ORF WE17110

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160048.1
Annotathon code: ORF_WE17110
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : Maxsmith
Annotated on : 2008-03-19 18:52:37
  • COMBEL maxime
  • MASQUELIER marion

Synopsis

Genomic Sequence

>AACY01160048.1 ORF_WE17110 genomic DNA
TAAAAGGAGAGACTCCAATACCATGTGTACAGTGCAATAAAACTGTAAAGTTTAATGATTTGTTTAATGAATCAAAAAATTTGAGGGCAGATGCTTTGAT
TACAGGTCATTATGTTAAAAGTGTAACTAAAAATAATATAACCAACATGTATAGAGCAATTGATGAAAATCGCGATCAAAGTTATTTTTTGTTTGATACA
ACTAGGGAGCAATTAAATTATTTAAGATTTCCTTTAGGCGGTATTTTAAAATCTGAAACTAGAGAAATAGCAAAAAAATTAGATTTAAATGTTGCAGAAA
AACCAGATAGTCAAGATATATGTTTTGTTCCAAACGGTGATTACGTTTCAGTAATAGAAAAAATAAGACCAGATGCTTTTAAAAAAGGTAACATAAAAGA
TTTAAAAGGAAAAGTTATTGGTGTTCACGACGGTATTGTAAATTTTACTATAGGACAAAGGAAAGGGATAAAGCTAGCTACAAAAGACCCTTTATATGTT
ATTGAAATTAATGCAGATAAAAATGAAATTATTGTAGGTTCAAAGCAGCATCTTGTTAAGAAGGAAATTTTTTTGAAAGATCTAAATTTACTTGGTAATA
AAAGAGAATTTCAAAGAGAAATTTTTGTAAAAGTAAGATCTACTGGAAAGTTACTAAAATCAAAAATCAATATTATAAATGACAATGAGGCAATTTTAAA
TTTACAAGAAGAGGAATATGGTATCTCTCCAGGACAAGCGTGTGTTTTTTATTCCAAGGATCAAAATGGTTATAAAGTTCTTGGTGGAGGCTGGATAAAA
AAGTAATTAAGCTTTTCTTTTTTTCCCACATAAGAAAGTTAAAAAATAGAAAAAAATGACACCTAGAAAATAATCCCATTCTTATG

Translation

[147 - 803/886]   direct strand
>ORF_WE17110 Translation [147-803   direct strand]
MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICFVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNF
TIGQRKGIKLATKDPLYVIEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQREIFVKVRSTGKLLKSKINIINDNEAILNLQEEEYGISPGQACV
FYSKDQNGYKVLGGGWIKK

Phylogeny

Arbre NJ


          +--------------Geobacter(delta proteo)
     +----7 
     !    +------------------Pelobacte (delta proteo)
     !  
     !               +--------------Roseobact (alpha proteo)
     !          +----5 
  +-10          !    !          +----Sinorhizo (alpha proteo)
  !  !          !    +----------2 
  !  !  +-------6               +----Agrobacte (alpha proteo)
  !  !  !       ! 
  !  !  !       !          +--------Candidatu (alpha proteo)
  !  +--9       +----------3 
  !     !                  +---------ORF_WE1711
  !     ! 
  !     !            +------------------Campyloba (epsilon proteo)
  !     +------------4 
  !                  +----------------------Wollinell (epsilon proteo)
  ! 
  !                    +------Vibrio (gamma proteo)  
  8--------------------1 
  !                    +------Shewanell (gamma proteo)
  ! 
  +----------------------Nostoc (Cyanobacterie) 


Arbre Parcimonie

 +--------------------------------Nostoc  (cyanobacterie)
  !  
  !                             +--Shewanell (gamma proteo)
  7  +--------------------------6  
  !  !                          +--Vibrio (gamma proteo)  
  !  !  
  !  !                          +--Pelobacte (delta proteo)
  +--5     +--------------------9  
     !     !                    +--Geobacter (delta proteo)
     !     !  
     !     !                    +--Wollinell (epsilon proteo)
     +-----8     +-------------11  
           !     !              +--Campyloba (epsilon proteo)
           !     !  
           !     !           +-----Roseobact (alpha proteo)
           +----10        +--4  
                 !        !  !  +--Sinorhizo (alpha proteo)
                 !     +--2  +--3  
                 !     !  !     +--Agrobacte (alpha proteo)
                 +-----1  !  
                       !  +--------Candidatu (alpha proteo)
                       !  
                       +-----------ORF_WE1711

Annotator commentaries

Pour trouver les ORFs de notre lot nous avons utilisé ORFfinder sur le site SMS. Nous avons recherché les ORF avec Any codons sur les 6 cadres de lecture. Sur le brin direct nous trouvons un ORF en position 3. Sur le brin reverse nous trouvons 2 ORFs en positions 1 et 2. Ensuite nous avons de nouveau lancé la recherche avec ATG comme 1er codon. Sur le brin direct nous trouvons un ORF en position 3 Sur le brin reverse nous trouvons un ORF en positions 2 L'ORF le plus long est celui placé sur le brin direct. Nous conservons la séquence la plus longue et la recherche avec l'ATG nous donne le point de départ de l'ORF. Nous obtenons donc un ORF allant de la base 147 à la base 803 sur le brin direct.Celui ci est constitué de 219 acides aminés.

La prédiction de domaines protéiques se fait sur la base de INTERPRO sur le site de l'EBI. Nous avons obtenus un résultat avec comme domaine prédit: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase

Nous avons ensuite realisé un alignement de notre séquence contre des séquences déja connues. Ce qui permet de faire ressortir les séquences les plus proches ( e-values) de notre lot. Nous avons lancé un Blastp sur le site du NCBI.

Dans un premier temps la recherche s'est faite sur la base de données Swissprot où nous avons obtenus de bons scores (e- values: 1e-50 pour les 9 premiers resultats). Cela nous permet d'obtenir de bonnes information sur la fonction des homologues les plus proches de notre 0RF. Dans un deuxième temps nous avons fait un Blastp contre NR afin d'avoir plus de choix concernant les homologues présumés de notre ORF. Nous obtenons aussi de très bonnes e-values( 1e-84 pour le premier resultat). Les similitudes entre notre séquence et les séquences obtenues sont bonnes (71% pour le premier résultat et environ 50% pour les autres résultats.

Pour l'alignement multiple nous avons utilisé ClustalW disponible sur le site de l'EBI. Pour réaliser notre alignement nous avons du faire un choix de séquences parmi les résultats du Blast. C'est cet alignement multiple qui nous a servi à construire l'arbre phylogénétique. Le choix s'est fait au niveau des Evalues,du groupe d'étude (les protéobactéries), et par le choix d'un groupe externe (une cynanobactérie).

L'arbre phylogénétique se fait grace au logiciel phylip. Nous l'avons fait par deux méthodes: NJ et parcimonie. Cela nous permet de comparer nos 2 résultats et de voir si ils sont coherants entre eux. La création de l'arbre se fait à partir de l'alignement multiple fait précédemment. Nous avons en premier réalisé un arbre avec plusieurs types de protéobactéries (alpha, gamma, delta...). Notre ORF s'est révélé plus proche des Alpha protéobactéries que des autres. Donc nous avons rajouté d'autres alpha protéobactéries dans l'arbre pour situer plus précisement notre ORF. C'est pourquoi dans notre arbre il y a plus d'alpha que d'autres protéobactéries. Notre arbre nous permet de conclure que notre lot proviens d'une alpha proteobactérie car candidatus pelagibacter est l'orthologue le plus proche et qu'il s'agit d'une alpha. Viennent ensuite les autres alpha puis les delta et les epsilon et enfin les gamma et le groupe exterieur. Nous placons le groupe exterieur avec les gamma protéobactéries car l'arbre réalisé par NJ nous place les gamma et le groupe exterieur au meme niveau par rapport à notre ORF.

