ORF WK18240

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160131.1
Annotathon code: ORF_WK18240
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : juli
Annotated on : 2008-03-19 18:52:37
  • ENJALBERT julie
  • SIMONI aurelie

Synopsis

Genomic Sequence

>AACY01160131.1 ORF_WK18240 genomic DNA
GAAGGTTTGATATTTCTTTTTTAGTTAATGTCTTGTTAACAATGTCATAACTCAGACCTTTAGGGACTATTTCCCAAACCAAAGCGCGGCCCACTGTTGT
CTCTACACGTCGGACATTCGATGAGAGGGAACCCGTATCAGGATCTTTTTGATATTCAGTCACTCGCACAACAATCTTAGACTGAAGACTCACAGCATCG
TTGTCATAAGCCATTTTTACTTGGTCGGTATTACTAAAAATAGAGCCTTCGCCCGGTTCATTAGCCGCTTCACGCGTCATGTAATACAAACCAAGAACCA
CGTCCTGACTTGGAACAATAATCGGTTCACCATTCGCAGGATGCAGCACATTATTTGTTGCCATCATCAACGAACGCGCTTCTAACTGAGCTTCTAATGT
CAAAGGCACGTGAACAGCCATTTGGTCACCATCAAAGTCCGCGTTATAAGCAGCACATACCAGAGGGTGTAATTGAATCGCCTTACCTTCAACCAAAACA
GGCTCAAACGCTTGAATACCTAAGCGGTGTAATGTAGGAGCTCGGTTTAAAAGCACCGGGTGCTCACGAATCACCTCATCAAGAATATCCCAGACTTCCG
GTGACTCACTGTCGACTAACTTTTTCGCTGCTTTGATTGTTGTAGCAAACTCTCTACGTTGCAACAAACTAAAAATAAAAGGCTTAAACAGCTCCAGCGC
CATTTTTTTAGGTAGCCCGCATTGATGAAGCTTGAGCTCAGGACCGACAACGATCACAGAACGACCTGAATAATCCACACGCTTACCTAATAAATTTTGT
CTAAAACGACCTTGCTTACCTTTAATCATATCGGTTAATGACTTCAGTGGACGCTTATTTGAACCCGACATAGCTCGCCCACGACGACCATTATCAAGCA
ACGCATCTACAGCTTCTTTG

Translation

[2 - 919/920]   indirect strand
>ORF_WK18240 Translation [2-919   indirect strand]
KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKK
LVDSESPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARSLMMATNNVLHPANGEPI
IVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDNDAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK
KEISNL

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

Arbre(s) issus de neighbor :

  16 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


                            +Nmenigi  [b-protéobactérie] 
       +--------------------1 
       !                    +Ngonorr   [b-protéobactérie]
       ! 
       ! +---------xxxxx     
  +----5 ! 
  !    ! !     +--------------Csalex  [g-protéobactérie]  
  !    ! !     ! 
  !    ! !   +-8       +---Avinela   [g-protéobactérie]
  !    +-6   ! !       ! 
  !      !   ! !       !     +Pentom    [g-protéobactérie]
  !      !   ! +-------9  +-10  
  !      !   !         !  !  +Pputida   [g-protéobactérie]
  !      !   !         !  !  
  !      !   !         +-12     +PsyringTO  [g-protéobactérie]
  !      +---7            !  +-11  
  !          !            !  !  +PsyringPH  [g-protéobactérie]
  !          !            +-13  
  !          !               !  +Pfluo     [g-protéobactérie]
  !          !               +-14  
  !          !                  +PfluoPF01 [g-protéobactérie]
  !          ! 
  !          !                +Ecoli     [g-protéobactérie,enterobactérie]
  !          +----------------3 
  !                           +Sboydii   [g-protéobactérie,enterobactérie]
  ! 
  !              +---------------Brhyzo    [a-protéobactérie]
  4--------------2 
  !              +---------------Bhens     [a-protéobactérie]
  ! 
  +------Ptorquis 

Annotator commentaries

Pour notre recherche d' ORF, nous soumettons notre séquence à une lecture de phase avec any codon qui nous permet d'obtenir une ORF qui code pour une longue séquence d'aa. (lors de notre blast, nous vérifirons que la lecture par ATG ne convient pas dans les alignements deux à deux)

Nous faisons ensuite un blastp contre nr, nous obtenons d' excellents résultats, les premières meilleures séquences appartiennent à des g-protéobactéries, et leur séquences codent pour une polymérase. Les suivantes, toujours avec un excellent e-value et la même proteine, appartiennent à d'autres protéobactéries, puis bactéries. Ce grand nombre de séquences homologues montre que la protéine codée par ces séquences est très conservée et joue donc un rôle majeur pour la cellule.

Lors de la création de notre arbre nous avons choisi comme groupe d'étude les protéobactéries (gamma, beta, alpha) et comme groupe extérieur "bactéria"( qui ne sont pas des protéobactéries). La méthode par parcimonie nous proposait deux types d'arbres et nous apportait moins d'infos sur la taxonomie de notre séquence. De ce fait nous avons privilégié la méthode: NJ. Cet arbre pourrait nous faire penser que notre séquence appartiendrait à une g-protéobactérie. Comme nous l'avons déjà dit, les homologues de notre séquence codent pour une ARN polymérase, nous serions tenté de penser que notre ORF coderait aussi pour cette enzyme. Vérifions!!!

En ce qui concerne les domaines protéiques, en utilisant interpro nous trouvons trois domaines protéiques en rapport avec notre hypothétique fonction. Ces domaines sont spécifiques de l'ARN polymérase.


Grâce à notre étude nous pouvons donc supposer que notre ORF appartiendrait à une g-protéobactérie et coderait pour une ARN polymérase ( tous les homologues codent pour cette protéine et on trouve les domaines protéiques correspondants sur notre séquence). Ainsi notre protéine intervindrait dans le mécanisme de transcription grâce notament à son site de liaison à l'ADN.

Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Pfluo           --MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
PfluoPF01       --MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
PsyringPH       --MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
PsyringTO       --MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
Pentom          --MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
Pputida         --MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
Avinela         --MKDLLNLLKNQGQLEEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFC
Csalex          --MKDLVKVLKSQAQSEEFDAIKITLASPDMIRSWSYGEVKKPETINYRTFKPERDGLFC
Ecoli           --MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFC
Sboydii         --MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFC
xxxxx           ------------------------------------------------------------
Ngonorr         MNLLNLFNPLQTAGMEEEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFC
Nmenigi         MNLLNLFNPLQTAGMEEEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFC
Ptorquis        ------------------------------------------------------------
Bhens           -MNHEVMNLFNPQSPAQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFC
Brhyzo          -MNQEIMNLFNPTTPAQVFDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFC
                                                                            

Pfluo           AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
PfluoPF01       AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
PsyringPH       AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
PsyringTO       AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
Pentom          AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
Pputida         AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
Avinela         AKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAHIELASPVAHIWFLK
Csalex          AKIFGPVKDYECLCGKYKRMKHRGIICEKCGVEVTKAAVRRERMGHIELAAPVAHIWFLK
Ecoli           ARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLK
Sboydii         ARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLK
xxxxx           ------------------------------------------------------------
Ngonorr         AKIFGPVKDYECLCGKYKRLKFKGVTCEKCGVEVTLSKVRRERMGHIELAAPVAHIWFLK
Nmenigi         AKIFGPVKDYECLCGKYKRLKFKGVTCEKCGVEVTLSKVRRERMGHIELAAPVAHIWFLK
Ptorquis        ----------ECLCGKYKRRKHRGVICEKCGVEVTATKVRRERMGHIELASPVAHIWFLK
Bhens           ARIFGPIKDYECLCGKYKRMKYKGIICEKCGVEVTLSRVRRERMGHIELAAPVAHIWFLK
Brhyzo          ARIFGPIKDYECLCGKYKRMKYKGIICEKCSVEVTLSRVRRERMGHIELAAPVAHIWFLK
                                                                            

Pfluo           SLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
PfluoPF01       SLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
PsyringPH       SLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
PsyringTO       SLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
Pentom          SLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
Pputida         SLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
Avinela         SLPSRIGLLLDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDEQYFEALEEFG-DDFD
Csalex          SLPSRIGMFLDMTLRDIERVLYFESFMVIDPGMTTLERGQLLNDEQYFEALEEFG-DDFD
Ecoli           SLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFG-DEFD
Sboydii         SLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFG-DEFD
xxxxx           ------------------------------------------------------------
Ngonorr         SLPSRLGMVLNMTLRDIERVLYFEAFVVTDPGMTPLQRRQLLTEDDYYNKLDEYG-DDFD
Nmenigi         SLPSRLGMVLDMTLRDIERVLYFEAFVVTDPGMTPLQRRQLLTEDDYYNKLDEYG-DDFD
Ptorquis        SLPSRIGLFLDMTLREIERVLYYESFVVVEAGITDLKKGQLLTEDEYYEALDEYD-EDFT
Bhens           SLPGRISTLLDLTLKDIERVLYFENYIVTEPGLTSLKLHQLLSEEEYMLAIDEFGEDQFT
Brhyzo          SLPSRIGLLLDMTLKDLERILYFEYYVVLEPGLTALKDRQLLSEDEYLKAQDEYGQDSFT
                                                                            

Pfluo           ARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
PfluoPF01       ARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
PsyringPH       ARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
PsyringTO       ARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
Pentom          ARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
Pputida         ARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
Avinela         ARMGAEAVRELLNQIDLEHEIGRLREEIPQTNSETKIKKLSKRLKLMEAFQGSGNLPEWM
Csalex          ARMGAEAVQALLNDVDLDEEIERLREEIPQTNSETKIKKLSKRLKLLEAFQKSGNDPAWM
Ecoli           AKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWM
Sboydii         AKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWM
xxxxx           ------------------------------------------------------------
Ngonorr         AKMGAEGIRELLRTLDVAGEIEILRQELESTGSDTKIKKIAKRLKVLEAFHRSGMKLEWM
Nmenigi         AKMGAEGIRELLRTLNVAGEIEILRQELESTGSDTKIKKIAKRLKVLEAFHRSGMKLEWM
Ptorquis        AMMGAEAVQMLLAEVDVEKETQEIREELNTSNSETKIKKLQKRLKLMEAFKESGQKPEWM
Bhens           AMIGAEAIYELLASMELEKIANDLRAELSETTSELKQKKLIKRLKIVENFLESGNRPEWM
Brhyzo          AMIGAEAIRELLKGMDLEKLEASLRVEMQETDSDIKHKKLAKRLKIVEAFRHSGNKPEWM
                                                                            

Pfluo           VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLSAPDIIVRNEKR
PfluoPF01       VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLSAPDIIVRNEKR
PsyringPH       VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLSAPDIIVRNEKR
PsyringTO       VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLSAPDIIVRNEKR
Pentom          VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLSAPDIIVRNEKR
Pputida         VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLSAPDIIVRNEKR
Avinela         VLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKR
Csalex          IMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPDIIVRNEKR
Ecoli           ILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKR
Sboydii         ILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKR
xxxxx           ------------------------------------------------------------
Ngonorr         IMDVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLELHAPDIIVRNEKR
Nmenigi         IMDVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLELHAPDIIVRNEKR
Ptorquis        IMNVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPEIIVRNEKR
Bhens           IMKTIPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLIELRAPGIIVRNEKR
Brhyzo          IMTVVPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLMELRAPDIIIRNEKR
                                                                            

Pfluo           MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
PfluoPF01       MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
PsyringPH       MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
PsyringTO       MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
Pentom          MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
Pputida         MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
Avinela         MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
Csalex          MLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
Ecoli           MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
Sboydii         MLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITV
xxxxx           --KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVV
Ngonorr         MLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFRQNLLGKRVDYSGRSVITV
Nmenigi         MLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFRQNLLGKRVDYSGRSVITV
Ptorquis        MLQESVDALLDNGRRGRAILGTNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVVVS
Bhens           MVQEAVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVT
Brhyzo          MLQEAVDALFDNGRRGRVITGANKRPLKSLADMLKGKQGRFRQNLLGKRVDYSGRSVIVV
                  :*:**:*:******:.: *:********:**:*** *******************:. 

Pfluo           GPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIR
PfluoPF01       GPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIR
PsyringPH       GPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIR
PsyringTO       GPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIR
Pentom          GPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIR
Pputida         GPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIR
Avinela         GPTLRLHQCGLPKKMALELFKPFIFGKLETRGMATTIKAAKKMVERELPEVWDVLAEVIR
Csalex          GPTLRLHQCGLPKKMALELFKPFIYSKLQAGGQASTIKAAKKMVERELPEVWDILADVIR
Ecoli           GPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIR
Sboydii         GPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIR
xxxxx           GPELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIR
Ngonorr         GPYLRLHQCGLPKKMALELFKPFIFHKLEKQGLASTVKAAKKLVEQEVPEVWDILEEVIR
Nmenigi         GPYLRLHQCGLPKKMALELFKPFIFHKLEKQGLASTVKAAKKLVEQEVPEVWDILEEVIR
Ptorquis        GPTLKLHQCGLPKKMALELFKPFIFNRLEQKGITITIKAAKQLVEEETPEVWDCLDEVIR
Bhens           GPELKLHQCGLPKKMALELFKPFIYARLDAKGYSSTVKQAKKLVEKEHPEVWDILDEVIR
Brhyzo          GPELRLHQCGLPKKMALELFKPFIYSRLDAKGLSTTVKQAKKLVEKERPEVWDILDEVIR
                ** *:*******************:  *:    : *:* **::*: * . *** * :***

Pfluo           EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
PfluoPF01       EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
PsyringPH       EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
PsyringTO       EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Pentom          EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Pputida         EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Avinela         EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Csalex          EHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Ecoli           EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Sboydii         EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
xxxxx           EHPVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQ
Ngonorr         EHPIMLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQ
Nmenigi         EHPIMLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQ
Ptorquis        EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQ
Bhens           EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQ
Brhyzo          EHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQ
                ***::*****************:*:************:*:***************:****

Pfluo           LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVF
PfluoPF01       LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVF
PsyringPH       LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVF
PsyringTO       LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVF
Pentom          LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVF
Pputida         LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVF
Avinela         LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAVNARGEGRVFADLQEVDRVF
Csalex          LESRTLMMATNNVLSPANGEPIIVPSQDVVLGLYYMTREKIGAPGEGMVFSNLDEVERAF
Ecoli           LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLY
Sboydii         LEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLY
xxxxx           LEARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAY
Ngonorr         MEARTLMLASNNVLSPANGEPIIVPSQDIVLGLYYMTRDRINAKGEGSLFADVKEVHRAY
Nmenigi         MEARTLMLASNNVLSPANGEPIIVPSQDIVLGLYYMTRDRINAKGEGSLFADVKEVHRAY
Ptorquis        LEARALMMSTNNILSPASGEPIIQPNQDVVLGIYYLTKEDFNLPGEGRSFVDVHEVKRAF
Bhens           LEARVLMMSTNNILHPANGAPIIVPSQDMVLGLYYLSIVSEKEPGEGMVFSDIGELHHAL
Brhyzo          LEARVLMMSTNNILHPANGQPIIVPSQDIVLGLYYVSIMREGLPGEGKIFGDMAELEHAL
                :*:* **:::**:* **.* *** *.**:***:**::       ***  : .  : .   

