
ATTTATGTTCCTGCAGCTATGCATCGTGTTGTTGATCGAGCTATCCAAGTTTATGGTTGG
AAAGGTGTTTCTGCAGATTTACCTTTATTTGGAATGTATCAGGGAGCAAGGACATTACGT
CTAGCCGATGGTCCAGATGAAGTTCACAGAATTTTAATCGCTAAACAAATTCTCAAAAAA
TATAAAGACGGACTTTCCTGGGATTTTGGAGTTTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MTQIIVPTNSPGFNIIRSVPIWGHTGGDHVEIKYENVRVPLENQLGARGSGHAAAQDRLG
AGRVFHCMNSIGQMWRAFDLMSKRTTTREVHGGLLESKQMIQGFIADSYIDIQTARLMTI
HCAEVMDSDGDPRVDISAIKIYVPAAMHRVVDRAIQVYGWKGVSADLPLFGMYQGARTLR
LADGPDEVHRILIAKQILKKYKDGLSWDFGV*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 356 to base 544.
CAATACATTGTGCTGAAGTTATGGACTCTGATGGTGATCCAAGAGTGGATATATCTGCAA
TCAAAATTTATGTTCCTGCAGCTATGCATCGTGTTGTTGATCGAGCTATCCAAGTTTATG
GTTGGAAAGGTGTTTCTGCAGATTTACCTTTATTTGGAATGTATCAGGGAGCAAGGACAT


Résultats de recherche d'ORF: SMS, any codon, sens 
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 229.
TTATCAATAGACGTAAACGTAAATTTTTTATCTTCTGGCGAACCAAAGTTGACAATTGCA
GTAGCGAGAATTAATAAAATAGGGAAATCAATTGCATTCTCTTCTGCCGATTTGTTTCAA
GATGATGAGCTTATTGCAACTGCTAGTTCGTCAATTAAACTTAAAGACTTTGAATCCAGA
AATTGGATCGACGACACGATAGGTAAAAACGTTAAAATAATAAGATAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
LSIDVNVNFLSSGEPKLTIAVARINKIGKSIAFSSADLFQDDELIATASSSIKLKDFESR
NWIDDTIGKNVKIIR*

No ORFs were found in reading frame 3.