D'apres nos recherches, l'ARNt méthyltransferase participerait a un processus dans lequel une molécule de pre-ARNt serait convertie en ARNt mature, prét pour l'adjonction d'un acide aminé. Celle ci a comme fonction moléculaire celle d'une transferase catalysant la réaction : S-adenosyl-L-methionine + tRNA _

S-adenosyl-L-homocysteine + tRNA containing 5-methylaminomethyl-2-thiouridylate. 

Multiple Alignement

ORF_WE17110         ------------------------------------------------------------
ACandidatus         -----MTKLNSIGIAKDPKDTLVIVAMSGGVDSSTVAAMMKNEGYNVIGITLKLYNDS-- 53
AAgrobacter         --------MNTLDFDKRPEDTRIVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHG-- 50
ASinorhizobium      --------MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHG-- 50
ARoseobacter        MPLDPSPTLNSLGFAKPPAETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHG-- 58
GVibrio             --------------------------MSGGVDSSVSAYLLKQQGYQVEGLFMKNWEED-- 32
GShewanella         ----------MTSIEPTHTGKKVIVGMSGGVDSSVSAYLLMQQGYQVEGLFMKNWEED-- 48
GENostoc            -------------------MKKVVVGLSGGVDSSTAAAILHNQGYEVIGLTL--WLMK-- 37
DGeobacter          -------------MVKNNKRKRVVIAMSGGVDSSVAAALLKEEGHEVIGISMQVWDYTRF 47
DPelobacter         ---------------MKEKNKHILVAMSGGVDSTVAAALLLAQGHQVSGVTMRVWDT--- 42
ECampylobacter      --------------------MKILVAMSGGVDSTVTAYKLKQAGHEIIGCYMKLHGKP-- 38
EWollinella         --------------------MKVALLMSGGIDSSYSAYLLQEAGHEVVGIYLKLHDND-- 38
                                                                                

ORF_WE17110         ------------------------------------------------------------
ACandidatus         --KETASSKQCCAGQDIMDAKRVADKLKIEHKILYYQNKFKEGVIDNFIDSYLNGETPIP 111
AAgrobacter         --AAVHRAGSCCAGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAEAYAMGETPIP 108
ASinorhizobium      --AAVHRAGSCCAGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIP 108
ARoseobacter        --AALAKKGACCAGLDIHDARRVSEKMGFPHYVLDYENIFKDAVIDEFAESYLGGATPVP 116
GVibrio             -----DNEEYCTAAEDLADAQAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNP 87
GShewanella         -----DNNEYCAAAEDLKDAQAVCDKLGIKLHTVNFAAEYWDNVFEYFLAEYKAGRTPNP 103
GENostoc            -----GKGQCCS--EGMIDAAYICEQLGIPHEVVDMRDVFQTHIVDYLVTGYGAGITPLP 90
DGeobacter          TAEEGEKFDTCCSLDDIHDARRVAEQLEIPFYVVNFEEEFQNLVIDDFVNEYLLGRTPNP 107
DPelobacter         -----EPLGDGREPAHIRDARKVAFDLGIPLHVVDLREEFLQQVVTPFCEEYLSGRTPNP 97
ECampylobacter      ----------NYHEENIQKVEKVANFLGIKYHILDLQEDFKNQVYMPFINTYKDGKTPNP 88
EWollinella         ----------LKHAQNIQNIEKVSQKLGIETHIFDAKELFKKHVYDYFVDSYQKGLTPNP 88
                                                                                

ORF_WE17110         -----------------------------------------------MYRAIDENRDQSY 13
ACandidatus         CVQCNKTVKFTDLFEEAKR-LNADALVTGHYVKSITEKDN-----TDMYRGIDLNRDQSY 165
AAgrobacter         CVACNQTVKFADLLATAQE-LGADALATGHYIRSRPNPVSGQPGRRALYRPIDSDRDQSW 167
ASinorhizobium      CVACNQTVKFADLLATAKE-LGADALATGHYIRSRPSPKPRYAGQRALYRPADAERDQSY 167
ARoseobacter        CIRCNERVKFKDLLETAKD-LDADCMATGHYIQRKSGPYG-----AELHSAADANRDQSY 170
GVibrio             DILCNKEIKFKAFLEFADEVLEADYIAMGHYVRRSFPENGEK---PQMLRGLDSNKDQSY 144
GShewanella         DIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDNSDGS----TQMLRGVDGNKDQSY 159
GENostoc            CSQCNKTVKFGPMVQYASEKLGCDRIATGHYARIRYDEATGR---YQLLRAVDRNKDQSY 147
DGeobacter          CVRCNQWIKFELLLKKARG-LGADMIATGHYART-EQDADGR---YRLMKGVDPAKDQSY 162
DPelobacter         CVLCNRVFKFSRLLREADR-LGADALATGHYAR--IVEHDGL---KVLAKGSNRQKDQSY 151
ECampylobacter      CALCNRFIKLGKLLEFAKS-LGCEKLATGHYARIENG---------LIKTAFDDSKDQSY 138
EWollinella         CAFCNPFMKFGFALERALE-LGCEKIATGHYARVKEG---------RIQEAKDQSKDQSY 138
                                                                   :    :  :***:

ORF_WE17110         FLFDTTREQLNYLRFPLGGIL----KSETREIAKKLDLNVAEKPDSQDICFVPNG-DYVS 68
ACandidatus         FLFNTTKDQLNFLRFPLGNLL----KDETRNIARELDLNVADKPDSQDICFVPNG-DYAS 220
AAgrobacter         FLFATTQEQIDYLRFPLGGLS----KAETRALAEEMGLVVAKKADSQDICFVPQG-KYTD 222
ASinorhizobium      FLFATTQEQIDYLRFPLGGLP----KSETRALAEEMGLVVAKKADSQDICFVPQG-KYSD 222
ARoseobacter        FLFSTTPEQLAFLRFPLGHLPS---KEDTRALAEKYGLSVANKPDSQDICFVPDG-DYAS 226
GVibrio             FLYTLSHEQVARSLFPVGDLE----KPEVRRIAEEQGLITAKKKDSTGICFIGER-KFTE 199
GShewanella         FLYTLSHEQVARSLFPVGELE----KHQVREIAKEMGLITHDKKDSTGICFIGER-KFTE 214
GENostoc            FLYDLSQDLLAASLFPLGEME----KADTRRIATEHGLKTADKPESQDLCLVESNGSMRA 203
DGeobacter          FLFTLTQEQLAMTLFPLGGMT----KQEVRALAAGYGLRVAEKGESQEICFVPDN-DYVR 217
DPelobacter         FLFTLTQQQLQRVVFPLGEMS----KEEVRTHAERLGLHVAQKGDSQDICFIPDG-DYIG 206
ECampylobacter      FLANADKEALEYLIFPLGEMKKEDVK-KFASTIEVLKSFATQK-ESSEICFVEDT--YVQ 194
EWollinella         FLFGLKESVISRLIFPLGDRLKSEIKPEALEILPWLGTLESYK-ESQEICFVESD--YID 195
                    **     . :    **:*       * .              * :*  :*:: .      