Pfluo           RAGEAALHAKIKVRISETVNDRDGG-SVSATRIVDTTVGRALLFQVVPKG--LSFDVVNL
PfluoPF01       RAGEAALHAKIKVRINETVNDRDGN-SVNNTRIVDTTVGRALLFQVVPKG--LSFDVVNL
PsyringPH       RAGEAALHAKVKVRIHETVNDRDGG-SVKNTRIVDTTVGRALLFQVVPAG--LSYDVVNQ
PsyringTO       RAGEAALHAKVKVRIHETVNDRDGG-SVKNTRIVDTTVGRALLFQVVPAG--LSYDVVNQ
Pentom          RAGEAALHAKIKVRINETVKDRDGS-ITKNTRIVDTTVGRALLFQVVPAG--LPYDVVNQ
Pputida         RAGEAALHAKIKVRINETVKERDGS-VVKNTRIVDTTVGRALLFQVVPAG--LPYDVVNQ
Avinela         RGGEASLHARVKVRINETVRQKDGS-LVHNTRIVDTTVGRALLFQVVPAG--LSFDVVNQ
Csalex          GTQSVSLHARVKVRLTEYDRDEDGGEWTSSTKIHDTTVGRALLYRILPKG--MPFELVDQ
Ecoli           RSGLASLHARVKVRITEYEKDANGE-LVAKTSLKDTTVGRAILWMIVPKG--LPYSIVNQ
Sboydii         RSGLASLHARVKVRITEYEKDANGE-LVAKTSLKDTTVGRAILWMIVPKG--LPYSIVNQ
xxxxx           DNDAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKG--LSYDIVNK
Ngonorr         HTKQVELGTKITVRLREWVKNEAGE-FEPVVNRYETTVGRALLSEILPKG--LPFEYVNK
Nmenigi         HTKQVELGTKITVRLREWVKNEAGE-FEPVVNRYETTVGRALLSEILPKG--LPFEYVNK
Ptorquis        LEKQINLHTKIKVRVQE----------GEEKNLHETTVGRCLLYEIMPKG--LDFNKVNK
Bhens           ENKVVTLHTKIKGRVKNIDKDGKEV-----AKLYDTTPGRLIIGELLPKNPSISFDIVNQ
Brhyzo          HAKVIHLHTKIKYRWQGMDETGKVS-----TRWIETTAGRVMLGNLLPKNPRISYEIINK
                      * :::  *                    :** ** ::  ::* .  : :. :: 

Pfluo           PMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTISGVSIGVNDFVIPDEKARII
PfluoPF01       PMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTISGVSIGVNDFVIPDEKARII
PsyringPH       PMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTISGVSIGVNDFVIPDEKARII
PsyringTO       PMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTISGVSIGVNDFVIPDEKARII
Pentom          PMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTISGVSIGVNDFVIPDEKARII
Pputida         PMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTISGVSIGVNDFVIPDEKARII
Avinela         PMKKKAISKLINHCYRTVGLKDTVIFADQLMYTGFAFSTLSGVSIGVNDFVIPTEKARII
Csalex          PMKKKAISGLINAVYRRSGLKDTVIFADQLMYTGFRLATWSGASIGVNDFVIPDSKKEIV
Ecoli           ALGKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEII
Sboydii         ALGKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEII
xxxxx           TLTKKEISNL--------------------------------------------------
Ngonorr         ALKKKEISKLINASFRLCGLRDTVIFADHLMYTGFGFAAKGGISIAVDDMEIPKEKAALL
Nmenigi         ALKKKEISKLINASFRLCGLRDTVIFADHLMYTGFGFAAKGGISIAVDDMEIPKEKAALL
Ptorquis        TLKKKDILNLISSVYKDFGLKESVLFADKLMY----------------------------
Bhens           EMTKKNISKMIDQVYRHCGQKETVIFCDRIMQLGFSHACRAGISFGKDDMLIPDSKLRLV
Brhyzo          LMTKREISGVIDQVYRHCGQKETVIFCDRIMALGFYNAFKAGISFGKDDMVVPHGKWKIV
                 : *: *  :                                                  

Pfluo           GAATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVSKAMMANLSKEKVIDRNGDEV
PfluoPF01       GAATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVSKAMMANLSKEKVIDRHGDEV
PsyringPH       DAATEEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVSKAMMSNLSKEKVIDRHGVEV
PsyringTO       DAATEEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVSKAMMSNLSKERVIDRHGVEV
Pentom          GTATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVSKAMMANLSKEKVIDRNGDEV
Pputida         GNATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVSKAMMANLSKEKVIDREGKEV
Avinela         EGATEEVKEIESQYATGLVTQGEKYNKVIDLWSKANDEVSKAMMANLSKEKVIDRQGNEV
Csalex          DGAEEEVKEIENQFSSGLVTAGEKYNKVIDIWSKANDKVAKAMMAGISKETAIDREGNEV
Ecoli           SEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEE
Sboydii         SEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEE
xxxxx           ------------------------------------------------------------
Ngonorr         AEANAEVKEIEDQYRQGLVTNGERYNKVVDIWGRAGDKIAKAMMDNLSKQKVIDRDGNEV
Nmenigi         AEANAEVKEIEDQYRQGLVTNGERYNKVVDIWGRAGDKIAKAMMDNLSKQKVIDRDGNEV
Ptorquis        ------------------------------------------------------------
Bhens           AETEALAKEYEQQYNDGLITQGEKYNKVVDAWGKCTDRVADEMMKRIQAVEFDPKTG---
Brhyzo          DTTRTLAKDFEQQYNDGLITHGEKYNKVVDAWSKATEEIAKAMMKEISATKKTASG----
                                                                            

Pfluo           EQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLSVLQYFI
PfluoPF01       EQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLSVLQYFI
PsyringPH       DQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLSVLQYFI
PsyringTO       DQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLSVLQYFI
Pentom          EQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLSVLQYFI
Pputida         EQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLSVLQYFI
Avinela         EQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFI
Csalex          EQDSFNSVFIMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFI
Ecoli           KQVSFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFI
Sboydii         KQVSFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFI
xxxxx           ------------------------------------------------------------
Ngonorr         DQESFNSIYMMADSGARGSAAQIKQLSGMRGLMAKPDGSIIETPITSNFREGLTVLQYFI
Nmenigi         DQESFNSIYMMADSGARGSAAQIKQLSGMRGLMAKPDGSIIETPITSNFREGLTVLQYFI
Ptorquis        ------------------------------------------------------------
Bhens           RQRPMNSIYMMSHSGARGSANQMKQLAGMRGLMAKPSGEIIETPIISNFKEGLTVNEYFN
Brhyzo          ADADINSIYMMAHSGARGSPAQMRQLAGMRGLMAKPSGEIIETPIISNFKEGLSVLEYFN
                                                                            

Pfluo           STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEIDCGTEHGLLMTPHIEGGDVVEP
PfluoPF01       STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEIDCGTEHGLLMTPHIEGGDVVEP
PsyringPH       STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEVDCGTEHGLLMTPHIEGGDVVEP
PsyringTO       STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEVDCGTEHGLLMTPHIEGGDVVEP
Pentom          STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEIDCGTEQGLLMTPHIEGGDVVEP
Pputida         STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEIDCGTDQGLVMTPHIEGGDVVEP
Avinela         STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEIDCGTEQGLLMTPHIEGGDVVEP
Csalex          STHGARKGLADTALKTANSGYLTRRLVDVSQDLVITEEDCGTEDGLTLHPVIEGGDVIVS
Ecoli           STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEP
Sboydii         STHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEP
xxxxx           ------------------------------------------------------------
Ngonorr         ATHGARKGLADTALKTANSGYLTRRLVDVTQDLVVVEDDCGTSDGFVMKAVVQGGDVIEA
Nmenigi         ATHGARKGLADTALKTANSGYLTRRLVDVTQDLVVVEDDCGTSDGFVMKAVVQGGDVIEA
Ptorquis        ------------------------------------------------------------
Bhens           STHGARKGLADTALKTANSGYLTRRLVDVAQDAIISAVDCGTAKGLTMQPIVDAGQIVAS
Brhyzo          STHGARKGLADTALKTANSGYLTRRLVDVAQDCIITQDDCGTKLGIKMRAIVDAGTVVAS
                                                                            

Pfluo           LGERVLGRVIARDVFKPGTEDVIVPAGTLVDEKWVEFIELNSIDEVIVRSPISCETRYGI
PfluoPF01       LGERVLGRVIARDVFKPGTEDVIVPAGTLVDEKWVEFIELNSIDEVIVRSPISCETRYGI
PsyringPH       LGERVLGRVIARDVFKPGTEDVIVPAGTLVDEKWVEFIELNSIDEVIVRSPISCETRYGI
PsyringTO       LGERVLGRVIARDVFKPGTEEIIVPAGTLVDEKWVEFIELNSIDEVIVRSPISCETRYGI
Pentom          LGERVLGRVIARDVFKPGTEDVIVPAGTLVDEQWVEFIELNSIDEVIVRSPINCETRYGI
Pputida         LGERVLGRVIARDVFKPGTEDVIVPAGTLVDEQWVEFIELNSIDEVIVRSPINCETRYGI
Avinela         LGERVLGRVIARDVFRPGGDEVIVPAGTLIDEKWVEFIEMNSIDEVVVRSPITCETRYGI
Csalex          LAQRVLGRVVAQDVVDPATDDVLIARGTLLDEAWCARLDTMGVDEIVVRSAITCETAHGV
Ecoli           LRDRVLGRVTAEDVLKPGTADILVPRNXLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGV
Sboydii         LRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGV
xxxxx           ------------------------------------------------------------
Ngonorr         LRDRILGRVTASDVVDPSSGETLVEAGTLLTEKLVDMIDQSGVDEVKVRTPITCKTRHGL
Nmenigi         LRDRILGRVTASDVVDPSSGETLVEAGTLLTEKLVDMIDQSGVDEVKVRTPITCKTRHGL
Ptorquis        ------------------------------------------------------------
Bhens           LGQRILGRTALVDILHPVSGEVILEGGAMIEEADVAKIEEAGIQSVQIRSALTCETRLGV
Brhyzo          LGSRILGRTACEDVRD-SSGKVIIKRGTLMEESHLDAIHQGGVQEVKIRSALTCELVNGI
                                                                            

Pfluo           CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKN
PfluoPF01       CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKN
PsyringPH       CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKN
PsyringTO       CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKN
Pentom          CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKN
Pputida         CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKN
Avinela         CAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAVDNVQVKN
Csalex          CSACYGRDLARGHQVNVGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRASAVDSVQVKH
Ecoli           CAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKN
Sboydii         CAYCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKN
xxxxx           ------------------------------------------------------------
Ngonorr         CAHCYGRDLARGKLVNAGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAASQVEAKS
Nmenigi         CAHCYGRDLARGKLVNAGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAASQVEAKS
Ptorquis        ------------------------------------------------------------
Bhens           CAKCYGRDLARGTPVNQGEAVGVIAAQSIGEPGTQLTMRTFHLGGTAQVVDSSHLEASYE
Brhyzo          CGKCYGRDLARGTPVNHGEAVGVIAAQSIGEPGTQLTMRTFHIGGAAQLNEQSFVESNFD
                                                                            

Pfluo           GGTVRLHN-LKHVERVDGHLVAVSRSGELAIADDFGRERERYKLPYGAVISVKEGDKVDA
PfluoPF01       GGTVRLHN-LKHVERVDGNLVAVSRSGELAIADDFGRERERYKLPYGAVISVKEGDKVDA
PsyringPH       GGTVRLHN-LKHVERVDGHLVAVSRSGELAIADDFGRERERYKLPYGAVISVKEGDKVDA
PsyringTO       GGTVRLHN-LKHVERVDGHLVAVSRSGELAIADDFGRERERYKLPYGAVISVKEGDKVDA
Pentom          GGMVRLHN-LKQVVRADGNLVAVSRSGELAIADEFGRERERYKLPYGAVISVKEGEKVEA
Pputida         GGMVRLHN-LKQVERADGNLVAVSRSGELAIADEFGRERERYKLPYGAVISVKEGEKVEA
Avinela         GGNIRLHN-LKYVERSDGALVAVSRSGELAVADDFGRERERYKLPYGAVISVKEGDKVSP
Csalex          GGTVRLHN-IKHVERSDGKLVVVSRSSALAVADEHGREREYYKLPYGAELSVRDGDMVEA
Ecoli           KGSIKLSN-VKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAG
Sboydii         KGSIKLSN-VKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAG
xxxxx           ------------------------------------------------------------
Ngonorr         NGTARFSSQMRYVANNKGELVVIGRSCEVVIHDDIGRERERHKVPYGAILLVQDGMAIKA
Nmenigi         NGTARFSSQMRYVANNKGELVVIGRSCEVVIHDDIGRERERHKVPYGAILLVQDGMAIKA
Ptorquis        ------------------------------------------------------------
Bhens           GTVEIRNR--NVVRNSEGHLVVMGRNMAILIKDGSGKERVVHRISYGAHIFVDDGDVVKC
Brhyzo          GKIVIRNK--AIARNSEGHLIAMVRNMVVAIVDADGTERATHRIQYGSRLHVDEGDTVKR
                                                                            

Pfluo           GAIVAKWDPHTHPIVTEMKGTVTYVGMEEGITIKRQTDELTGMTNIEVLDVKDRP-AAGK
PfluoPF01       GAIVAKWDPHTHPIVTEMKGTVTYVGMEEGITIKRQTDELTGMTNIEVLDAKDRP-AAGK
PsyringPH       GSIVAKWDPHTHPIVTEMKGTVTYVGMEEGITIKRQTDELTGMTNIEVLDAKDRP-AAGK
PsyringTO       GSIVAKWDPHTHPIVTEMKGTVTYVGMEEGITIKRQTDELTGMTNIEVLDAKDRP-AAGK
Pentom          GAIVAKWDPHTHPIVTELKGTVTFVGMEENITIKRQTDELTGLTNIEVMDVKDRP-AAGK
Pputida         GAIVAKWDPHTHPIVTELKGTVTFVGMEENITIKRQTDELTGLTNIEVLDVKDRP-AAGK
Avinela         GAIVAKWDPHTHPIVTEMKGTVTFVGMEEGITIKRQTDELTGLTNIEVIDPKDRP-AAGK
Csalex          GTPVAKWDPHTHPVVAEVEGKVQFSDMEEGLTIHRSVDEMTGLSNIEVIESASRP-ASGR
Ecoli           GETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERT-AGGK
Sboydii         GETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERT-AGGK
xxxxx           ------------------------------------------------------------
Ngonorr         GQTLATWDPHTRPMITEHAGMVKFENMEEGVTVAKQTDDVTGLSTLVVIDGKRRSSSASK
Nmenigi         GQTLATWDPHTRPMITEHAGMVKFENVEEGVTVAKQTDDVTGLSTLVVIDGKRRSSSASK
Ptorquis        ------------------------------------------------------------
Bhens           GQRIAEWDPYTRPILTEVEGYVGFEDMIDGLSVTETADESTGITKRLVIDWRANP--RGA
Brhyzo          GQRIVEWDPYTRPLLTEVEGTIGFEDLVEGQSISETLDEATGIAKRVVIDWRSTR--GGS
                                                                            

Pfluo           DIRPAVKMVGMDGKDLLLPGTDVPAQYFLPANALVGVADGAQIAIGDVIARIPQETSKTR
PfluoPF01       DIRPAVKMVDDNGKDLLLPGTDVIAQYFLPANALVGVADGAKIAIGDVIARIPQETSKTR
PsyringPH       DIRPAVKMVGLDGKDLLLPGTDVPAQYFLPANALVGVADGAQIAIGDVIARIPQETSKTR
PsyringTO       DIRPAVKMVGLDGKDLLLPGTDVPAQYFLPANALVGVADGAQIAIGDVIARIPQETSKTR
Pentom          EIRPAIKMVDANGKDLYLPGTDVPAQYFLPANALVGVADGAQIGVGDVIARIPQETSKTR
Pputida         EIRPAIKMVDASGKDLYLPGTDVPAQYFLPANALVGVADGAQIGVGDVIARIPQETSKTR
Avinela         DIRPAVKLVDASGKELLLPGTDVPAQYFLPANALVGVADGAEVGVGDVIARIPQETSKTR
Csalex          DKRPMIMLLDENGGHVTLPGSNTPVQYMLPGKAIISVENGGQVGVGEVIARIPVEASGNK
Ecoli           DLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTK
Sboydii         DLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTK
xxxxx           ------------------------------------------------------------
Ngonorr         LLRPTVKLLDENGVEICIPGTSTPVSMAFPVGAVITVREGQEIGKGDVLARIPQASSKTR
Nmenigi         LLRPTVKLLDENGVEICIPGTSTPVSMAFPVGAVITVREGQEIGKGDVLARIPQASSKTR
Ptorquis        ------------------------------------------------------------
Bhens           DLKPAIIIHADKKGEAIAKYKGAEARYMMSVETILSVEPGSHVKAGDVIARLPMESAKTK
Brhyzo          DLRPAIVVKG-KDGKVLKLARGGDARYMLSVDAILSVDIGAKVAPGDILARVSTESAKTR
                                                                            

Pfluo           DITGGLPRVADLFEARRPKEASILAEVSGTIAFGKETKGKRRLVITPNDGS-DPYEELIP
PfluoPF01       DITGGLPRVADLFEARRPKEASILAEVSGTIAFGKETKGKRRLVITPNDGS-DPYEELIP
PsyringPH       DITGGLPRVADLFEARRPKEASILAEVSGTIAFGKETKGKRRLVITPNDGS-DPYEELIP
PsyringTO       DITGGLPRVADLFEARRPKEASILAEVSGTIAFGKETKGKRRLVITPNDGS-DPYEELIP
Pentom          DITGGLPRVADLFEARRPKEASILAEVSGTIAFGKETKGKRRLVITPTDGS-DPYEELIP
Pputida         DITGGLPRVADLFEARRPKEASILAEVSGTIAFGKETKGKRRLVITPTDGS-DPYEELIP
Avinela         DITGGLPRVADLFEARRPKEPSILAEVSGTISFGKETKGKRRLVITPNDGS-EAYEELIP
Csalex          DITGGLPRVADLFEARKPKEPAILAEVTGTISFGKETKGKRRLTITPEEG--DPLEMLIP
Ecoli           DITGGLPRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGS-DPYEEMIP
Sboydii         DITGGLPRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGS-DPYEEMIP
xxxxx           ------------------------------------------------------------
Ngonorr         DITGGLPRVAELFEARVPKDAGMLAEITGTVSFGKETKGKQRLIITDVDG--VAYETLIS
Nmenigi         DITGGLPRVAELFEARVPKDAGMLAEITGTVSFGKETKGKQRLIVTDVDG--VAYETLIS
Ptorquis        ------------------------------------------------------------
Bhens           DITGGLPRVAELFEARRPKDHAIIAEVSGTIRFGRGYKNKRRIIIEPNDETLEPVEYLIP
Brhyzo          DITGGLPRVAELFEARRPKDAAIIAEIAGTIRFGRDYKNKRRISIEPMDKTDEPREYLIP
                                                                            

Pfluo           KWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
PfluoPF01       KWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
PsyringPH       KWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
PsyringTO       KWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
Pentom          KWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
Pputida         KWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
Avinela         KWRHLNVFEGEQVNRGEVISDGPSNPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDK
Csalex          KWRQIGVFEGETVEKGEVISDGPSNPHDILRLLGVAELAKYITAEIQDVYRLQGVVIDDK
Ecoli           KWRQLNVFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDK
Sboydii         KWRQLNVFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDK
xxxxx           ------------------------------------------------------------
Ngonorr         KEKQILVHDGQVVNRGETIVDGAVDPHDILRLQGIEALARYIVQEVQEVYRLQGVKISDK
Nmenigi         KEKQILVHDGQVVNRGETIVDGAVDPHDILRLQGIEALARYIVQEVQEVYRLQGVKISDK
Ptorquis        ------------------------------------------------------------
Bhens           KGKLFHFQEGDQIEKGDYILDGNPAPHDILAIKGVEALASYLVNEIQEVYRLQGVLINDK
Brhyzo          KGKHIHLQDGDVVEKGDFIVEGNPAPHDILAVKGIEELAAYLVNEIQEVYRLQGVLINDK
                                                                            

Pfluo           HIETILRQMLRKVEIAESGDSSFIKGDQMELTHVLVENERLSTEDKFVAKFTRVLLGITK
PfluoPF01       HIETILRQMLRKVEISESGDSSFIKGDQMELTHVLVENERLNAEDKFVSKFTRVLLGITK
PsyringPH       HIETILRQMLRKVEIAESGDSSFIKGDQMELTHVLVENERLSTEDKFVSKFTRVLLGITK
PsyringTO       HIETILRQMLRKVEIAESGDSSFIKGDQMELTHVLVENERLGADDKFVSKFTRVLLGITK
Pentom          HIETILRQMLRKVEIAESGDSSFIKGDQMELTQVLVENERLAAEDKFISKYTRVLLGITK
Pputida         HIETILRQMLRKVEISESGDSSFIKGDQMELTQVLVENERLAGEDKFISKFTRVLLGITK
Avinela         HIETILRQMLRKVEITEAGDSSFIKGDQVELTQVLEENEQLATEDRFSAKYERILLGITK
Csalex          HIEVIVRQMLRKVEITDSGDSSFITGDQVEFVRVLEENQRLAQEDKFPAKYDRLLLGITK
Ecoli           HIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITK
Sboydii         HIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITK
xxxxx           ------------------------------------------------------------
Ngonorr         HIEVIIRQMLRRVNIADAGETGFITGEQVERGDVMAANEKALEEGKEPARYENILLGITK
Nmenigi         HIEVIIRQMLRRVNIADAGETGFITGEQVERGDVMAANEKALEEGKEPARYENVLLGITK
Ptorquis        ------------------------------------------------------------
Bhens           HIEVIVRQMLQKVEITESGDSGYIPGDHVDRIELDEINDNLLAEGKRPASGNPILLGITK
Brhyzo          HIEVIVRQMLQKVEVTDQGDTDMISGEQVDKIEFDALNEKAKEEGKKIATGTPVLLGITK
                                                                            

Pfluo           ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKR
PfluoPF01       ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKR
PsyringPH       ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKR
PsyringTO       ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKR
Pentom          ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKR
Pputida         ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKR
Avinela         ASLSTESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERRR
Csalex          ASLATESFISAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLVPAGTGLAHHAERRR
Ecoli           ASLATESFISAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMR
Sboydii         ASLATESFISAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMR
xxxxx           ------------------------------------------------------------
Ngonorr         ASLSTDSFISAASFQETTRVLTEAAIMGKQDELRGLKENVIVGRLIPAGTGLTYHRSRHQ
Nmenigi         ASLSTDSFISAASFQETTRVLTEAAIMGKQDELRGLKENVIVGRLIPAGTGLTYHRSRHQ
Ptorquis        ------------------------------------------------------------
Bhens           ASLQTPSFISAASFQETTRVLTEAAVSGKIDTLQGLKENVIVGRLIPAGTGGTIAQIRRI
Brhyzo          ASLQTRSFFSAASFQETTRVLTEAAVNGKVDPLEGLKENVIVGRLIPAGTGASMAKIREV
                                                                            

Pfluo           RR-DADKPLRVSASEVEAALTEALNSSGN-------
PfluoPF01       RR-DADKPLRVSASEVEAALTEALNSSGN-------
PsyringPH       RR-EMDKPTRVSASEVEAALTEALNSSGN-------
PsyringTO       RR-EMDKPTRVSASEVEAALTEALNSSGN-------
Pentom          RR-DADKPLRVSASEVEAALTEALNSSGN-------
Pputida         RR-DADKPLRVSASEVEAALTEALNSSGN-------
Avinela         KR-DAEKPVRVSAEEVEAALTEALNTSGN-------
Csalex          RREDPESTANPSAFDVEQELGAQLTALDAEDDDL--
Ecoli           RRAAGEAPAAPQVTAEDASASLAELLNAGLGGSDNE
Sboydii         RRAAGEAPAAPQVTAEDASASLAELLNAGLGGSDNE
xxxxx           ------------------------------------
Ngonorr         QWQGVEQETAETQVTDE-------------------
Nmenigi         QWQGVEQETAETQVTDE-------------------
Ptorquis        ------------------------------------
Bhens           AAVRDDLIVDEQRKSGNNEVAKAMLTNMTTVTTVE-
Brhyzo          AMKRDKLILDEREKQAAVVSPAPEAELPALPPAE--

BLAST

blastp contre nr



Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference: 
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1165223985-20980-65187418598.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,201,456 sequences; 1,445,405,603 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  Translation of ORF number 1 in reading frame 2 on the reverse strand.
Length=306