ORF_WE17110         VIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLA-------TKDPLYVIEI 121
ACandidatus         VIEKFRPNSFSKGNIKNMNGEVIGVHDGIINYTIGQRKGIGVS-------DKNPLYVVKI 273
AAgrobacter         IINKLKPNAALAGDIVHLDGRVLGRHDGIVHYTIGQRRGIGVA-------TGEPLYVVHL 275
ASinorhizobium      IVSKLKPNAALAGEIVHLDGRVLGAHEGILHYTIGQRRGIGVA-------TGEPLYVVYL 275
ARoseobacter        VIRKLRPEAAAPGDIVDTDGRVLARHDGVVNYTIGQRRGLGIGG------LATPLYVIKL 280
GVibrio             FLG--RYLPAQPGNIETPEGEVIGQHQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEK 257
GShewanella         FLR--TYLPAQPGNIETPEGEVIGTHQGLMYHTLGQRKGLGIGGMKNS--NDDPWYVVDK 270
GENostoc            FLD--KYIAPKKGDIVDTAGKVLGQHDGVHHYTIGQRKGLGIAA-------PEPLYVVEL 254
DGeobacter          FIEEERGKQLLSGNIVDRKGKVLGVHDGTYRYTVGQRKGLGIAH-------PEPLYVLGV 270
DPelobacter         FLERQSHATDTEGSIVHVSGKRLGKHRGAYRFTVGQRRGLGIAW-------PEPLYVVAI 259
ECampylobacter      VLDQFMDTK-IPGIVRDSSGKEVGKHEGYMHYTIGKRRGFEVRG------AHEPHFVLKI 247
EWollinella         ILRRHFPVE-QKGIVQDSSGRVVGEHKGYMQYTIGKRKGFTVKG------AHDPHYVLSI 248
                    .:          * :    *. :. * *   .*:*:*:*: :           * :*   

ORF_WE17110         NADKNEIIVG---SKQHLVKKEIFLKDLNLLGN-KREFQR----EIFVKVRSTGKLLKSK 173
ACandidatus         IADKNEIIVG---AKEHLVKTKINLKDLNIITNDQNDFKN----ELFVKVRSTGRLIKAK 326
AAgrobacter         DARGRRVIVG---PREALETRRVYLRDMNWLGDGALAADAGQGFTCFAKVRSTRPPTEAV 332
ASinorhizobium      DSRSRRVIVG---PKEALETRRVYLRDVNWLGDEELEAAAGQGFECFAKVRSTRRPAPAV 332
ARoseobacter        DAEARQVVVG---PKSMLSTRTVPVREINWLGDEPFQSRD--AWHLAVKVRSTRPPTDAI 335
GVibrio             DLDRNVLIAVQGKDHPMLKSEGLLASQLHWVDREPIRDVM----KCTVKTRYRQQDIPCT 313
GShewanella         DLERNVLIVGQGGHHPRLMSTGMTVNQLHWVDRTGPVDGC----HITVKTRYRQQDVPCT 326
GENostoc            DAVHNKVVVG---DRTKATQEECTVNRVNWVSIAEPSTPI----RAAVQIRYRSAPEPVT 307
DGeobacter          DAARKEVTVG---PRDALYSDGLIATAINWIAPT-PETAI----EASCKIRYRHHPIPCR 322
DPelobacter         DAAKKQVIVG---EKEHLHVDRLVTTGTNWIVAQ-PQQPL----QARCRIRYRHQEAPCT 311
ECampylobacter      DPKKNEIIVG---KKEELKINEFDLEKINLFIDAKELDCE-------VKIRYRSRSTPCK 297
EWollinella         DPKENRLIVG---SKEELAKNVVYADPFALPEGFEHFEGE-------VKIRYRSLKVKAE 298
                        . : .     :                                 : *         

ORF_WE17110         INIINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK-------------- 219
ACandidatus         IDINDTN-ANVNLLEEEHGIAPGQACVFYAKNNNGYKVLGGGWIKS-------------- 371
AAgrobacter         LHADEN-GIYVDLMTGEAGVAPGQACVLYSAPGPDARVYGGGFIDRSERSVDAEASLKAL 391
ASinorhizobium      LKSDAE-GLYVELVEGEAGVAPGQACALYSGTGEDARVYGGGFIRRSEREPAAEAALKAL 391
ARoseobacter        IRPISDTEATVELTSPEEGISPGQACVFYDTD--SSRIYGGGWIHKG------------- 380
GVibrio             IIPIDDENIKVIFDEPQIAVTPGQSAVFYKDD----VCLGGGIIEQRIKYSQA------- 362
GShewanella         LTYTDEHTLRVVFDEPVAAVTPGQSAVFYDGE----VCLGGGIIDQLIRG---------- 372
GENostoc            VIPLENSRVRLVFDEPQFSITPGQAAVWYDGN----KVLGGGIIEQFSK----------- 352
DGeobacter          ILPLADNRAEVRFTEREKSVTPGQAVVFYDGD----TVLGGGWIEHAVNTKTAVSHE--- 375
DPelobacter         LVVLGNDRVEVRFDEPQSGVSPGQAAVFYDED----RVLGGGWIA--------------- 352
ECampylobacter      VMINDDKSAKVILKEPVYGLASGQMAVFYDKD----LVLASGFIN--------------- 338
EWollinella         VRLDESGRLVAHLKEKVYGVANGQALVLYAED----LVIGGGWILDSSLKS--------- 345
                    :           :     .:: **  . *          ..* *                

ORF_WE17110         -------
ACandidatus         -------
AAgrobacter         LEKPVAA 398
ASinorhizobium      LQAPAAA 398
ARoseobacter        -------
GVibrio             -------
GShewanella         -------
GENostoc            -------
DGeobacter          -------
DPelobacter         -------
ECampylobacter      -------
EWollinella         -------

BLAST

----------------------------Blast swissprot---------------------------
BLASTP 2.2.15 [Oct-15-2006]

Database: Non-redundant SwissProt sequences
           217,875 sequences; 82,042,039 total letters