                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|118056610|ref|ZP_01525077.1|  DNA-directed RNA polymerase, ...   476    4e-133
gi|92112548|ref|YP_572476.1|  DNA-directed RNA polymerase, sub...   476    6e-133 
gi|104779749|ref|YP_606247.1|  RNA polymerase, beta prime subu...   475    9e-133 
gi|70732888|ref|YP_262656.1|  DNA-directed RNA polymerase beta...   474    2e-132 
gi|71737777|ref|YP_276712.1|  DNA-directed RNA polymerase, bet...   473    4e-132 
gi|66047781|ref|YP_237622.1|  DNA-directed RNA polymerase beta...   473    4e-132 
gi|28867848|ref|NP_790467.1|  DNA-directed RNA polymerase beta...   473    4e-132 
gi|94414344|ref|ZP_01294206.1|  hypothetical protein PaerP_010...   473    5e-132
gi|107103781|ref|ZP_01367699.1|  hypothetical protein PaerPA_0...   473    6e-132
gi|15599465|ref|NP_252959.1|  DNA-directed RNA polymerase beta...   473    7e-132 
gi|67157002|ref|ZP_00418364.1|  DNA-directed RNA polymerase [A...   472    8e-132
gi|21667489|gb|AAM74071.1|AF491331_1  RNA polymerase beta' subuni   472    8e-132
gi|58583213|ref|YP_202229.1|  DNA-directed RNA polymerase beta...   472    8e-132 
gi|82739428|ref|ZP_00902231.1|  RNA polymerase I subunit A, N-...   472    9e-132
gi|26987189|ref|NP_742614.1|  DNA-directed RNA polymerase beta...   472    9e-132 
gi|77461306|ref|YP_350813.1|  DNA-directed RNA polymerase beta...   472    1e-131 
gi|21230358|ref|NP_636275.1|  DNA-directed RNA polymerase beta...   472    1e-131 
gi|18496612|gb|AAL74151.1|AF426389_1  RNA polymerase beta prim...   472    1e-131
gi|22774033|gb|AAN07183.1|  RNA polymerase beta prime subunit/...   469    5e-131
gi|90417541|ref|ZP_01225462.1|  DNA-directed RNA polymerase be...   469    6e-131
gi|77955740|ref|ZP_00820086.1|  RNA polymerase I subunit A, N-...   469    7e-131
gi|88704390|ref|ZP_01102104.1|  RNA polymerase, beta' subunit ...   469    8e-131
gi|78046548|ref|YP_362723.1|  DNA-directed RNA polymerase beta...   468    2e-130 
gi|21241731|ref|NP_641313.1|  DNA-directed RNA polymerase beta...   468    2e-130 
gi|26250759|ref|NP_756799.1|  DNA-directed RNA polymerase beta...   467    2e-130 
gi|116215834|ref|ZP_01481766.1|  hypothetical protein VchoR_02002   467    3e-130
gi|116219528|ref|ZP_01485009.1|  hypothetical protein VchoV5_0200   467    4e-130
gi|223476|prf||0808241A  polymerase beta',RNA                       467    4e-130
gi|75179654|ref|ZP_00699658.1|  COG0086: DNA-directed RNA poly...   467    4e-130
gi|15804578|ref|NP_290619.1|  DNA-directed RNA polymerase beta...   467    4e-130 
gi|82778837|ref|YP_405186.1|  RNA polymerase, beta prime subun...   466    5e-130 
gi|110807838|ref|YP_691358.1|  RNA polymerase, beta prime subu...   466    5e-130 
gi|91212805|ref|YP_542791.1|  RNA polymerase, beta prime subun...   466    5e-130 
gi|223424|prf||0805230A  rpoC gene EcoRID fragment                  466    5e-130
gi|409789|gb|AAC43086.1|  DNA-directed RNA polymerase, beta'-subu   466    5e-130
gi|110644323|ref|YP_672053.1|  DNA-directed RNA polymerase bet...   466    6e-130 
gi|147730|gb|AAA24586.1|  RNA polymerase (rpoC)                     466    6e-130
gi|118075306|ref|ZP_01543437.1|  DNA-directed RNA polymerase, ...   466    6e-130
gi|15640356|ref|NP_229983.1|  DNA-directed RNA polymerase beta...   466    6e-130 
gi|91228702|ref|ZP_01262615.1|  DNA-directed RNA polymerase be...   466    8e-130
gi|116183879|ref|ZP_01473842.1|  hypothetical protein VEx2w_02003   466    8e-130
gi|21672327|ref|NP_660394.1|  DNA-directed RNA polymerase beta...   466    9e-130 
gi|27364617|ref|NP_760145.1|  DNA-directed RNA polymerase beta...   465    1e-129 
gi|87122757|ref|ZP_01078631.1|  DNA-directed RNA polymerase be...   465    1e-129
gi|59802171|ref|YP_208883.1|  DNA-directed RNA polymerase beta...   465    1e-129 
gi|15793169|ref|NP_282991.1|  DNA-directed RNA polymerase beta...   465    1e-129 
gi|15676061|ref|NP_273191.1|  DNA-directed RNA polymerase beta...   464    2e-129 
gi|28899695|ref|NP_799300.1|  DNA-directed RNA polymerase beta...   464    2e-129 
gi|56415981|ref|YP_153056.1|  DNA-directed RNA polymerase beta...   464    2e-129 
gi|16762299|ref|NP_457916.1|  DNA-directed RNA polymerase beta...   464    2e-129 
gi|32130456|sp|Q9PA87|RPOC_XYLFA  DNA-directed RNA polymerase ...   463    4e-129
gi|15839221|ref|NP_299909.1|  DNA-directed RNA polymerase beta...   463    4e-129 
gi|224026|prf||1008145A  polymerase beta',RNA                       463    4e-129
gi|84393082|ref|ZP_00991848.1|  DNA-directed RNA polymerase be...   463    5e-129
gi|88861461|ref|ZP_01136088.1|  RNA polymerase, beta prime sub...   463    6e-129
gi|33591289|ref|NP_878933.1|  DNA-directed RNA polymerase beta...   462    7e-129 
gi|94500502|ref|ZP_01307033.1|  DNA-directed RNA polymerase be...   462    8e-129
gi|89095344|ref|ZP_01168261.1|  DNA-directed RNA polymerase be...   462    8e-129
gi|90020572|ref|YP_526399.1|  DNA-directed RNA polymerase [Sac...   462    8e-129 
gi|28199866|ref|NP_780180.1|  DNA-directed RNA polymerase beta...   461    1e-128 
gi|71902424|ref|ZP_00684376.1|  DNA-directed RNA polymerase [X...   461    2e-128
gi|34499647|ref|NP_903862.1|  DNA-directed RNA polymerase beta...   461    2e-128 
gi|37524449|ref|NP_927793.1|  DNA-directed RNA polymerase beta...   461    2e-128 
gi|33519999|ref|NP_878831.1|  DNA-directed RNA polymerase beta...   461    2e-128 
gi|86147870|ref|ZP_01066175.1|  DNA-directed RNA polymerase be...   461    2e-128
gi|71275246|ref|ZP_00651533.1|  DNA-directed RNA polymerase [X...   461    2e-128
gi|109893826|sp|Q2L2L3|RPOC_BORA1  DNA-directed RNA polymerase...   461    2e-128
gi|83648858|ref|YP_437293.1|  DNA-directed RNA polymerase, bet...   461    3e-128 
gi|90413407|ref|ZP_01221400.1|  DNA-directed RNA polymerase be...   460    3e-128
gi|88796721|ref|ZP_01112376.1|  RNA polymerase, beta prime sub...   460    4e-128
gi|85058113|ref|YP_453815.1|  RNA polymerase beta prime subuni...   460    4e-128 
gi|15616662|ref|NP_239874.1|  DNA-directed RNA polymerase beta...   460    5e-128 
gi|71279442|ref|YP_271412.1|  DNA-directed RNA polymerase, bet...   459    5e-128 
gi|91791533|ref|YP_561184.1|  DNA-directed RNA polymerase, sub...   459    6e-128 
gi|71892325|ref|YP_278059.1|  DNA-directed RNA polymerase beta...   459    6e-128 
gi|94491356|ref|ZP_01298570.1|  hypothetical protein CburD_010...   459    8e-128
gi|77165793|ref|YP_344318.1|  DNA-directed RNA polymerase, alp...   459    8e-128 
gi|29653584|ref|NP_819276.1|  DNA-directed RNA polymerase beta...   459    8e-128 
gi|77972248|ref|ZP_00827820.1|  COG0086: DNA-directed RNA poly...   459    9e-128
gi|88799212|ref|ZP_01114791.1|  DNA-directed RNA polymerase be...   459    1e-127
gi|115305566|sp|Q6LLW3|RPOC_PHOPR  DNA-directed RNA polymerase...   459    1e-127
gi|54310497|ref|YP_131517.1|  DNA-directed RNA polymerase beta...   459    1e-127 
gi|78368994|ref|ZP_00839174.1|  DNA-directed RNA polymerase [S...   459    1e-127
gi|90581311|ref|ZP_01237108.1|  DNA-directed RNA polymerase be...   458    1e-127
gi|109896927|ref|YP_660182.1|  DNA-directed RNA polymerase, be...   458    1e-127 
gi|114561330|ref|YP_748843.1|  DNA-directed RNA polymerase, be...   457    2e-127 
gi|74316417|ref|YP_314157.1|  DNA-directed RNA polymerase beta...   457    2e-127 
gi|89075375|ref|ZP_01161797.1|  DNA-directed RNA polymerase be...   457    2e-127
gi|114773733|ref|ZP_01450758.1|  RNA polymerase, beta prime su...   457    2e-127
gi|28188321|gb|AAL78753.1|  RpoC [Baumannia cicadellinicola]        457    3e-127
gi|77957011|ref|ZP_00821080.1|  COG0086: DNA-directed RNA poly...   457    3e-127
gi|118069350|ref|ZP_01537596.1|  DNA-directed RNA polymerase, ...   457    3e-127
gi|77359194|ref|YP_338769.1|  RNA polymerase subunit beta prim...   457    3e-127 
gi|27904546|ref|NP_777672.1|  DNA-directed RNA polymerase beta...   457    3e-127 
gi|114319613|ref|YP_741296.1|  DNA-directed RNA polymerase, be...   457    4e-127 
gi|50119184|ref|YP_048351.1|  DNA-directed RNA polymerase beta...   457    4e-127 
gi|77977805|ref|ZP_00833245.1|  COG0086: DNA-directed RNA poly...   457    4e-127
gi|24371823|ref|NP_715865.1|  DNA-directed RNA polymerase beta...   456    5e-127 
gi|94493162|ref|ZP_01300366.1|  hypothetical protein Rgryl_010009   456    5e-127
gi|41018147|sp|Q9KW13|RPOC_SHEVI  DNA-directed RNA polymerase ...   456    5e-127
gi|53804615|ref|YP_113542.1|  DNA-directed RNA polymerase beta...   456    5e-127 
gi|77960651|ref|ZP_00824513.1|  COG0086: DNA-directed RNA poly...   456    6e-127
gi|88950292|ref|ZP_01152900.1|  RNA polymerase I subunit A, N-...   456    6e-127
gi|16123883|ref|NP_407196.1|  DNA-directed RNA polymerase beta...   455    1e-126 
gi|22124400|ref|NP_667823.1|  DNA-directed RNA polymerase beta...   455    1e-126 
gi|118594006|ref|ZP_01551353.1|  DNA-directed RNA polymerase s...   455    1e-126
gi|89902355|ref|YP_524826.1|  DNA-directed RNA polymerase, sub...   455    1e-126 
gi|94676668|ref|YP_588938.1|  DNA-directed RNA polymerase beta...   455    2e-126 
gi|32491272|ref|NP_871526.1|  DNA-directed RNA polymerase beta...   454    2e-126 
gi|68544662|ref|ZP_00584284.1|  DNA-directed RNA polymerase [S...   454    2e-126
gi|114331771|ref|YP_747993.1|  DNA-directed RNA polymerase, be...   454    2e-126 
gi|113951160|ref|ZP_01436750.1|  DNA-directed RNA polymerase, ...   454    2e-126
gi|82701893|ref|YP_411459.1|  DNA-directed RNA polymerase [Nit...   454    2e-126 
gi|113968538|ref|YP_732331.1|  DNA-directed RNA polymerase, be...   454    2e-126 
gi|117918651|ref|YP_867843.1|  DNA-directed RNA polymerase, be...   454    2e-126 
gi|114045701|ref|YP_736251.1|  DNA-directed RNA polymerase, be...   454    2e-126 
gi|91774629|ref|YP_544385.1|  DNA-directed RNA polymerase, sub...   454    2e-126 
gi|110833240|ref|YP_692099.1|  DNA-directed RNA polymerase, be...   454    3e-126 
gi|33152865|ref|NP_874218.1|  DNA-directed RNA polymerase beta...   454    3e-126 
gi|54296359|ref|YP_122728.1|  DNA-directed RNA polymerase beta...   454    3e-126 
gi|115305564|sp|Q5ZYP9|RPOC_LEGPH  DNA-directed RNA polymerase...   454    3e-126
gi|54293315|ref|YP_125730.1|  DNA-directed RNA polymerase beta...   453    4e-126 
gi|30249985|ref|NP_842055.1|  DNA-directed RNA polymerase beta...   453    4e-126 
gi|47574112|ref|ZP_00244148.1|  COG0086: DNA-directed RNA poly...   453    5e-126
gi|52840568|ref|YP_094367.1|  DNA-directed RNA polymerase beta...   453    6e-126 
gi|53733048|ref|ZP_00155506.2|  COG0086: DNA-directed RNA poly...   453    6e-126
gi|46156015|ref|ZP_00133526.2|  COG0086: DNA-directed RNA poly...   452    7e-126
gi|113461700|ref|YP_719769.1|  DNA-directed RNA polymerase bet...   452    7e-126 
gi|82743826|ref|ZP_00906447.1|  RNA polymerase I subunit A, N-...   452    8e-126
gi|16272458|ref|NP_438672.1|  DNA-directed RNA polymerase beta...   452    9e-126 
gi|53733301|ref|ZP_00156341.2|  COG0086: DNA-directed RNA poly...   452    9e-126
gi|68249111|ref|YP_248223.1|  DNA-directed RNA polymerase beta...   452    9e-126 
gi|110816550|sp|Q65W40|RPOC_MANSM  DNA-directed RNA polymerase...   452    1e-125
gi|52424268|ref|YP_087405.1|  DNA-directed RNA polymerase beta...   452    1e-125 
gi|46143682|ref|ZP_00134647.2|  COG0086: DNA-directed RNA poly...   452    1e-125
gi|77816616|ref|ZP_00815790.1|  DNA-directed RNA polymerase [S...   451    2e-125
gi|15603601|ref|NP_246675.1|  DNA-directed RNA polymerase beta...   451    2e-125 
gi|88812763|ref|ZP_01128009.1|  DNA-directed RNA polymerase, a...   450    4e-125
gi|75428795|ref|ZP_00731910.1|  DNA-directed RNA polymerase [A...   450    4e-125
gi|68548495|ref|ZP_00587993.1|  DNA-directed RNA polymerase [S...   450    4e-125
gi|78484634|ref|YP_390559.1|  DNA-directed RNA polymerase [Thi...   450    5e-125 
gi|115305561|sp|Q6FF89|RPOC_ACIAD  DNA-directed RNA polymerase...   449    7e-125
gi|56459457|ref|YP_154738.1|  DNA-directed RNA polymerase beta...   449    9e-125 
gi|226781|prf||1605164A  RNA polymerase beta'                       449    9e-125
gi|50083580|ref|YP_045090.1|  DNA-directed RNA polymerase beta...   449    1e-124 
gi|84714778|ref|ZP_01022070.1|  RNA polymerase I subunit A, N-...   448    2e-124
gi|118567726|gb|ABL02531.1|  DNA-directed RNA polymerase, beta...   447    2e-124
gi|91790274|ref|YP_551226.1|  DNA-directed RNA polymerase, sub...   446    5e-124 
gi|110594414|ref|ZP_01382759.1|  DNA-directed RNA polymerase, ...   446    7e-124
gi|85712784|ref|ZP_01043828.1|  DNA-directed RNA polymerase be...   446    8e-124
gi|86158018|ref|YP_464803.1|  DNA-directed RNA polymerase, sub...   446    8e-124 
gi|111616970|ref|ZP_01404001.1|  DNA-directed RNA polymerase, ...   446    9e-124
gi|41019482|sp|P19176|RPOC_PSEPU  DNA-directed RNA polymerase ...   444    2e-123
gi|45731|emb|CAA34538.1|  beta'-subunit of RNA polymerase [Pseudo   444    2e-123
gi|111611762|ref|ZP_01398850.1|  DNA-directed RNA polymerase [...   444    4e-123
gi|94312264|ref|YP_585474.1|  DNA-directed RNA polymerase, sub...   442    7e-123 
gi|117618755|ref|YP_858455.1|  DNA-directed RNA polymerase, be...   442    1e-122 
gi|56477588|ref|YP_159177.1|  DNA-directed RNA polymerase beta...   442    1e-122 
gi|93007000|ref|YP_581437.1|  DNA-directed RNA polymerase, sub...   442    1e-122 
gi|71066441|ref|YP_265168.1|  DNA-directed RNA polymerase beta...   442    1e-122 
gi|67549787|ref|ZP_00427634.1|  DNA-directed RNA polymerase [B...   441    1e-122
gi|91218673|ref|ZP_01255578.1|  DNA-directed RNA polymerase be...   441    2e-122
gi|73542872|ref|YP_297392.1|  DNA-directed RNA polymerase beta...   441    2e-122 
gi|115350315|ref|YP_772154.1|  DNA-directed RNA polymerase, be...   441    2e-122 
gi|118054120|ref|ZP_01522661.1|  DNA-directed RNA polymerase, ...   441    2e-122
gi|113869443|ref|YP_727932.1|  DNA-directed RNA polymerase bet...   441    2e-122 
gi|67645159|ref|ZP_00443463.1|  COG0086: DNA-directed RNA poly...   441    2e-122
gi|67640297|ref|ZP_00439109.1|  COG0086: DNA-directed RNA poly...   441    3e-122
gi|53720828|ref|YP_109814.1|  DNA-directed RNA polymerase beta...   441    3e-122 
gi|67734556|ref|ZP_00485678.1|  COG0086: DNA-directed RNA poly...   441    3e-122
gi|83719751|ref|YP_443579.1|  DNA-directed RNA polymerase, bet...   441    3e-122 
gi|53723862|ref|YP_104174.1|  DNA-directed RNA polymerase beta...   441    3e-122 
gi|90290123|ref|ZP_01209800.1|  hypothetical protein Bpse17_02...   441    3e-122
gi|17547752|ref|NP_521154.1|  DNA-directed RNA polymerase beta...   440    4e-122 
gi|108759710|ref|YP_631281.1|  DNA-directed RNA polymerase, be...   440    4e-122 
gi|116270490|ref|ZP_01494725.1|  DNA-directed RNA polymerase, ...   440    4e-122
gi|83749355|ref|ZP_00946351.1|  DNA-directed RNA polymerase be...   440    4e-122
gi|49475399|ref|YP_033440.1|  DNA-directed RNA polymerase beta...   440    5e-122 
gi|27380520|ref|NP_772049.1|  DNA-directed RNA polymerase beta...   439    5e-122 
gi|84360462|ref|ZP_00985163.1|  COG0086: DNA-directed RNA poly...   439    7e-122
gi|84356460|ref|ZP_00981305.1|  COG0086: DNA-directed RNA poly...   438    1e-121
gi|107024310|ref|YP_622637.1|  DNA-directed RNA polymerase, su...   438    1e-121 
gi|49474306|ref|YP_032348.1|  DNA-directed RNA polymerase beta...   438    2e-121 
gi|90407964|ref|ZP_01216137.1|  DNA-directed RNA polymerase be...   438    2e-121
gi|118035012|ref|ZP_01506430.1|  DNA-directed RNA polymerase, ...   438    2e-121
gi|118591192|ref|ZP_01548591.1|  DNA-directed RNA polymerase s...   438    2e-121
gi|89358264|ref|ZP_01196086.1|  RNA polymerase I subunit A, N-...   437    2e-121
gi|91785472|ref|YP_560678.1|  DNA-directed RNA polymerase [Bur...   437    3e-121 
gi|71905955|ref|YP_283542.1|  DNA-directed RNA polymerase beta...   437    3e-121 
gi|77918309|ref|YP_356124.1|  RNA polymerase, beta prime subun...   437    3e-121 
gi|78064917|ref|YP_367686.1|  DNA-directed RNA polymerase beta...   437    4e-121 
gi|91770310|ref|ZP_01272137.1|  DNA-directed RNA polymerase [P...   436    7e-121
gi|85715143|ref|ZP_01046127.1|  DNA-directed RNA polymerase be...   436    9e-121
gi|37912945|gb|AAR05277.1|  DNA-directed RNA polymerase beta' ...   434    2e-120
gi|85858139|ref|YP_460341.1|  DNA-directed RNA polymerase beta...   434    2e-120 
gi|83751226|ref|ZP_00947640.1|  COG0086: DNA-directed RNA poly...   434    3e-120
gi|78698569|ref|ZP_00863070.1|  DNA-directed RNA polymerase [B...   434    3e-120
gi|39936330|ref|NP_948606.1|  DNA-directed RNA polymerase beta...   433    4e-120 
gi|78221840|ref|YP_383587.1|  DNA-directed RNA polymerase, sub...   433    6e-120 
gi|37912996|gb|AAR05325.1|  DNA-directed RNA polymerase beta' ...   433    6e-120
gi|116514967|ref|YP_802596.1|  RNA polymerase, b' subunit [Buc...   433    6e-120 
gi|90417769|ref|ZP_01225681.1|  DNA-directed RNA polymerase be...   432    9e-120
gi|110634168|ref|YP_674376.1|  DNA-directed RNA polymerase, be...   432    1e-119 
gi|92117085|ref|YP_576814.1|  DNA-directed RNA polymerase, sub...   431    2e-119 
gi|91977662|ref|YP_570321.1|  DNA-directed RNA polymerase, sub...   431    2e-119 
gi|15889249|ref|NP_354930.1|  DNA-directed RNA polymerase beta...   431    2e-119 
gi|17935845|ref|NP_532635.1|  DNA-directed RNA polymerase beta...   431    2e-119 
gi|110602083|ref|ZP_01390229.1|  DNA-directed RNA polymerase, ...   431    2e-119
gi|116251533|ref|YP_767371.1|  DNA-directed RNA polymerase bet...   431    2e-119 
gi|86749406|ref|YP_485902.1|  DNA-directed RNA polymerase, sub...   431    2e-119 
gi|87198049|ref|YP_495306.1|  DNA-directed RNA polymerase, sub...   430    3e-119 
gi|117924149|ref|YP_864766.1|  DNA-directed RNA polymerase, be...   430    5e-119 
gi|75675543|ref|YP_317964.1|  DNA-directed RNA polymerase beta...   430    5e-119 
gi|23502119|ref|NP_698246.1|  DNA-directed RNA polymerase beta...   429    6e-119 
gi|17987033|ref|NP_539667.1|  DNA-directed RNA polymerase beta...   429    6e-119 
gi|86357298|ref|YP_469190.1|  DNA-directed RNA polymerase beta...   429    6e-119 
gi|62290153|ref|YP_221946.1|  DNA-directed RNA polymerase beta...   428    1e-118 
gi|94497754|ref|ZP_01304321.1|  DNA-directed RNA polymerase, s...   428    1e-118
gi|106883894|ref|ZP_01351285.1|  DNA-directed RNA polymerase, ...   428    1e-118
gi|95930692|ref|ZP_01313425.1|  DNA-directed RNA polymerase, s...   428    1e-118
gi|45644688|gb|AAS73076.1|  predicted DNA-directed RNA polymer...   428    2e-118
gi|83594026|ref|YP_427778.1|  DNA-directed RNA polymerase [Rho...   427    2e-118 
gi|113875388|ref|ZP_01415513.1|  DNA-directed RNA polymerase [...   427    2e-118
gi|90424946|ref|YP_533316.1|  DNA-directed RNA polymerase, sub...   427    3e-118 
gi|99080076|ref|YP_612230.1|  DNA-directed RNA polymerase, sub...   427    3e-118 
gi|15965102|ref|NP_385455.1|  DNA-directed RNA polymerase beta...   427    3e-118 
gi|103486970|ref|YP_616531.1|  DNA-directed RNA polymerase, su...   427    3e-118 
gi|88937665|ref|ZP_01143217.1|  RNA polymerase I subunit A, N-...   427    3e-118
gi|13470543|ref|NP_102111.1|  DNA-directed RNA polymerase beta...   427    4e-118 
gi|94987346|ref|YP_595279.1|  DNA-directed RNA polymerase, bet...   427    4e-118 
gi|84703910|ref|ZP_01017738.1|  DNA-directed RNA polymerase be...   426    7e-118
gi|78358038|ref|YP_389487.1|  DNA-directed RNA polymerase., Ac...   426    9e-118 
gi|115525595|ref|YP_782506.1|  DNA-directed RNA polymerase, be...   425    2e-117 
gi|114704477|ref|ZP_01437385.1|  DNA-directed RNA polymerase b...   424    2e-117
gi|56551628|ref|YP_162467.1|  DNA-directed RNA polymerase beta...   424    3e-117 
gi|56698329|ref|YP_168702.1|  DNA-directed RNA polymerase beta...   423    5e-117 
gi|94266149|ref|ZP_01289861.1|  DNA-directed RNA polymerase [d...   423    5e-117
gi|89257012|ref|YP_514374.1|  DNA-directed RNA polymerase, bet...   423    6e-117 
gi|56707315|ref|YP_169211.1|  DNA-directed RNA polymerase, bet...   423    6e-117 
gi|118498135|ref|YP_899185.1|  DNA-directed RNA polymerase, be...   422    9e-117 
gi|46581333|ref|YP_012141.1|  DNA-directed RNA polymerase, bet...   422    1e-116 
gi|86137186|ref|ZP_01055764.1|  DNA-directed RNA polymerase be...   421    2e-116
gi|110681144|ref|YP_684151.1|  DNA-directed RNA polymerase, be...   421    3e-116 
gi|89053060|ref|YP_508511.1|  DNA-directed RNA polymerase, sub...   420    4e-116 
gi|118579113|ref|YP_900363.1|  DNA-directed RNA polymerase, be...   420    5e-116
gi|83854988|ref|ZP_00948518.1|  DNA-directed RNA polymerase be...   420    6e-116
gi|84685444|ref|ZP_01013342.1|  DNA-directed RNA polymerase, b...   419    7e-116
gi|113934120|ref|ZP_01420021.1|  DNA-directed RNA polymerase, ...   419    9e-116
gi|88938868|ref|ZP_01144320.1|  RNA polymerase I subunit A-lik...   418    2e-115
gi|114764153|ref|ZP_01443391.1|  DNA-directed RNA polymerase b...   418    2e-115
gi|69938875|ref|ZP_00633236.1|  DNA-directed RNA polymerase [P...   417    2e-115
gi|52698495|ref|ZP_00339903.1|  COG0086: DNA-directed RNA poly...   417    2e-115
gi|15604017|ref|NP_220532.1|  DNA-directed RNA polymerase beta...   417    3e-115 
gi|91205967|ref|YP_538322.1|  DNA-directed RNA polymerase beta...   417    3e-115 
gi|102191437|ref|ZP_01347249.1|  hypothetical protein RcanM_01...   417    4e-115
gi|51473340|ref|YP_067097.1|  DNA-directed RNA polymerase beta...   417    4e-115 
gi|109728117|ref|ZP_01379528.1|  hypothetical protein RbelO_01...   417    4e-115
gi|114570351|ref|YP_757031.1|  DNA-directed RNA polymerase, be...   417    4e-115 
gi|83949806|ref|ZP_00958539.1|  DNA-directed RNA polymerase be...   416    6e-115
gi|16124758|ref|NP_419322.1|  DNA-directed RNA polymerase beta...   416    8e-115 
gi|84499870|ref|ZP_00998136.1|  DNA-directed RNA polymerase be...   414    2e-114
gi|77462252|ref|YP_351756.1|  DNA-directed RNA polymerase beta...   414    2e-114 
gi|85706812|ref|ZP_01037903.1|  DNA-directed RNA polymerase be...   414    2e-114
gi|83371925|ref|ZP_00916705.1|  RNA polymerase I subunit A, N-...   414    2e-114
gi|114771277|ref|ZP_01448697.1|  DNA-directed RNA polymerase b...   414    3e-114
gi|116748985|ref|YP_845672.1|  DNA-directed RNA polymerase, be...   414    3e-114 
gi|42453336|ref|ZP_00153243.1|  COG0086: DNA-directed RNA poly...   412    1e-113
gi|15892105|ref|NP_359819.1|  DNA-directed RNA polymerase beta...   411    2e-113 
gi|67459537|ref|YP_247161.1|  DNA-directed RNA polymerase beta...   411    2e-113 
gi|34580864|ref|ZP_00142344.1|  DNA-directed RNA polymerase be...   411    2e-113
gi|58038860|ref|YP_190824.1|  DNA-directed RNA polymerase beta...   411    2e-113 
gi|84515198|ref|ZP_01002561.1|  DNA-directed RNA polymerase be...   411    2e-113
gi|114798314|ref|YP_761535.1|  DNA-directed RNA polymerase, be...   411    2e-113 
gi|51244970|ref|YP_064854.1|  DNA-directed RNA polymerase, bet...   410    3e-113 
gi|59713019|ref|YP_205795.1|  DNA-directed RNA polymerase beta...   410    3e-113 
gi|83858572|ref|ZP_00952094.1|  DNA-directed RNA polymerase be...   410    4e-113
gi|85709548|ref|ZP_01040613.1|  DNA-directed RNA polymerase 16...   410    4e-113
gi|89071324|ref|ZP_01158477.1|  DNA-directed RNA polymerase be...   409    9e-113
gi|85375721|ref|YP_459783.1|  DNA-directed RNA polymerase 160 ...   407    3e-112 
gi|114327213|ref|YP_744370.1|  DNA-directed RNA polymerase bet...   407    4e-112 
gi|42524380|ref|NP_969760.1|  DNA-directed RNA polymerase, bet...   405    2e-111 
gi|114778904|ref|ZP_01453701.1|  DNA-directed RNA polymerase b...   399    8e-110
gi|83312238|ref|YP_422502.1|  DNA-directed RNA polymerase, bet...   395    2e-108 
gi|46202206|ref|ZP_00053590.2|  COG0086: DNA-directed RNA poly...   394    4e-108
gi|98660451|dbj|GAA02293.1|  unnamed protein product [Pelotomacul   392    8e-108
gi|106895656|ref|ZP_01362737.1|  DNA-directed RNA polymerase, ...   386    8e-106
gi|88944028|ref|ZP_01147361.1|  RNA polymerase I subunit A, N-...   386    8e-106
gi|68171623|ref|ZP_00544991.1|  DNA-directed RNA polymerase [E...   384    2e-105
gi|73666803|ref|YP_302819.1|  DNA-directed RNA polymerase [Ehr...   384    3e-105 
gi|88657749|ref|YP_507739.1|  DNA-directed RNA polymerase, bet...   383    6e-105 
gi|58616893|ref|YP_196092.1|  DNA-directed RNA polymerase beta...   383    7e-105 
gi|57238904|ref|YP_180040.1|  DNA-directed RNA polymerase beta...   383    7e-105 
gi|88608346|ref|YP_506555.1|  DNA-directed RNA polymerase, bet...   381    2e-104 
gi|118444505|ref|YP_877191.1|  DNA-directed RNA polymerase, be...   381    3e-104 
gi|78044548|ref|YP_361126.1|  DNA-directed RNA polymerase beta...   379    9e-104 
gi|56961925|ref|YP_173647.1|  DNA-directed RNA polymerase beta...   379    1e-103 
gi|91763155|ref|ZP_01265119.1|  DNA-directed RNA polymerase be...   378    2e-103
gi|71083809|ref|YP_266529.1|  DNA-directed RNA polymerase beta...   378    2e-103 
gi|116624532|ref|YP_826688.1|  DNA-directed RNA polymerase, be...   377    3e-103 
gi|76797453|ref|ZP_00779768.1|  DNA-directed RNA polymerase [T...   377    3e-103
gi|94971701|ref|YP_593749.1|  DNA-directed RNA polymerase, sub...   376    7e-103 
gi|72163052|ref|YP_290709.1|  DNA-directed RNA polymerase beta...   376    8e-103 
gi|113943869|ref|ZP_01429570.1|  DNA-directed RNA polymerase, ...   376    9e-103
gi|20808667|ref|NP_623838.1|  DNA-directed RNA polymerase beta...   376    9e-103 
gi|106887336|ref|ZP_01354645.1|  DNA-directed RNA polymerase, ...   375    1e-102
gi|56416547|ref|YP_153621.1|  DNA-directed RNA polymerase beta...   375    2e-102 
gi|86739287|ref|YP_479687.1|  DNA-directed RNA polymerase, sub...   374    3e-102 
gi|109647476|ref|ZP_01371379.1|  DNA-directed RNA polymerase, ...   373    6e-102
gi|89211784|ref|ZP_01190126.1|  RNA polymerase Rpb1, domain 4 ...   373    6e-102
gi|114567848|ref|YP_755002.1|  DNA-directed RNA polymerase [Sy...   373    6e-102 
gi|71365440|ref|ZP_00655993.1|  DNA-directed RNA polymerase [N...   373    7e-102
gi|89893210|ref|YP_516697.1|  hypothetical protein DSY0464 [De...   373    7e-102 
gi|116871648|ref|YP_848429.1|  RNA polymerase beta subunit [Li...   373    8e-102 
gi|15612690|ref|NP_240993.1|  DNA-directed RNA polymerase beta...   372    1e-101 
gi|7514789|pir||T09641  DNA-directed RNA polymerase (EC 2.7.7....   372    2e-101
gi|46906496|ref|YP_012885.1|  DNA-directed RNA polymerase beta...   372    2e-101 
gi|47091393|ref|ZP_00229190.1|  DNA-directed RNA polymerase, b...   372    2e-101
gi|114845491|ref|ZP_01455889.1|  DNA-directed RNA polymerase, ...   371    2e-101
gi|111220538|ref|YP_711332.1|  DNA-directed RNA polymerase bet...   371    2e-101 
gi|16799363|ref|NP_469631.1|  DNA-directed RNA polymerase beta...   371    2e-101 
gi|56418634|ref|YP_145952.1|  DNA-directed RNA polymerase beta...   370    3e-101 
gi|68056506|ref|ZP_00540622.1|  DNA-directed RNA polymerase [E...   370    4e-101
gi|88607105|ref|YP_505582.1|  DNA-directed RNA polymerase, bet...   370    5e-101 
gi|69285488|ref|ZP_00616974.1|  DNA-directed RNA polymerase [K...   370    6e-101
gi|88854710|ref|ZP_01129376.1|  DNA-directed RNA polymerase be...   370    6e-101
gi|15594733|ref|NP_212522.1|  DNA-directed RNA polymerase beta...   370    6e-101 
gi|68230918|ref|ZP_00570094.1|  DNA-directed RNA polymerase., ...   369    7e-101
gi|58697061|ref|ZP_00372517.1|  DNA-directed RNA polymerase, b...   369    7e-101
gi|16802305|ref|NP_463790.1|  DNA-directed RNA polymerase beta...   369    9e-101 
gi|47096520|ref|ZP_00234111.1|  DNA-directed RNA polymerase, b...   369    9e-101
gi|18311394|ref|NP_563328.1|  DNA-directed RNA polymerase beta...   369    9e-101 
gi|51598645|ref|YP_072833.1|  DNA-directed RNA polymerase beta...   369    9e-101 
gi|115249071|emb|CAJ66882.1|  DNA-directed RNA polymerase beta...   369    1e-100