                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|38258585|sp|Q8CY38|TRMU_BRUSU  Probable tRNA (5-methylamino...   218    1e-56
gi|24638318|sp|Q8YIL6|TRMU_BRUME  Probable tRNA (5-methylamino...   216    5e-56
gi|24638313|sp|Q8U9M5|TRMU_AGRT5  Probable tRNA (5-methylamino...   214    2e-55
gi|24638324|sp|Q92MB5|TRMU_RHIME  Probable tRNA (5-methylamino...   213    3e-55
gi|24638328|sp|Q98HL0|TRMU_RHILO  Probable tRNA (5-methylamino...   213    5e-55
gi|14195261|sp|P58074|TRMU_CAUCR  Probable tRNA (5-methylamino...   206    6e-53
gi|20455354|sp|Q92IL0|TRMU_RICCN  Probable tRNA (5-methylamino...   204    2e-52
gi|6226259|sp|Q9ZDM1|TRMU_RICPR  Probable tRNA (5-methylaminom...   199    8e-51
gi|73920129|sp|Q68X66|TRMU_RICTY  Probable tRNA (5-methylamino...   198    1e-50
gi|24638319|sp|Q8YX56|TRMU_ANASP  Probable tRNA (5-methylamino...   152    1e-36  Gene info
gi|24638309|sp|Q8RAH7|TRMU1_THETN  Probable tRNA (5-methylamin...   152    1e-36
gi|3122978|sp|P73755|TRMU_SYNY3  Probable tRNA (5-methylaminom...   149    5e-36  Gene info
gi|24638308|sp|Q8R7F0|TRMU2_THETN  Probable tRNA (5-methylamin...   149    8e-36
gi|24638315|sp|Q8XJH3|TRMU_CLOPE  Probable tRNA (5-methylamino...   145    8e-35
gi|30173409|sp|Q8CWM0|TRMU_SYNEL  Probable tRNA (5-methylamino...   143    3e-34
gi|73920124|sp|Q7MBC9|TRMU_GLOVI  Probable tRNA (5-methylamino...   139    9e-33
gi|24638326|sp|Q97GY2|TRMU_CLOAB  Probable tRNA (5-methylamino...   135    1e-31
gi|73920128|sp|Q72Q44|TRMU_LEPIC  Probable tRNA (5-methylamino...   132    6e-31
gi|14195288|sp|Q9PJ66|TRMU_CAMJE  Probable tRNA (5-methylamino...   132    6e-31
gi|59799068|sp|Q8F625|TRMU_LEPIN  Probable tRNA (5-methylamino...   132    7e-31
gi|6226257|sp|O67274|TRMU_AQUAE  Probable tRNA (5-methylaminom...   130    3e-30
gi|81657396|sp|Q7TTZ4|TRMU_RHOBA  Probable tRNA (5-methylamino...   129    7e-30
gi|24638303|sp|Q8NR24|TRMU_CORGL  Probable tRNA (5-methylamino...   129    7e-30
gi|30173439|sp|Q8FQ01|TRMU_COREF  Probable tRNA (5-methylamino...   122    1e-27
gi|30173411|sp|Q8CX40|TRMU_SHEON  Probable tRNA (5-methylamino...   121    1e-27
gi|3122976|sp|O33099|TRMU_MYCLE  Probable tRNA (5-methylaminom...   117    2e-26
gi|14195297|sp|Q9RTK1|TRMU_DEIRA  Probable tRNA (5-methylamino...   117    2e-26
gi|8134738|sp|O51625|TRMU_BORBU  Probable tRNA (5-methylaminom...   117    2e-26
gi|73920122|sp|Q6NHQ7|TRMU_CORDI  Probable tRNA (5-methylamino...   117    2e-26
gi|73920033|sp|Q660I8|TRMU_BORGA  Probable tRNA (5-methylamino...   117    4e-26
gi|11135216|sp|P57349|TRMU_BUCAI  Probable tRNA (5-methylamino...   115    9e-26
gi|33301704|sp|Q820E9|TRMU_CHLCV  Probable tRNA (5-methylamino...   115    1e-25
gi|30173412|sp|Q8CXC7|TRMU_OCEIH  Probable tRNA (5-methylamino...   115    1e-25
gi|67461977|sp|Q71ZF8|TRMU_LISMF  Probable tRNA (5-methylamino...   113    4e-25  Gene info
gi|32130287|sp|Q87QL9|TRMU_VIBPA  Probable tRNA (5-methylamino...   112    6e-25
gi|24638323|sp|Q92BK1|TRMU_LISIN  Probable tRNA (5-methylamino...   112    9e-25
gi|73919895|sp|Q812R6|TRMU_BACCR  Probable tRNA (5-methylamino...   112    1e-24
gi|24638317|sp|Q8Y714|TRMU_LISMO  Probable tRNA (5-methylamino...   112    1e-24
gi|73919894|sp|Q730D7|TRMU_BACC1  Probable tRNA (5-methylamino...   112    1e-24  Gene info
gi|73919893|sp|Q81JE5|TRMU_BACAN  Probable tRNA (5-methylamino...   110    3e-24
gi|73920125|sp|Q5QYZ7|TRMU_IDILO  Probable tRNA (5-methylamino...   110    3e-24
gi|71658010|sp|Q634E9|TRMU_BACCZ  Probable tRNA (5-methylamino...   110    4e-24  Gene info
gi|73919897|sp|Q65GR9|TRMU_BACLD  Probable tRNA (5-methylamino...   110    4e-24  Gene info
gi|61217310|sp|Q7MLT4|TRMU_VIBVY  Probable tRNA (5-methylamino...   110    4e-24  Gene info
gi|14195272|sp|Q9CLA3|TRMU_PASMU  Probable tRNA (5-methylamino...   110    5e-24
gi|30173408|sp|Q8CWJ6|TRMU_VIBVU  Probable tRNA (5-methylamino...   110    5e-24
gi|34395981|sp|O35020|TRMU_BACSU  Probable tRNA (5-methylamino...   109    6e-24
gi|14195289|sp|Q9PKA7|TRMU_CHLMU  Probable tRNA (5-methylamino...   108    9e-24
gi|1723144|sp|P47537|TRMU_MYCGE  Probable tRNA (5-methylaminom...   108    1e-23
gi|24638329|sp|Q98Q11|TRMU_MYCPU  Probable tRNA (5-methylamino...   108    1e-23
gi|3122972|sp|O25893|TRMU_HELPY  Probable tRNA (5-methylaminom...   108    1e-23
gi|6647880|sp|O84289|TRMU_CHLTR  Probable tRNA (5-methylaminom...   107    3e-23
gi|24638322|sp|Q8ZPZ4|TRMU_SALTY  tRNA (5-methylaminomethyl-2-thi   107    3e-23
gi|71658016|sp|Q5F7G4|TRMU_NEIG1  Probable tRNA (5-methylamino...   107    4e-23
gi|14195280|sp|Q9JYJ6|TRMU_NEIMB  Probable tRNA (5-methylamino...   107    4e-23
gi|8134749|sp|Q9ZJQ0|TRMU_HELPJ  Probable tRNA (5-methylaminom...   106    5e-23  Gene info
gi|71658017|sp|Q57QC0|TRMU_SALCH  tRNA (5-methylaminomethyl-2-thi   106    5e-23
gi|14195281|sp|Q9KDF2|TRMU_BACHD  Probable tRNA (5-methylamino...   106    7e-23
gi|24638321|sp|Q8ZFQ5|TRMU_YERPE  tRNA (5-methylaminomethyl-2-...   106    7e-23
gi|8039809|sp|P44551|TRMU_HAEIN  Probable tRNA (5-methylaminom...   105    1e-22
gi|71153355|sp|Q7U342|TRMU_HAEDU  Probable tRNA (5-methylamino...   105    1e-22
gi|30173406|sp|Q8CSA5|TRMU_STAES  Probable tRNA (5-methylamino...   105    1e-22  Gene info
gi|24638320|sp|Q8Z7G9|TRMU_SALTI  tRNA (5-methylaminomethyl-2-...   105    1e-22
gi|24638314|sp|Q8X735|TRMU_ECO57  tRNA (5-methylaminomethyl-2-thi   105    1e-22
gi|30173414|sp|Q8CXZ8|TRMU_ECOL6  Probable tRNA (5-methylamino...   104    2e-22
gi|37999578|sp|Q87ZR6|TRMU_PSESM  Probable tRNA (5-methylamino...   104    2e-22
gi|8039808|sp|P25745|TRMU_ECOLI  tRNA (5-methylaminomethyl-2-thio   104    2e-22
gi|54039755|sp|P66977|TRMU_MYCBO  Probable tRNA (5-methylamino...   103    3e-22
gi|29428172|sp|P59460|TRMU_BUCBP  Probable tRNA (5-methylamino...   103    3e-22
gi|71658014|sp|Q5NEF9|TRMU_FRATT  Probable tRNA (5-methylamino...   103    3e-22
gi|14195282|sp|Q9KSX8|TRMU_VIBCH  Probable tRNA (5-methylamino...   103    4e-22
gi|71658019|sp|Q5E3W7|TRMU_VIBF1  Probable tRNA (5-methylamino...   103    5e-22  Gene info
gi|24638325|sp|Q931Q6|TRMU_STAAM  Probable tRNA (5-methylamino...   103    5e-22  Gene info
gi|24638330|sp|Q99TM8|TRMU_STAAN  Probable tRNA (5-methylamino...   103    5e-22  Gene info
gi|37999625|sp|Q88FR9|TRMU_PSEPK  Probable tRNA (5-methylamino...   102    8e-22  Gene info
gi|6647887|sp|Q9Z8A5|TRMU_CHLPN  Probable tRNA (5-methylaminom...   102    1e-21
gi|14195277|sp|Q9JTJ9|TRMU_NEIMA  Probable tRNA (5-methylamino...   101    1e-21
gi|73920127|sp|Q74JW9|TRMU_LACJO  Probable tRNA (5-methylamino...   101    2e-21
gi|14195276|sp|Q9I0L2|TRMU_PSEAE  Probable tRNA (5-methylamino...   101    2e-21
gi|73920123|sp|Q820U1|TRMU_ENTFA  Probable tRNA (5-methylamino...   100    3e-21
gi|24638304|sp|Q8NW84|TRMU_STAAW  Probable tRNA (5-methylamino...   100    3e-21  Gene info
gi|73920126|sp|Q5FKU0|TRMU_LACAC  Probable tRNA (5-methylamino...   100    4e-21
gi|73920121|sp|Q5L6D1|TRMU_CHLAB  Probable tRNA (5-methylamino...  99.8    6e-21
gi|6226260|sp|O86583|TRMU_STRCO  Probable tRNA (5-methylaminom...  98.6    1e-20
gi|24638316|sp|Q8XVV4|TRMU_RALSO  Probable tRNA (5-methylamino...  95.9    9e-20
gi|81628239|sp|Q820W2|TRMU_COXBU  Probable tRNA (5-methylamino...  95.5    1e-19
gi|71658013|sp|Q6D4E9|TRMU_ERWCT  tRNA (5-methylaminomethyl-2-thi  95.5    1e-19
gi|14195293|sp|Q9PQ88|TRMU_UREPA  Probable tRNA (5-methylamino...  94.7    2e-19
gi|30173418|sp|Q8D397|TRMU_WIGBR  Probable tRNA (5-methylamino...  94.4    3e-19  Gene info
gi|3122982|sp|Q12093|TRMU_YEAST  tRNA (5-methylaminomethyl-2-t...  93.2    6e-19  Gene info
gi|25009493|sp|Q8K9Q8|TRMU_BUCAP  Probable tRNA (5-methylamino...  92.8    7e-19
gi|38258513|sp|Q88V96|TRMU_LACPL  Probable tRNA (5-methylamino...  92.8    7e-19
gi|14195271|sp|Q9CHA1|TRMU_LACLA  Probable tRNA (5-methylamino...  92.4    1e-18
gi|8134745|sp|Q9WYZ0|TRMU_THEMA  Probable tRNA (5-methylaminom...  91.7    2e-18
gi|2496370|sp|P75365|TRMU_MYCPN  Probable tRNA (5-methylaminom...  91.3    2e-18
gi|71658015|sp|Q6AEE4|TRMU_LEIXX  Probable tRNA (5-methylamino...  90.9    3e-18
gi|30173426|sp|Q8DRS4|TRMU_STRMU  Probable tRNA (5-methylamino...  89.4    8e-18
gi|25091447|sp|Q8K5H5|TRMU_STRP3  Probable tRNA (5-methylamino...  89.4    8e-18
gi|24638305|sp|Q8NZ00|TRMU_STRP8  Probable tRNA (5-methylamino...  88.6    1e-17
gi|68053070|sp|Q5X9C1|TRMU_STRP6  Probable tRNA (5-methylamino...  88.6    1e-17
gi|14195262|sp|P58075|TRMU_STRP1  Probable tRNA (5-methylamino...  88.6    2e-17
gi|54039756|sp|P66979|TRMU_STRA5  Probable tRNA (5-methylamino...  87.0    4e-17
gi|24638306|sp|Q8P9A1|TRMU_XANCP  Probable tRNA (5-methylamino...  85.9    9e-17
gi|30173410|sp|Q8CWW0|TRMU_STRR6  Probable tRNA (5-methylamino...  84.7    2e-16
gi|14195287|sp|Q9PDD9|TRMU_XYLFA  Probable tRNA (5-methylamino...  84.7    2e-16
gi|32130276|sp|Q87DM0|TRMU_XYLFT  Probable tRNA (5-methylamino...  84.0    4e-16  Gene info
gi|24638327|sp|Q97T38|TRMU_STRPN  Probable tRNA (5-methylamino...  82.8    8e-16
gi|73919892|sp|Q6FCW2|TRMU_ACIAD  Probable tRNA (5-methylamino...  82.8    8e-16  Gene info
gi|24638307|sp|Q8PL08|TRMU_XANAC  Probable tRNA (5-methylamino...  82.4    1e-15
gi|30173413|sp|Q8CXQ3|TRMU_MYCPE  Probable tRNA (5-methylamino...  80.5    3e-15
gi|20141962|sp|Q17440|TRMU_CAEEL  Probable tRNA (5-methylamino...  72.8    7e-13  Gene info
gi|14195274|sp|Q9DAT5|TRMU_MOUSE  tRNA (5-methylaminomethyl-2-thi  67.8    2e-11  Gene info
gi|8134740|sp|O75648|TRMU_HUMAN  tRNA (5-methylaminomethyl-2-t...  67.8    3e-11  Gene info
gi|3122971|sp|O13947|TRMU_SCHPO  Probable tRNA (5-methylaminom...  65.5    1e-10
gi|75055053|sp|Q5RB73|TRMU_PONPY  tRNA (5-methylaminomethyl-2-thi  60.1    5e-09
gi|75571355|sp|Q5ZKW0|TRMU_CHICK  tRNA (5-methylaminomethyl-2-thi  57.0    5e-08  Gene info
gi|81593416|sp|Q8Z4Y9|FADI_SALTI  3-ketoacyl-CoA thiolase (Fat...  32.0    1.7  
gi|1176069|sp|P44288|Y1672_HAEIN  Protein HI1672                   29.6    7.4  