gi|90576476|ref|ZP_01232938.1|  hypothetical protein CdifQ_020...   369    1e-100
gi|16077176|ref|NP_387989.1|  DNA-directed RNA polymerase beta...   369    1e-100 
gi|2507344|sp|P37871|RPOC_BACSU  DNA-directed RNA polymerase b...   369    1e-100
gi|950303|gb|AAB59112.1|  RNA polymerase beta' subunit              369    1e-100
gi|58584904|ref|YP_198477.1|  DNA-directed RNA polymerase, fus...   369    1e-100 
gi|52078602|ref|YP_077393.1|  DNA-directed RNA polymerase beta...   369    1e-100 
gi|50955585|ref|YP_062873.1|  DNA-directed RNA polymerase beta...   369    1e-100 
gi|114152143|sp|P0C1T4|RPOC_STAAU  DNA-directed RNA polymerase...   368    2e-100
gi|1495791|emb|CAA61517.1|  DNA-directed RNA polymerase [Staphylo   368    2e-100
gi|42519942|ref|NP_965857.1|  DNA-directed RNA polymerase, bet...   368    2e-100 
gi|83591283|ref|YP_431292.1|  DNA-directed RNA polymerase, sub...   368    2e-100 
gi|51894219|ref|YP_076910.1|  DNA-directed RNA polymerase beta...   367    3e-100 
gi|90587130|ref|ZP_01242803.1|  RNA polymerase Rpb1, domain 4 ...   367    3e-100
gi|82750251|ref|YP_415992.1|  DNA-directed RNA polymerase beta...   367    3e-100 
gi|49482773|ref|YP_039997.1|  DNA-directed RNA polymerase beta...   367    3e-100 
gi|15923533|ref|NP_371067.1|  DNA-directed RNA polymerase beta...   367    3e-100 
gi|1495299|emb|CAA61515.1|  DNA-directed RNA polymerase [Brochoth   367    3e-100
gi|2500612|sp|P77839|RPOC_BROTH  DNA-directed RNA polymerase b...   367    3e-100
gi|111115217|ref|YP_709835.1|  DNA-directed RNA polymerase [Bo...   367    3e-100 
gi|87161137|ref|YP_493231.1|  DNA-directed RNA polymerase, bet...   367    4e-100 
gi|88194305|ref|YP_499097.1|  DNA directed RNA polymerase beta...   367    4e-100 
gi|89338438|ref|ZP_01191203.1|  RNA polymerase, alpha subunit:...   367    4e-100
gi|117927509|ref|YP_872060.1|  DNA-directed RNA polymerase, be...   367    5e-100 
gi|90202723|ref|ZP_01205369.1|  DNA-directed RNA polymerase [M...   367    5e-100
gi|86609872|ref|YP_478634.1|  DNA-directed RNA polymerase, gam...   367    5e-100 
gi|99034287|ref|ZP_01314336.1|  hypothetical protein Wendoof_0...   366    7e-100
gi|7514790|pir||T09645  DNA-directed RNA polymerase (EC 2.7.7....   366    8e-100
gi|2500614|sp|P77882|RPOC_LISGR  DNA-directed RNA polymerase b...   366    8e-100
gi|62424432|ref|ZP_00379578.1|  COG0086: DNA-directed RNA poly...   366    9e-100
gi|118469768|ref|YP_885754.1|  DNA-directed RNA polymerase, be...   365    2e-99  
gi|89100357|ref|ZP_01173222.1|  DNA-directed RNA polymerase be...   364    2e-99 
gi|41410229|ref|NP_963065.1|  DNA-directed RNA polymerase beta...   364    3e-99  
gi|92089237|ref|ZP_01274186.1|  DNA-directed RNA polymerase, s...   364    4e-99 
gi|67917243|ref|ZP_00510903.1|  DNA-directed RNA polymerase [C...   363    4e-99 
gi|118568643|gb|ABL03394.1|  DNA-directed RNA polymerase, beta...   363    4e-99 
gi|70727463|ref|YP_254379.1|  DNA-directed RNA polymerase beta...   363    5e-99  
gi|15896391|ref|NP_349740.1|  DNA-directed RNA polymerase beta...   363    5e-99  
gi|34762884|ref|ZP_00143867.1|  DNA-directed RNA polymerase be...   363    5e-99 
gi|118467211|ref|YP_883636.1|  DNA-directed RNA polymerase, be...   363    6e-99  
gi|23097568|ref|NP_691034.1|  DNA-directed RNA polymerase beta...   363    6e-99  
gi|86605129|ref|YP_473892.1|  DNA-directed RNA polymerase, gam...   363    6e-99  
gi|22536345|ref|NP_687196.1|  DNA-directed RNA polymerase beta...   363    6e-99  
gi|19705326|ref|NP_602821.1|  DNA-directed RNA polymerase beta...   363    7e-99  
gi|34540222|ref|NP_904701.1|  DNA-directed RNA polymerase beta...   363    7e-99  
gi|15840071|ref|NP_335108.1|  DNA-directed RNA polymerase beta...   363    8e-99  
gi|15607808|ref|NP_215182.1|  DNA-directed RNA polymerase beta...   363    8e-99  
gi|82749037|ref|ZP_00911507.1|  RNA polymerase I subunit A, N-...   363    8e-99 
gi|89091380|ref|ZP_01164389.1|  RNA polymerase I subunit A, N-...   363    8e-99 
gi|76798579|ref|ZP_00780809.1|  DNA-directed RNA polymerase, b...   362    8e-99 
gi|116671529|ref|YP_832462.1|  DNA-directed RNA polymerase, be...   362    8e-99  
gi|23129280|ref|ZP_00111112.1|  COG0086: DNA-directed RNA poly...   362    9e-99 
gi|75910406|ref|YP_324702.1|  DNA-directed RNA polymerase gamm...   362    1e-98  
gi|27467225|ref|NP_763862.1|  DNA-directed RNA polymerase beta...   362    1e-98  
gi|81429386|ref|YP_396387.1|  DNA-directed RNA polymerase, bet...   362    1e-98  
gi|76785578|ref|ZP_00772745.1|  COG0086: DNA-directed RNA poly...   362    1e-98 
gi|87306544|ref|ZP_01088691.1|  DNA-directed RNA polymerase be...   362    1e-98 
gi|85666787|ref|ZP_01029010.1|  hypothetical protein Badol_010...   362    2e-98 
gi|19745278|ref|NP_606414.1|  DNA-directed RNA polymerase beta...   362    2e-98  
gi|89209106|ref|ZP_01187567.1|  RNA polymerase Rpb1, domain 4 ...   361    2e-98 
gi|94993487|ref|YP_601585.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|94987716|ref|YP_595817.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|21909612|ref|NP_663880.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|71902748|ref|YP_279551.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|28894989|ref|NP_801339.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|581335|emb|CAA78669.1|  RNA polymerase beta' subunit [Mycobact   361    2e-98 
gi|15828009|ref|NP_302272.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|50843337|ref|YP_056564.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|28212180|ref|NP_783124.1|  DNA-directed RNA polymerase beta...   361    2e-98  
gi|41018005|sp|Q890N5|RPOC_CLOTE  DNA-directed RNA polymerase ...   361    2e-98 
gi|1495275|emb|CAA61514.1|  DNA-directed RNA polymerase [Bacillus   361    3e-98 
gi|15903818|ref|NP_359368.1|  DNA-directed RNA polymerase beta...   360    4e-98  
gi|111658848|ref|ZP_01409469.1|  hypothetical protein SpneT_02...   360    4e-98 
gi|116515724|ref|YP_817181.1|  DNA-directed RNA polymerase, be...   360    4e-98  
gi|15901783|ref|NP_346387.1|  DNA-directed RNA polymerase beta...   360    4e-98  
gi|116495959|ref|YP_807693.1|  DNA-directed RNA polymerase, be...   360    4e-98  
gi|94989595|ref|YP_597695.1|  DNA-directed RNA polymerase beta...   360    5e-98  
gi|50913478|ref|YP_059450.1|  DNA-directed RNA polymerase beta...   360    5e-98  
gi|15674322|ref|NP_268496.1|  DNA-directed RNA polymerase beta...   360    5e-98  
gi|56808831|ref|ZP_00366544.1|  COG0086: DNA-directed RNA poly...   360    5e-98 
gi|75762689|ref|ZP_00742527.1|  DNA-directed RNA polymerase be...   360    5e-98 
gi|73663521|ref|YP_302302.1|  DNA-directed RNA polymerase beta...   360    6e-98  
gi|54027072|ref|YP_121314.1|  DNA-directed RNA polymerase beta...   360    6e-98  
gi|49183137|ref|YP_026389.1|  DNA-directed RNA polymerase beta...   360    6e-98  
gi|92910106|ref|ZP_01278882.1|  DNA-directed RNA polymerase, s...   360    6e-98 
gi|30260294|ref|NP_842671.1|  DNA-directed RNA polymerase beta...   360    6e-98  
gi|17229087|ref|NP_485635.1|  DNA-directed RNA polymerase gamm...   360    6e-98  
gi|108804980|ref|YP_644917.1|  DNA-directed RNA polymerase, su...   360    6e-98  
gi|41018033|sp|Q8DS47|RPOC_STRMU  DNA-directed RNA polymerase ...   360    7e-98 
gi|32473690|ref|NP_866684.1|  DNA-directed RNA polymerase beta...   360    7e-98  
gi|24380332|ref|NP_722287.1|  DNA-directed RNA polymerase beta...   359    8e-98  
gi|83814133|ref|YP_445875.1|  DNA-directed RNA polymerase, bet...   359    8e-98  
gi|84494795|ref|ZP_00993914.1|  DNA-directed RNA polymerase be...   359    1e-97 
gi|15606950|ref|NP_214332.1|  RNA polymerase beta prime subuni...   359    1e-97  
gi|28493039|ref|NP_787200.1|  DNA-directed RNA polymerase beta...   358    2e-97  
gi|41017971|sp|Q820D9|RPOC_TROW8  DNA-directed RNA polymerase ...   358    2e-97 
gi|28572250|ref|NP_789030.1|  DNA-directed RNA polymerase beta...   358    2e-97  
gi|7531199|sp|Q9X6Y2|RPOC_AQUPY  DNA-directed RNA polymerase b...   358    2e-97 
gi|81096692|ref|ZP_00875027.1|  DNA-directed RNA polymerase [S...   358    2e-97 
gi|37523846|ref|NP_927223.1|  DNA-directed RNA polymerase gamm...   357    4e-97  
gi|109674890|ref|ZP_01377045.1|  hypothetical protein Ccur5_01...   357    4e-97 
gi|52145115|ref|YP_081714.1|  DNA-directed RNA polymerase beta...   357    4e-97  
gi|42779184|ref|NP_976431.1|  DNA-directed RNA polymerase beta...   357    4e-97  
gi|30018373|ref|NP_830004.1|  DNA-directed RNA polymerase beta...   357    4e-97  
gi|19551732|ref|NP_599734.1|  DNA-directed RNA polymerase beta...   357    4e-97  
gi|47570396|ref|ZP_00241036.1|  DNA-directed RNA polymerase, b...   357    4e-97 
gi|23335343|ref|ZP_00120580.1|  COG0086: DNA-directed RNA poly...   357    5e-97 
gi|15673781|ref|NP_267956.1|  DNA-directed RNA polymerase beta...   357    6e-97  
gi|41018127|sp|Q9CEN7|RPOC_LACLA  DNA-directed RNA polymerase ...   357    6e-97 
gi|116512668|ref|YP_811575.1|  DNA-directed RNA polymerase, be...   357    6e-97  
gi|29377681|ref|NP_816835.1|  DNA-directed RNA polymerase beta...   357    6e-97  
gi|109671200|ref|ZP_01373463.1|  hypothetical protein Ccon1_01...   356    6e-97 
gi|22298183|ref|NP_681430.1|  DNA-directed RNA polymerase gamm...   356    7e-97  
gi|68536937|ref|YP_251642.1|  DNA-directed RNA polymerase, bet...   356    8e-97  
gi|49479285|ref|YP_034455.1|  DNA-directed RNA polymerase beta...   356    9e-97  
gi|11466381|ref|NP_038384.1|  RNA polymerase beta' chain [Meso...   355    1e-96  
gi|111018958|ref|YP_701930.1|  DNA-directed RNA polymerase bet...   355    1e-96  
gi|10637869|emb|CAC10564.1|  DNA-dependent RNA polymerase subu...   355    1e-96 
gi|3914827|sp|O33431|RPOC_PORCN  DNA-directed RNA polymerase b...   355    1e-96 
gi|113476514|ref|YP_722575.1|  DNA-directed RNA polymerase, ga...   355    1e-96  
gi|29831458|ref|NP_826092.1|  DNA-directed RNA polymerase beta...   355    2e-96  
gi|86140280|ref|ZP_01058839.1|  DNA-directed RNA polymerase be...   354    2e-96 
gi|116334276|ref|YP_795803.1|  DNA-directed RNA polymerase, be...   354    3e-96  
gi|88807054|ref|ZP_01122569.1|  DNA-directed RNA polymerase be...   354    3e-96 
gi|25027054|ref|NP_737108.1|  DNA-directed RNA polymerase beta...   354    4e-96  
gi|88802468|ref|ZP_01117995.1|  DNA-directed RNA polymerase be...   353    4e-96 
gi|116331870|ref|YP_801588.1|  DNA-directed RNA polymerase, be...   353    7e-96  
gi|116327517|ref|YP_797237.1|  DNA-directed RNA polymerase, be...   353    7e-96  
gi|11467372|ref|NP_043229.1|  RNA polymerase beta' chain [Cyan...   353    7e-96  
gi|32141243|ref|NP_733644.1|  DNA-directed RNA polymerase beta...   353    8e-96  
gi|42527921|ref|NP_973019.1|  DNA-directed RNA polymerase beta...   352    1e-95  
gi|57504731|ref|ZP_00370785.1|  DNA-directed RNA polymerase be...   352    1e-95 
gi|15791843|ref|NP_281666.1|  DNA-directed RNA polymerase beta...   352    1e-95  
gi|116493169|ref|YP_804904.1|  DNA-directed RNA polymerase, be...   352    2e-95  
gi|38233061|ref|NP_938828.1|  DNA-directed RNA polymerase beta...   352    2e-95  
gi|1684751|emb|CAA70579.1|  DNA directed RNA polymerase beta' cha   352    2e-95 
gi|73913596|gb|AAZ91716.1|  DNA-directed RNA polymerase beta' ...   352    2e-95 
gi|15639234|ref|NP_218682.1|  DNA-directed RNA polymerase beta...   352    2e-95  
gi|69246465|ref|ZP_00603960.1|  DNA-directed RNA polymerase., ...   351    2e-95 
gi|57237533|ref|YP_178547.1|  DNA-directed RNA polymerase, bet...   351    2e-95  
gi|86153857|ref|ZP_01072060.1|  DNA-directed RNA polymerase, b...   351    2e-95 
gi|112805594|gb|EAU02938.1|  DNA-directed RNA polymerase, beta...   351    2e-95 
gi|109691596|ref|ZP_01378663.1|  hypothetical protein Cjejd_01...   351    2e-95 
gi|86151719|ref|ZP_01069933.1|  DNA-directed RNA polymerase, b...   351    2e-95 
gi|86133999|ref|ZP_01052581.1|  DNA-directed RNA polymerase be...   351    2e-95 
gi|108744242|gb|ABD62241.1|  beta' subunit of RNA polymerase [Chl   350    4e-95 
gi|24216118|ref|NP_713599.1|  DNA-directed RNA polymerase beta...   350    4e-95  
gi|90994442|ref|YP_536932.1|  DNA-directed RNA polymerase beta...   350    5e-95  
gi|90961180|ref|YP_535096.1|  DNA-directed RNA polymerase beta...   350    5e-95  
gi|16330858|ref|NP_441586.1|  DNA-directed RNA polymerase gamm...   350    5e-95  
gi|81300332|ref|YP_400540.1|  DNA-directed RNA polymerase [Syn...   350    7e-95  
gi|56752517|ref|YP_173218.1|  DNA-directed RNA polymerase gamm...   349    8e-95  
gi|90590327|ref|ZP_01245974.1|  DNA-directed RNA polymerase [F...   349    1e-94 
gi|51209979|ref|YP_063643.1|  RNA polymerase beta' subunit [Gr...   349    1e-94  
gi|86131818|ref|ZP_01050415.1|  DNA-directed RNA polymerase be...   349    1e-94 
gi|28377826|ref|NP_784718.1|  DNA-directed RNA polymerase beta...   349    1e-94  
gi|67935040|ref|ZP_00528064.1|  DNA-directed RNA polymerase., ...   348    2e-94 
gi|91200661|emb|CAJ73712.1|  strongly similar to DNA-directed ...   347    3e-94 
gi|11465717|ref|NP_053861.1|  RNA polymerase beta' chain [Porp...   347    3e-94  
gi|60683449|ref|YP_213593.1|  DNA-directed RNA polymerase beta...   347    3e-94  
gi|53715476|ref|YP_101468.1|  DNA-directed RNA polymerase beta...   347    3e-94  
gi|117578864|emb|CAL67333.1|  DNA-directed RNA polymerase subu...   347    3e-94 
gi|83855425|ref|ZP_00948954.1|  DNA-directed RNA polymerase be...   347    3e-94 
gi|91215209|ref|ZP_01252181.1|  DNA-directed RNA polymerase be...   347    4e-94 
gi|106888500|ref|ZP_01355700.1|  DNA-directed RNA polymerase, ...   347    4e-94 
gi|67919886|ref|ZP_00513441.1|  DNA-directed RNA polymerase [C...   347    4e-94 
gi|78188336|ref|YP_378674.1|  DNA-directed RNA polymerase beta...   347    4e-94  
gi|57240978|ref|ZP_00368926.1|  DNA-directed RNA polymerase, b...   347    5e-94 