>gi|38258585|sp|Q8CY38|TRMU_BRUSU  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
 gi|71658011|sp|Q57BT1|TRMU_BRUAB  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=398

 Score =  218 bits (555),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 104/224 (46%), Positives = 154/224 (68%), Gaps = 6/224 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR +D +RDQSYFLF TT+EQ++YLRFPLG + K++ REIA++L L VA+K DSQDICF
Sbjct  152  LYRPVDTDRDQSYFLFATTQEQIDYLRFPLGHLPKAQVREIAEELGLTVAKKQDSQDICF  211

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  +I +++P+A   G+I  + G+ +G HDGIV++T+GQR+GI +AT + LYV+ 
Sbjct  212  VPQGKYSDIISRLKPEAANPGDIVHIDGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVH  271

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNK-----REFQREIFVKVRSTGKLLKSKIN  175
            ++A    +IVG ++ L   ++FL+D+N LG+       +   E+F KVRST +  +  + 
Sbjct  272  LDAANARVIVGPREALETHKVFLRDVNWLGDTPIADLPKSGMEVFAKVRST-RPPRPAVL  330

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
               D +  + L + E GI+PGQACV YS D N  +V GGG+I +
Sbjct  331  RHADGQTWVELVDGESGIAPGQACVLYSDDSNAARVFGGGFIGR  374


>gi|24638318|sp|Q8YIL6|TRMU_BRUME  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=398

 Score =  216 bits (549),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 104/224 (46%), Positives = 153/224 (68%), Gaps = 6/224 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR +D +RDQSYFLF TT+EQ++YLRFPLG + K++ REIA++L L VA+K DSQDICF
Sbjct  152  LYRPVDTDRDQSYFLFATTQEQIDYLRFPLGHLPKAQVREIAEELGLTVAKKQDSQDICF  211