alignements deux à deux

>gi|118056610|ref|ZP_01525077.1|  DNA-directed RNA polymerase, beta' subunit [Pseudomonas mendocina 
ymp]
 gi|118010221|gb|EAV24288.1|  DNA-directed RNA polymerase, beta' subunit [Pseudomonas mendocina 
ymp]
Length=1399

 Score =  476 bits (1226),  Expect = 4e-133, Method: Composition-based stats.
 Identities = 234/306 (76%), Positives = 265/306 (86%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAVNAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               SL +++ VR+ E  K+ D GS++ N R V+TTVGRAL+++IVP GLSYD+VN+ + K
Sbjct  540  GEASLHARVKVRINETVKEKD-GSITKNTRIVDTTVGRALLFQIVPAGLSYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|92112548|ref|YP_572476.1|  DNA-directed RNA polymerase, subunit beta-prime [Chromohalobacter 
salexigens DSM 3043]
 gi|91795638|gb|ABE57777.1|  DNA-directed RNA polymerase, subunit beta-prime [Chromohalobacter 
salexigens DSM 3043]
Length=1405

 Score =  476 bits (1225),  Expect = 6e-133, Method: Composition-based stats.
 Identities = 230/306 (75%), Positives = 268/306 (87%), Gaps = 0/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +E+VDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFI+S LQ    A+TIKAAKK+V+ E PEVWDIL +VIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIYSKLQAGGQASTIKAAKKMVERELPEVWDILADVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEP+L+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            +R+LMMATNNVL PANGEPIIVPSQDVVLGLYYMTRE    PGEG +FSN D+V+ A+  
Sbjct  480  SRTLMMATNNVLSPANGEPIIVPSQDVVLGLYYMTREKIGAPGEGMVFSNLDEVERAFGT  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
             +VSL +++ VR+TEY +D D G  +S+ +  +TTVGRAL++ I+PKG+ +++V++ + K
Sbjct  540  QSVSLHARVKVRLTEYDRDEDGGEWTSSTKIHDTTVGRALLYRILPKGMPFELVDQPMKK  599

Query  301  KEISNL  306
            K IS L
Sbjct  600  KAISGL  605


>gi|104779749|ref|YP_606247.1|  RNA polymerase, beta prime subunit [Pseudomonas entomophila L48]
 gi|95108736|emb|CAK13430.1|  RNA polymerase, beta prime subunit [Pseudomonas]
Length=1399

 Score =  475 bits (1223),  Expect = 9e-133, Method: Composition-based stats.
 Identities = 234/306 (76%), Positives = 264/306 (86%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +KI VR+ E  KD D GS++ N R V+TTVGRAL++++VP GL YD+VN+ + K
Sbjct  540  GEAALHAKIKVRINETVKDRD-GSITKNTRIVDTTVGRALLFQVVPAGLPYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|70732888|ref|YP_262656.1|  DNA-directed RNA polymerase beta' subunit [Pseudomonas fluorescens 
Pf-5]
 gi|90111029|sp|Q4K527|RPOC_PSEF5  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|68347187|gb|AAY94793.1|  DNA-directed RNA polymerase, beta' subunit [Pseudomonas fluorescens 
Pf-5]
Length=1399

 Score =  474 bits (1220),  Expect = 2e-132, Method: Composition-based stats.
 Identities = 234/306 (76%), Positives = 265/306 (86%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +KI VR++E   D D GS+S+  R V+TTVGRAL++++VPKGLS+D+VN  + K
Sbjct  540  GEAALHAKIKVRISETVNDRDGGSVSA-TRIVDTTVGRALLFQVVPKGLSFDVVNLPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|71737777|ref|YP_276712.1|  DNA-directed RNA polymerase, beta' subunit [Pseudomonas syringae 
pv. phaseolicola 1448A]
 gi|90111028|sp|Q48D30|RPOC_PSE14  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|71558330|gb|AAZ37541.1|  DNA-directed RNA polymerase, beta' subunit [Pseudomonas syringae 
pv. phaseolicola 1448A]
Length=1399

 Score =  473 bits (1218),  Expect = 4e-132, Method: Composition-based stats.
 Identities = 233/306 (76%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +K+ VR+ E   D D GS+  N R V+TTVGRAL++++VP GLSYD+VN+ + K
Sbjct  540  GEAALHAKVKVRIHETVNDRDGGSV-KNTRIVDTTVGRALLFQVVPAGLSYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|66047781|ref|YP_237622.1|  DNA-directed RNA polymerase beta' subunit [Pseudomonas syringae 
pv. syringae B728a]
 gi|75500410|sp|Q4ZMN8|RPOC_PSEU2  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|63258488|gb|AAY39584.1|  DNA-directed RNA polymerase [Pseudomonas syringae pv. syringae 
B728a]
Length=1399

 Score =  473 bits (1218),  Expect = 4e-132, Method: Composition-based stats.
 Identities = 233/306 (76%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +K+ VR+ E   D D GS+  N R V+TTVGRAL++++VP GLSYD+VN+ + K
Sbjct  540  GEAALHAKVKVRIHETVNDRDGGSV-KNTRIVDTTVGRALLFQVVPAGLSYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|28867848|ref|NP_790467.1|  DNA-directed RNA polymerase beta' subunit [Pseudomonas syringae 
pv. tomato str. DC3000]
 gi|41017998|sp|Q889X7|RPOC_PSESM  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|28851084|gb|AAO54162.1|  DNA-directed RNA polymerase, beta' subunit [Pseudomonas syringae 
pv. tomato str. DC3000]
Length=1399

 Score =  473 bits (1218),  Expect = 4e-132, Method: Composition-based stats.
 Identities = 233/306 (76%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +K+ VR+ E   D D GS+  N R V+TTVGRAL++++VP GLSYD+VN+ + K
Sbjct  540  GEAALHAKVKVRIHETVNDRDGGSV-KNTRIVDTTVGRALLFQVVPAGLSYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|94414344|ref|ZP_01294206.1|  hypothetical protein PaerP_01003925 [Pseudomonas aeruginosa PA7]
Length=1371

 Score =  473 bits (1217),  Expect = 5e-132, Method: Composition-based stats.
 Identities = 232/306 (75%), Positives = 265/306 (86%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  272  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  331

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  332  TLRLHQCGLPKKMALELFKPFIFGKLEGRGMATTIKAAKKMVERELPEVWDVLAEVIREH  391

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  392  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  451

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVV+GLYYMTREA N  GEG  F++  +V  AY +
Sbjct  452  ARALMMSTNNILSPANGEPIIVPSQDVVMGLYYMTREAINAKGEGMAFADLQEVDRAYRS  511

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               SL +++ VR+ E  K  D G L++N R V+TTVGRAL++++VP GL +D+VN+++ K
Sbjct  512  GQASLHARVKVRINEKVKGED-GQLTANTRIVDTTVGRALLFQVVPAGLPFDVVNQSMKK  570

Query  301  KEISNL  306
            K IS L
Sbjct  571  KAISKL  576


>gi|107103781|ref|ZP_01367699.1|  hypothetical protein PaerPA_01004852 [Pseudomonas aeruginosa 
PACS2]
Length=1371

 Score =  473 bits (1217),  Expect = 6e-132, Method: Composition-based stats.
 Identities = 232/306 (75%), Positives = 265/306 (86%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  272  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  331

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  332  TLRLHQCGLPKKMALELFKPFIFGKLEGRGMATTIKAAKKMVERELPEVWDVLAEVIREH  391

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  392  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  451

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVV+GLYYMTREA N  GEG  F++  +V  AY +
Sbjct  452  ARALMMSTNNILSPANGEPIIVPSQDVVMGLYYMTREAINAKGEGMAFADLQEVDRAYRS  511

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               SL +++ VR+ E  K  D G L++N R V+TTVGRAL++++VP GL +D+VN+++ K
Sbjct  512  GQASLHARVKVRINEKIKGED-GQLTANTRIVDTTVGRALLFQVVPAGLPFDVVNQSMKK  570

Query  301  KEISNL  306
            K IS L
Sbjct  571  KAISKL  576


>gi|15599465|ref|NP_252959.1|  DNA-directed RNA polymerase beta' subunit [Pseudomonas aeruginosa 
PAO1]
 gi|116052304|ref|YP_788850.1|  DNA-directed RNA polymerase beta* chain [Pseudomonas aeruginosa 
UCBPP-PA14]
 gi|14423917|sp|Q9HWC9|RPOC_PSEAE  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|9950487|gb|AAG07657.1|AE004842_6  DNA-directed RNA polymerase beta* chain [Pseudomonas aeruginosa 
PAO1]
 gi|115587525|gb|ABJ13540.1|  DNA-directed RNA polymerase beta* chain [Pseudomonas aeruginosa 
UCBPP-PA14]
Length=1399

 Score =  473 bits (1216),  Expect = 7e-132, Method: Composition-based stats.
 Identities = 232/306 (75%), Positives = 265/306 (86%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEGRGMATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVV+GLYYMTREA N  GEG  F++  +V  AY +
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVMGLYYMTREAINAKGEGMAFADLQEVDRAYRS  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               SL +++ VR+ E  K  D G L++N R V+TTVGRAL++++VP GL +D+VN+++ K
Sbjct  540  GQASLHARVKVRINEKIKGED-GQLTANTRIVDTTVGRALLFQVVPAGLPFDVVNQSMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|67157002|ref|ZP_00418364.1|  DNA-directed RNA polymerase [Azotobacter vinelandii AvOP]
 gi|67085679|gb|EAM05151.1|  DNA-directed RNA polymerase [Azotobacter vinelandii AvOP]
Length=1399

 Score =  472 bits (1215),  Expect = 8e-132, Method: Composition-based stats.
 Identities = 232/306 (75%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLETRGMATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAVNARGEGRVFADLQEVDRVFRG  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               SL +++ VR+ E  +  D GSL  N R V+TTVGRAL++++VP GLS+D+VN+ + K
Sbjct  540  GEASLHARVKVRINETVRQKD-GSLVHNTRIVDTTVGRALLFQVVPAGLSFDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|21667489|gb|AAM74071.1|AF491331_1  RNA polymerase beta' subunit [Xanthomonas oryzae pv. oryzae]
Length=1405

 Score =  472 bits (1215),  Expect = 8e-132, Method: Composition-based stats.
 Identities = 231/306 (75%), Positives = 263/306 (85%), Gaps = 0/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +E+VDALLDNGRRGRA++G+NKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             LKLHQCGLPKKMALELFKPF+F+ LQRR  ATTIKAAKKLV+ E  EVWDIL+EVIREH
Sbjct  360  YLKLHQCGLPKKMALELFKPFVFAKLQRRGLATTIKAAKKLVEREEAEVWDILEEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVC A+NADFDGDQMAVHVPL+LEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYM+R   N+ GEG +F+NT +VK AYDN
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMSRALENKKGEGMVFANTSEVKRAYDN  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
              V L +K+ VR+T+   D   G  +S    V+TTVGRAL+ EI+P+GL + + N  +TK
Sbjct  540  RVVELHAKVKVRITQVDVDAVDGKRTSGTSIVDTTVGRALLSEILPEGLPFQLANTEMTK  599