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  +I +++P+A   G+I  + G+ +G HDGIV++T+GQR+GI +AT + LYV+ 
Sbjct  212  VPQGKYSDIISRLKPEAANPGDIVHIDGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVH  271

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNK-----REFQREIFVKVRSTGKLLKSKIN  175
            ++A    +IVG ++ L   ++FL+D+N LG+       +   E+F KVRST +  +  + 
Sbjct  272  LDAANARVIVGPREALETHKVFLRDVNWLGDTPIADLPKSGMEVFAKVRST-RPPRPAVL  330

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
               D +  + L + E GI+PGQACV YS D N   V GGG+I +
Sbjct  331  RHADGQTWVELVDGESGIAPGQACVLYSDDSNAACVFGGGFIGR  374


>gi|24638313|sp|Q8U9M5|TRMU_AGRT5  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=398

 Score =  214 bits (545),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 105/226 (46%), Positives = 156/226 (69%), Gaps = 10/226 (4%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR ID +RDQS+FLF TT+EQ++YLRFPLGG+ K+ETR +A+++ L VA+K DSQDICF
Sbjct  155  LYRPIDSDRDQSWFLFATTQEQIDYLRFPLGGLSKAETRALAEEMGLVVAKKADSQDICF  214

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  +I K++P+A   G+I  L G+V+G HDGIV++TIGQR+GI +AT +PLYV+ 
Sbjct  215  VPQGKYTDIINKLKPNAALAGDIVHLDGRVLGRHDGIVHYTIGQRRGIGVATGEPLYVVH  274

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGN-------KREFQREIFVKVRSTGKLLKSK  173
            ++A    +IVG ++ L  + ++L+D+N LG+        + F    F KVRST    ++ 
Sbjct  275  LDARGRRVIVGPREALETRRVYLRDMNWLGDGALAADAGQGFT--CFAKVRSTRPPTEAV  332

Query  174  INIINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
            ++  ++N   ++L   E G++PGQACV YS      +V GGG+I +
Sbjct  333  LH-ADENGIYVDLMTGEAGVAPGQACVLYSAPGPDARVYGGGFIDR  377


>gi|24638324|sp|Q92MB5|TRMU_RHIME  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=398

 Score =  213 bits (543),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 108/230 (46%), Positives = 156/230 (67%), Gaps = 18/230 (7%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR  D  RDQSYFLF TT+EQ++YLRFPLGG+ KSETR +A+++ L VA+K DSQDICF
Sbjct  155  LYRPADAERDQSYFLFATTQEQIDYLRFPLGGLPKSETRALAEEMGLVVAKKADSQDICF  214

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  ++ K++P+A   G I  L G+V+G H+GI+++TIGQR+GI +AT +PLYV+ 
Sbjct  215  VPQGKYSDIVSKLKPNAALAGEIVHLDGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVY  274

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQR------EIFVKVRSTGK----LL  170
            +++    +IVG K+ L  + ++L+D+N LG++ E +       E F KVRST +    +L
Sbjct  275  LDSRSRRVIVGPKEALETRRVYLRDVNWLGDE-ELEAAAGQGFECFAKVRSTRRPAPAVL  333

Query  171  KSKINIINDNEAI-LNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
            KS      D E + + L E E G++PGQAC  YS      +V GGG+I++
Sbjct  334  KS------DAEGLYVELVEGEAGVAPGQACALYSGTGEDARVYGGGFIRR  377


>gi|24638328|sp|Q98HL0|TRMU_RHILO  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=396

 Score =  213 bits (541),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 101/224 (45%), Positives = 153/224 (68%), Gaps = 6/224 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR +D +RDQSYFLF TT+ Q++YLRFPLGG+ K + R IA+++ L VA K DSQDICF
Sbjct  150  LYRPVDADRDQSYFLFATTQAQIDYLRFPLGGLSKPQVRAIAEEMGLTVAAKQDSQDICF  209

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  +I K++P A   G+I  + G+V+G H+GI+ +TIGQR+GI +A+ +PLYV+ 
Sbjct  210  VPQGKYSDIIAKLKPAAANPGDIVHIDGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVH  269

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNK-----REFQREIFVKVRSTGKLLKSKIN  175
            ++A++  ++VG ++ L   +I+L+++N LG+       E   E+F KVRST     + + 
Sbjct  270  LDAERARVVVGPREALETHKIYLRNMNWLGDGPLGDIPEGGLELFAKVRSTRPPRPAVLR  329

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
             +    ++  L + E GI+PGQACV YS D N  +V GGG+I++
Sbjct  330  YVAGVTSV-ELADGESGIAPGQACVLYSDDGNEARVFGGGFIER  372


>gi|14195261|sp|P58074|TRMU_CAUCR  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=383

 Score =  206 bits (523),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 99/223 (44%), Positives = 152/223 (68%), Gaps = 8/223 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            + RA D  +DQSYFLF TTREQL++LRFPLGG+ K   R +A  L L++A+KPDSQDICF
Sbjct  151  LRRAADPAKDQSYFLFATTREQLDFLRFPLGGMDKPTVRAVAAGLGLSIADKPDSQDICF  210

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y +VI++IRP   + G++  L G+V+G H+G+  +TIGQR+G+ +A  DPL+V++
Sbjct  211  VPEGKYTTVIDRIRPQGAEAGDVVHLDGRVLGRHEGVTRYTIGQRRGLNIAVGDPLFVVK  270

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQ------REIFVKVRSTGKLLKSKI  174
            INADK ++IVG ++ L+   + LK+ + LG +   +      + +  +VRST + +  ++
Sbjct  271  INADKRQVIVGPREALLTASLTLKEGSWLGAQDSLEAAAEDGQRVLARVRSTREPVPGRL  330

Query  175  NIINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             +I+   +++    EE G++PGQACV Y    +  +VLGGG+I
Sbjct  331  AMIDGALSVVFDGAEE-GVAPGQACVLYDP-ADPDRVLGGGFI  371


>gi|20455354|sp|Q92IL0|TRMU_RICCN  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=370

 Score =  204 bits (519),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 103/221 (46%), Positives = 151/221 (68%), Gaps = 6/221 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            ++  +D  +DQSYFLF TT+EQL YLRFPLGG+ K ETR++A K  L VA+KPDSQDICF
Sbjct  151  LHTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKDETRKLASKFGLEVADKPDSQDICF  210

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            +P+G+Y SVI KIRP++ + G I  + G  +G H GI+N+TIGQR+G+ +A  +PLYV++
Sbjct  211  IPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVK  270

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGN--KREFQREIFVKVRSTGKLLKSKINIIN  178
            I+   N + VG +  L  +E  ++D+N L +  K   + E+ VK+RST     ++I+ + 
Sbjct  271  IDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDNEKLEVAVKIRSTRPPRLAEISKLG  330

Query  179  DNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
            D++  +    EE  ++PGQACV Y+    G +VLGGGWI +
Sbjct  331  DDKMKVKFLCEEKAVAPGQACVIYA----GERVLGGGWITR  367


>gi|6226259|sp|Q9ZDM1|TRMU_RICPR  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=358

 Score =  199 bits (505),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 144/219 (65%), Gaps = 6/219 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            ++  +D  +DQSYFLF  TREQL YL FPLGG  K ETR++A K  L++A+KPDSQDICF
Sbjct  139  LHTGLDTTKDQSYFLFTITREQLEYLSFPLGGFTKYETRKLASKFGLDIADKPDSQDICF  198

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP+G+Y +VI KIRP+A   G I  + G  +G H GI+N+TIGQR+G+ +A  +PLYV++
Sbjct  199  VPDGNYKTVINKIRPEANTSGKIVHINGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVK  258

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGN--KREFQREIFVKVRSTGKLLKSKINIIN  178
            I+   N + VG +  L   E  +KD+N L +  K   +  + VK+RST     ++I+ + 
Sbjct  259  IDPSNNIVYVGQESALHVHEFIIKDVNWLADEIKDHEKLAVDVKIRSTRPPCHAEISKLC  318

Query  179  DNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
            ++   +    +E  ++PGQACV Y+    G +VLGGGWI
Sbjct  319  NDRIKVKFLSKEKAVAPGQACVIYA----GERVLGGGWI  353


>gi|73920129|sp|Q68X66|TRMU_RICTY  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Length=358

 Score =  198 bits (504),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 101/221 (45%), Positives = 145/221 (65%), Gaps = 6/221 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            ++  +D  +DQSYFLF  TREQL YL FPLGG  K ETR++A K  L+VA+KPDSQDICF
Sbjct  139  LHTGLDAAKDQSYFLFTITREQLEYLIFPLGGFTKYETRKLASKFGLDVADKPDSQDICF  198

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP+G+Y +VI KIRP+A   G I  + G  +G H GI+N+TIGQR+G+ +A  +PLYV++
Sbjct  199  VPDGNYKTVINKIRPEASTSGKIVHINGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVK  258

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGN--KREFQREIFVKVRSTGKLLKSKINIIN  178
            I+   N + VG +  L   E  +KD+N L +  K   +  + VK+RST     ++I+ + 
Sbjct  259  IDPSNNIVYVGQESALHVHEFIIKDVNWLADEIKDNEKLAVDVKIRSTRPPCHAEISKLC  318

Query  179  DNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
            +++  +     E  ++PGQACV Y+    G +VLGGGWI +
Sbjct  319  NDKIKVQFLSAEKAVAPGQACVIYA----GERVLGGGWITR  355


----------------------------------Blast nr----------------------------------------
BLASTP 2.2.15 [Oct-15-2006] 

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,196,452 sequences; 1,444,328,266 total letters