Query  301  KEISNL  306
            K IS L
Sbjct  600  KNISRL  605


>gi|58583213|ref|YP_202229.1|  DNA-directed RNA polymerase beta' subunit [Xanthomonas oryzae 
pv. oryzae KACC10331]
 gi|84625050|ref|YP_452422.1|  RNA polymerase beta' subunit [Xanthomonas oryzae pv. oryzae MAFF 
311018]
 gi|62297927|sp|Q8KTH8|RPOC_XANOR  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|109893858|sp|Q2NZX9|RPOC_XANOM  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|58427807|gb|AAW76844.1|  RNA polymerase beta' subunit [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368990|dbj|BAE70148.1|  RNA polymerase beta' subunit [Xanthomonas oryzae pv. oryzae MAFF 
311018]
Length=1405

 Score =  472 bits (1215),  Expect = 8e-132, Method: Composition-based stats.
 Identities = 231/306 (75%), Positives = 263/306 (85%), Gaps = 0/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +E+VDALLDNGRRGRA++G+NKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             LKLHQCGLPKKMALELFKPF+F+ LQRR  ATTIKAAKKLV+ E  EVWDIL+EVIREH
Sbjct  360  YLKLHQCGLPKKMALELFKPFVFAKLQRRGLATTIKAAKKLVEREEAEVWDILEEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVC A+NADFDGDQMAVHVPL+LEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYM+R   N+ GEG +F+NT +VK AYDN
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMSRALENKKGEGMVFANTSEVKRAYDN  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
              V L +K+ VR+T+   D   G  +S    V+TTVGRAL+ EI+P+GL + + N  +TK
Sbjct  540  RVVELHAKVKVRITQVDVDAVDGKRTSGTSIVDTTVGRALLSEILPEGLPFQLANTEMTK  599

Query  301  KEISNL  306
            K IS L
Sbjct  600  KNISRL  605


>gi|82739428|ref|ZP_00902231.1|  RNA polymerase I subunit A, N-terminal [Pseudomonas putida F1]
 gi|82713490|gb|EAP48601.1|  RNA polymerase I subunit A, N-terminal [Pseudomonas putida F1]
Length=1399

 Score =  472 bits (1215),  Expect = 9e-132, Method: Composition-based stats.
 Identities = 233/306 (76%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +KI VR+ E  K+ D GS+  N R V+TTVGRAL++++VP GL YD+VN+ + K
Sbjct  540  GEAALHAKIKVRINETVKERD-GSVVKNTRIVDTTVGRALLFQVVPAGLPYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|26987189|ref|NP_742614.1|  DNA-directed RNA polymerase beta' subunit [Pseudomonas putida 
KT2440]
 gi|41018000|sp|Q88QP1|RPOC_PSEPK  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|24981826|gb|AAN66078.1|AE016237_2  DNA-directed RNA polymerase, beta' subunit [Pseudomonas putida 
KT2440]
Length=1399

 Score =  472 bits (1215),  Expect = 9e-132, Method: Composition-based stats.
 Identities = 233/306 (76%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +KI VR+ E  K+ D GS+  N R V+TTVGRAL++++VP GL YD+VN+ + K
Sbjct  540  GEAALHAKIKVRINETVKERD-GSVVKNTRIVDTTVGRALLFQVVPAGLPYDVVNQPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|77461306|ref|YP_350813.1|  DNA-directed RNA polymerase beta' subunit [Pseudomonas fluorescens 
PfO-1]
 gi|92090953|sp|Q3K5Y2|RPOC_PSEPF  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|77385309|gb|ABA76822.1|  RNA polymerase Rpb1 [Pseudomonas fluorescens PfO-1]
Length=1399

 Score =  472 bits (1214),  Expect = 1e-131, Method: Composition-based stats.
 Identities = 233/306 (76%), Positives = 263/306 (85%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFIF  L+ R  ATTIKAAKK+V+ E PEVWD+L EVIREH
Sbjct  360  TLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKKMVERELPEVWDVLAEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTREA N  GEG +F++  +V   +  
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREAINAKGEGRVFADLQEVDRVFRA  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               +L +KI VR+ E   D D  S+ +N R V+TTVGRAL++++VPKGLS+D+VN  + K
Sbjct  540  GEAALHAKIKVRINETVNDRDGNSV-NNTRIVDTTVGRALLFQVVPKGLSFDVVNLPMKK  598

Query  301  KEISNL  306
            K IS L
Sbjct  599  KAISKL  604


>gi|21230358|ref|NP_636275.1|  DNA-directed RNA polymerase beta' subunit [Xanthomonas campestris 
pv. campestris str. ATCC 33913]
 gi|66769648|ref|YP_244410.1|  DNA-directed RNA polymerase beta' subunit [Xanthomonas campestris 
pv. campestris str. 8004]
 gi|41018074|sp|Q8PC55|RPOC_XANCP  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|81304397|sp|Q4URD3|RPOC_XANC8  DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) 
(Transcriptase beta' chain) (RNA polymerase beta' subunit)
 gi|21111913|gb|AAM40199.1|  RNA polymerase beta' subunit [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gi|66574980|gb|AAY50390.1|  RNA polymerase beta' subunit [Xanthomonas campestris pv. campestris 
str. 8004]
Length=1405

 Score =  472 bits (1214),  Expect = 1e-131, Method: Composition-based stats.
 Identities = 231/306 (75%), Positives = 263/306 (85%), Gaps = 0/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +E+VDALLDNGRRGRA++G+NKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             LKLHQCGLPKKMALELFKPF+F+ LQRR  ATTIKAAKKLV+ E  EVWDIL+EVIREH
Sbjct  360  YLKLHQCGLPKKMALELFKPFVFAKLQRRGLATTIKAAKKLVEREEAEVWDILEEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVC A+NADFDGDQMAVHVPL+LEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYM+R   N+ GEG +F+NT +VK AYDN
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMSRALENKKGEGMVFANTSEVKRAYDN  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
              V L +K+ VR+T+   D   G  +S    V+TTVGRAL+ EI+P+GL + + N  +TK
Sbjct  540  RVVELHAKVKVRITQVDVDTVDGKRTSGTSIVDTTVGRALLSEILPEGLPFQLANTEMTK  599

Query  301  KEISNL  306
            K IS L
Sbjct  600  KNISRL  605


>gi|18496612|gb|AAL74151.1|AF426389_1  RNA polymerase beta prime subunit [Xanthomonas campestris pv. 
campestris]
Length=1403

 Score =  472 bits (1214),  Expect = 1e-131, Method: Composition-based stats.
 Identities = 231/306 (75%), Positives = 263/306 (85%), Gaps = 0/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +E+VDALLDNGRRGRA++G+NKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             LKLHQCGLPKKMALELFKPF+F+ LQRR  ATTIKAAKKLV+ E  EVWDIL+EVIREH
Sbjct  360  YLKLHQCGLPKKMALELFKPFVFAKLQRRGLATTIKAAKKLVEREEAEVWDILEEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVC A+NADFDGDQMAVHVPL+LEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYM+R   N+ GEG +F+NT +VK AYDN
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMSRALENKKGEGMVFANTSEVKRAYDN  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
              V L +K+ VR+T+   D   G  +S    V+TTVGRAL+ EI+P+GL + + N  +TK
Sbjct  540  RVVELHAKVKVRITQVDVDTVDGKRTSGTSIVDTTVGRALLSEILPEGLPFQLANTEMTK  599

Query  301  KEISNL  306
            K IS L
Sbjct  600  KNISRL  605


>gi|22774033|gb|AAN07183.1|  RNA polymerase beta prime subunit/intein-CBD fusion protein [Cloning 
vector pIA423]
Length=1929

 Score =  469 bits (1208),  Expect = 5e-131, Method: Composition-based stats.
 Identities = 229/306 (74%), Positives = 259/306 (84%), Gaps = 1/306 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +EAVDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVI VGP
Sbjct  300  QEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPKKMALELFKPFI+  L+ R  ATTIKAAKK+V+ E   VWDILDEVIREH
Sbjct  360  YLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            AR+LMM+TNN+L PANGEPIIVPSQDVVLGLYYMTR+  N  GEG + +   + +  Y +
Sbjct  480  ARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRS  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
               SL +++ VR+TEY+KD + G L +     +TTVGRA++W IVPKGL Y IVN+ L K
Sbjct  540  GLASLHARVKVRITEYEKDAN-GELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGK  598

Query  301  KEISNL  306
            K IS +
Sbjct  599  KAISKM  604


>gi|90417541|ref|ZP_01225462.1|  DNA-directed RNA polymerase beta' subunit [marine gamma proteobacterium 
HTCC2207]
 gi|90330633|gb|EAS45923.1|  DNA-directed RNA polymerase beta' subunit [marine gamma proteobacterium 
HTCC2207]
Length=1408

 Score =  469 bits (1208),  Expect = 6e-131, Method: Composition-based stats.
 Identities = 227/304 (74%), Positives = 264/304 (86%), Gaps = 0/304 (0%)

Query  1    KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  60
            +E+VDALLDNGRRGRA++GSNKRPLKSL DMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP
Sbjct  300  QESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP  359

Query  61   ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH  120
             L+LHQCGLPK+MALELFKPFIFS L+ R  ATTIKAAKK+V+ E P VWDIL++VIREH
Sbjct  360  ALRLHQCGLPKRMALELFKPFIFSKLELRGLATTIKAAKKMVEREEPVVWDILEDVIREH  419

Query  121  PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE  180
            PVLLNRAPTLHRLGIQAFEPVL+EGKAIQLHPLVCAAYNADFDGDQMAVHVPLT+EAQ+E
Sbjct  420  PVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTIEAQME  479

Query  181  ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN  240
            +R+LMM+TNN+L PA+GEPIIVPSQDVVLGLYYMTR   N  GEG +F++  +V  AY +
Sbjct  480  SRALMMSTNNILSPASGEPIIVPSQDVVLGLYYMTRHKVNGRGEGMVFADGSEVSRAYYS  539

Query  241  DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK  300
            D V LQ++I VR+ E   D  TG  +   + ++TTVGRAL+W+IVPKGL +++VNK + K
Sbjct  540  DKVELQTRIKVRINEVLVDEVTGEKTDETKIIDTTVGRALLWQIVPKGLPFELVNKPMVK  599

Query  301  KEIS  304
            K IS
Sbjct  600  KAIS  603

ORF finding

any codon, direct, standard

>ORF number 1 in reading frame 1 on the direct strand extends from base 322 to base 537.
TCGGTTCACCATTCGCAGGATGCAGCACATTATTTGTTGCCATCATCAACGAACGCGCTT
CTAACTGAGCTTCTAATGTCAAAGGCACGTGAACAGCCATTTGGTCACCATCAAAGTCCG
CGTTATAAGCAGCACATACCAGAGGGTGTAATTGAATCGCCTTACCTTCAACCAAAACAG
GCTCAAACGCTTGAATACCTAAGCGGTGTAATGTAG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
SVHHSQDAAHYLLPSSTNALLTELLMSKAREQPFGHHQSPRYKQHIPEGVIESPYLQPKQ
AQTLEYLSGVM*

>ORF number 1 in reading frame 2 on the direct strand extends from base 125 to base 385.
GAGGGAACCCGTATCAGGATCTTTTTGATATTCAGTCACTCGCACAACAATCTTAGACTG
AAGACTCACAGCATCGTTGTCATAAGCCATTTTTACTTGGTCGGTATTACTAAAAATAGA
GCCTTCGCCCGGTTCATTAGCCGCTTCACGCGTCATGTAATACAAACCAAGAACCACGTC
CTGACTTGGAACAATAATCGGTTCACCATTCGCAGGATGCAGCACATTATTTGTTGCCAT
CATCAACGAACGCGCTTCTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
EGTRIRIFLIFSHSHNNLRLKTHSIVVISHFYLVGITKNRAFARFISRFTRHVIQTKNHV
LTWNNNRFTIRRMQHIICCHHQRTRF*

>ORF number 1 in reading frame 3 on the direct strand extends from base 516 to base 725.
ATACCTAAGCGGTGTAATGTAGGAGCTCGGTTTAAAAGCACCGGGTGCTCACGAATCACC
TCATCAAGAATATCCCAGACTTCCGGTGACTCACTGTCGACTAACTTTTTCGCTGCTTTG
ATTGTTGTAGCAAACTCTCTACGTTGCAACAAACTAAAAATAAAAGGCTTAAACAGCTCC
AGCGCCATTTTTTTAGGTAGCCCGCATTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
IPKRCNVGARFKSTGCSRITSSRISQTSGDSLSTNFFAALIVVANSLRCNKLKIKGLNSS
SAIFLGSPH*


any codon , indirect, standard

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 919.
AAAGAAGCTGTAGATGCGTTGCTTGATAATGGTCGTCGTGGGCGAGCTATGTCGGGTTCA
AATAAGCGTCCACTGAAGTCATTAACCGATATGATTAAAGGTAAGCAAGGTCGTTTTAGA
CAAAATTTATTAGGTAAGCGTGTGGATTATTCAGGTCGTTCTGTGATCGTTGTCGGTCCT
GAGCTCAAGCTTCATCAATGCGGGCTACCTAAAAAAATGGCGCTGGAGCTGTTTAAGCCT
TTTATTTTTAGTTTGTTGCAACGTAGAGAGTTTGCTACAACAATCAAAGCAGCGAAAAAG
TTAGTCGACAGTGAGTCACCGGAAGTCTGGGATATTCTTGATGAGGTGATTCGTGAGCAC
CCGGTGCTTTTAAACCGAGCTCCTACATTACACCGCTTAGGTATTCAAGCGTTTGAGCCT
GTTTTGGTTGAAGGTAAGGCGATTCAATTACACCCTCTGGTATGTGCTGCTTATAACGCG
GACTTTGATGGTGACCAAATGGCTGTTCACGTGCCTTTGACATTAGAAGCTCAGTTAGAA
GCGCGTTCGTTGATGATGGCAACAAATAATGTGCTGCATCCTGCGAATGGTGAACCGATT
ATTGTTCCAAGTCAGGACGTGGTTCTTGGTTTGTATTACATGACGCGTGAAGCGGCTAAT
GAACCGGGCGAAGGCTCTATTTTTAGTAATACCGACCAAGTAAAAATGGCTTATGACAAC
GATGCTGTGAGTCTTCAGTCTAAGATTGTTGTGCGAGTGACTGAATATCAAAAAGATCCT
GATACGGGTTCCCTCTCATCGAATGTCCGACGTGTAGAGACAACAGTGGGCCGCGCTTTG
GTTTGGGAAATAGTCCCTAAAGGTCTGAGTTATGACATTGTTAACAAGACATTAACTAAA
AAAGAAATATCAAACCTT

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
KEAVDALLDNGRRGRAMSGSNKRPLKSLTDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGP
ELKLHQCGLPKKMALELFKPFIFSLLQRREFATTIKAAKKLVDSESPEVWDILDEVIREH
PVLLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLE
ARSLMMATNNVLHPANGEPIIVPSQDVVLGLYYMTREAANEPGEGSIFSNTDQVKMAYDN
DAVSLQSKIVVRVTEYQKDPDTGSLSSNVRRVETTVGRALVWEIVPKGLSYDIVNKTLTK
KEISNL

No ORFs were found in reading frame 3.