gi|71083529|ref|YP_266248.1|  tRNA (5-methylaminomethyl-2-thio...   315    1e-84  
gi|118433757|gb|EAV40418.1|  tRNA (5-methylaminomethyl-2-thiou...   237    4e-61
gi|83942322|ref|ZP_00954783.1|  tRNA (5-methylaminomethyl-2-th...   228    1e-58
gi|83953541|ref|ZP_00962262.1|  tRNA (5-methylaminomethyl-2-th...   228    1e-58
gi|84500833|ref|ZP_00999068.1|  tRNA (5-methylaminomethyl-2-th...   226    4e-58
gi|114569244|ref|YP_755924.1|  tRNA (5-methylaminomethyl-2-thi...   225    1e-57  
gi|84516171|ref|ZP_01003531.1|  tRNA (5-methylaminomethyl-2-th...   224    2e-57
gi|114768812|ref|ZP_01446438.1|  tRNA (5-methylaminomethyl-2-t...   223    7e-57
gi|110679829|ref|YP_682836.1|  tRNA (5-methylaminomethyl-2-thi...   222    8e-57  
gi|99081242|ref|YP_613396.1|  tRNA (5-methylaminomethyl-2-thio...   221    2e-56  
gi|114766932|ref|ZP_01445852.1|  tRNA (5-methylaminomethyl-2-t...   220    3e-56
gi|89069527|ref|ZP_01156871.1|  tRNA (5-methylaminomethyl-2-th...   220    4e-56
gi|84686908|ref|ZP_01014792.1|  tRNA (5-methylaminomethyl-2-th...   218    1e-55
gi|23502454|ref|NP_698581.1|  tRNA (5-methylaminomethyl-2-thio...   218    2e-55  
gi|83859630|ref|ZP_00953150.1|  tRNA (5-methylaminomethyl-2-th...   218    2e-55
gi|85702766|ref|ZP_01033870.1|  tRNA (5-methylaminomethyl-2-th...   217    3e-55
gi|56696559|ref|YP_166916.1|  tRNA (5-methylaminomethyl-2-thio...   216    5e-55  
gi|83951896|ref|ZP_00960628.1|  tRNA (5-methylaminomethyl-2-th...   216    6e-55
gi|17986711|ref|NP_539345.1|  tRNA (5-methylaminomethyl-2-thio...   216    7e-55  
gi|39934381|ref|NP_946657.1|  tRNA (5-methylaminomethyl-2-thio...   215    1e-54  
gi|85713551|ref|ZP_01044541.1|  tRNA (5-methylaminomethyl-2-th...   215    1e-54
gi|86751223|ref|YP_487719.1|  tRNA (5-methylaminomethyl-2-thio...   214    2e-54  
gi|15891245|ref|NP_356917.1|  tRNA (5-methylaminomethyl-2-thio...   214    2e-54  
gi|24638313|sp|Q8U9M5|TRMU_AGRT5  Probable tRNA (5-methylamino...   214    2e-54
gi|17937408|ref|NP_534197.1|  tRNA (5-methylaminomethyl-2-thio...   214    2e-54  
gi|91978423|ref|YP_571082.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|75674801|ref|YP_317222.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|15966466|ref|NP_386819.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|92116313|ref|YP_576042.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|113872455|ref|ZP_01412584.1|  tRNA (5-methylaminomethyl-2-t...   213    4e-54
gi|110634566|ref|YP_674774.1|  tRNA (5-methylaminomethyl-2-thi...   213    4e-54  
gi|56551665|ref|YP_162504.1|  tRNA (5-methylaminomethyl-2-thio...   213    5e-54  
gi|24638328|sp|Q98HL0|TRMU_RHILO  Probable tRNA (5-methylamino...   213    7e-54
gi|13472503|ref|NP_104070.1|  tRNA (5-methylaminomethyl-2-thio...   213    7e-54  
gi|86138410|ref|ZP_01056984.1|  tRNA (5-methylaminomethyl-2-th...   213    7e-54
gi|83751595|ref|ZP_00948008.1|  COG0482: Predicted tRNA(5-meth...   212    1e-53
gi|89054998|ref|YP_510449.1|  tRNA (5-methylaminomethyl-2-thio...   211    2e-53  
gi|69933484|ref|ZP_00628686.1|  tRNA (5-methylaminomethyl-2-th...   211    3e-53
gi|115523063|ref|YP_779974.1|  tRNA (5-methylaminomethyl-2-thi...   211    3e-53  
gi|84704099|ref|ZP_01017927.1|  tRNA (5-methylaminomethyl-2-th...   211    3e-53
gi|90419040|ref|ZP_01226951.1|  tRNA methyl transferase ((5-me...   210    3e-53
gi|116253697|ref|YP_769535.1|  putative tRNA (5-methylaminomet...   209    8e-53  
gi|90422506|ref|YP_530876.1|  tRNA (5-methylaminomethyl-2-thio...   209    1e-52  
gi|94498089|ref|ZP_01304652.1|  tRNA (5-methylaminomethyl-2-th...   207    2e-52
gi|58698498|ref|ZP_00373403.1|  tRNA (5-methylaminomethyl-2-th...   207    2e-52
gi|103487513|ref|YP_617074.1|  tRNA (5-methylaminomethyl-2-thi...   207    3e-52  
gi|78693408|ref|ZP_00857922.1|  tRNA (5-methylaminomethyl-2-th...   207    3e-52
gi|86359043|ref|YP_470935.1|  tRNA 5-methylaminomethyl-2-thiou...   207    3e-52  
gi|16125150|ref|NP_419714.1|  tRNA (5-methylaminomethyl-2-thio...   206    8e-52  
gi|27382106|ref|NP_773635.1|  tRNA (5-methylaminomethyl-2-thio...   206    9e-52  
gi|49474501|ref|YP_032543.1|  tRNA (5-methylaminomethyl-2-thio...   205    1e-51  
gi|114706635|ref|ZP_01439536.1|  tRNA (5-methylaminomethyl-2-t...   204    2e-51
gi|15892333|ref|NP_360047.1|  tRNA (5-methylaminomethyl-2-thio...   204    3e-51  
gi|67458888|ref|YP_246512.1|  tRNA (5-methylaminomethyl-2-thio...   204    3e-51  
gi|99035878|ref|ZP_01314930.1|  hypothetical protein Wendoof_0...   203    4e-51
gi|42521055|ref|NP_966970.1|  tRNA (5-methylaminomethyl-2-thio...   203    4e-51  
gi|34580653|ref|ZP_00142133.1|  tRNA (5-methylaminomethyl-2-th...   203    4e-51
gi|89361379|ref|ZP_01199194.1|  tRNA (5-methylaminomethyl-2-th...   203    4e-51
gi|53731980|ref|ZP_00153456.2|  COG0482: Predicted tRNA(5-meth...   203    5e-51
gi|83368057|ref|ZP_00912922.1|  tRNA (5-methylaminomethyl-2-th...   203    5e-51
gi|102191989|ref|ZP_01347801.1|  hypothetical protein RcanM_01...   202    7e-51
gi|49475921|ref|YP_033962.1|  tRNA (5-methylaminomethyl-2-thio...   202    1e-50  
gi|88608438|ref|YP_506353.1|  tRNA (5-methylaminomethyl-2-thio...   201    1e-50  
gi|77463173|ref|YP_352677.1|  tRNA (5-methylaminomethyl-2-thio...   201    2e-50  
gi|114798727|ref|YP_759370.1|  tRNA (5-methylaminomethyl-2-thi...   201    2e-50  
gi|23012016|ref|ZP_00052207.1|  COG0482: Predicted tRNA(5-meth...   201    3e-50
gi|91205346|ref|YP_537701.1|  tRNA (5-methylaminomethyl-2-thio...   200    3e-50  
gi|83373958|ref|ZP_00918734.1|  tRNA (5-methylaminomethyl-2-th...   200    3e-50
gi|56416599|ref|YP_153673.1|  tRNA (5-methylaminomethyl-2-thio...   200    4e-50  
gi|52698722|ref|ZP_00340130.1|  COG0482: Predicted tRNA(5-meth...   199    6e-50
gi|113935682|ref|ZP_01421579.1|  tRNA (5-methylaminomethyl-2-t...   199    8e-50
gi|15604175|ref|NP_220690.1|  tRNA (5-methylaminomethyl-2-thio...   199    1e-49  
gi|51473501|ref|YP_067258.1|  tRNA (5-methylaminomethyl-2-thio...   198    1e-49  
gi|58584415|ref|YP_197988.1|  Predicted tRNA(5-methylaminometh...   198    1e-49  
gi|83593359|ref|YP_427111.1|  tRNA (5-methylaminomethyl-2-thio...   197    3e-49  
gi|57238956|ref|YP_180092.1|  tRNA (5-methylaminomethyl-2-thio...   194    2e-48  
gi|58616948|ref|YP_196147.1|  Probable tRNA (5-methylaminometh...   192    6e-48  
gi|68171265|ref|ZP_00544667.1|  tRNA (5-methylaminomethyl-2-th...   191    2e-47
gi|73666857|ref|YP_302873.1|  tRNA(5-methylaminomethyl-2-thiou...   190    4e-47  
gi|88607883|ref|YP_505483.1|  tRNA (5-methylaminomethyl-2-thio...   189    1e-46  
gi|83312118|ref|YP_422382.1|  Predicted tRNA(5-methylaminometh...   185    1e-45  
gi|110808325|gb|ABG91067.1|  tRNA (5-methylaminomethyl-2-thiou...   183    5e-45
gi|46202527|ref|ZP_00053063.2|  COG0482: Predicted tRNA(5-meth...   182    9e-45
gi|87198069|ref|YP_495326.1|  tRNA (5-methylaminomethyl-2-thio...   181    2e-44  
gi|88938014|ref|ZP_01143533.1|  tRNA (5-methylaminomethyl-2-th...   181    3e-44
gi|85709728|ref|ZP_01040793.1|  tRNA (5-methylaminomethyl-2-th...   179    6e-44
gi|78222093|ref|YP_383840.1|  tRNA (5-methylaminomethyl-2-thio...   169    7e-41  
gi|85375520|ref|YP_459582.1|  tRNA (5-methylaminomethyl-2-thio...   169    1e-40  
gi|117924260|ref|YP_864877.1|  tRNA (5-methylaminomethyl-2-thi...   168    2e-40  
gi|110600609|ref|ZP_01388825.1|  tRNA (5-methylaminomethyl-2-t...   167    3e-40
gi|77919454|ref|YP_357269.1|  tRNA (5-methylaminomethyl-2-thio...   166    6e-40  
gi|58039815|ref|YP_191779.1|  tRNA (5-methylaminomethyl-2-thio...   166    7e-40  
gi|94969297|ref|YP_591345.1|  tRNA (5-methylaminomethyl-2-thio...   161    2e-38  
gi|41152729|gb|AAR35942.2|  tRNA (5-methylaminomethyl-2-thiour...   160    4e-38
gi|39997664|ref|NP_953615.1|  tRNA (5-methylaminomethyl-2-thio...   160    4e-38  
gi|23126446|ref|ZP_00108340.1|  COG0482: Predicted tRNA(5-meth...   158    1e-37
gi|116619734|ref|YP_821890.1|  tRNA (5-methylaminomethyl-2-thi...   157    4e-37  
gi|95930240|ref|ZP_01312978.1|  tRNA (5-methylaminomethyl-2-th...   157    4e-37
gi|67922387|ref|ZP_00515898.1|  tRNA (5-methylaminomethyl-2-th...   156    8e-37
gi|27262188|gb|AAN87375.1|  tRNA (5-methylaminomethyl-2-thiour...   155    9e-37
gi|21674668|ref|NP_662733.1|  tRNA (5-methylaminomethyl-2-thio...   155    1e-36  
gi|87306814|ref|ZP_01088960.1|  tRNA (5-methylaminomethyl-2-th...   154    2e-36
gi|78188235|ref|YP_378573.1|  tRNA (5-methylaminomethyl-2-thio...   154    2e-36  
gi|78043170|ref|YP_361010.1|  tRNA (5-methylaminomethyl-2-thio...   154    3e-36  
gi|109645516|ref|ZP_01369436.1|  tRNA (5-methylaminomethyl-2-t...   154    4e-36
gi|17228854|ref|NP_485402.1|  tRNA (5-methylaminomethyl-2-thio...   152    1e-35  
gi|20807693|ref|NP_622864.1|  predicted tRNA(5-methylaminometh...   152    1e-35  
gi|75910268|ref|YP_324564.1|  tRNA (5-methylaminomethyl-2-thio...   151    2e-35  
gi|67935858|ref|ZP_00528875.1|  tRNA (5-methylaminomethyl-2-th...   150    3e-35
gi|16330399|ref|NP_441127.1|  tRNA (5-methylaminomethyl-2-thio...   149    6e-35  
gi|114844534|ref|ZP_01454980.1|  tRNA (5-methylaminomethyl-2-t...   149    8e-35
gi|76796111|ref|ZP_00778479.1|  tRNA (5-methylaminomethyl-2-th...   149    8e-35
gi|20808819|ref|NP_623990.1|  predicted tRNA(5-methylaminometh...   149    1e-34  
gi|113940343|ref|ZP_01426179.1|  tRNA (5-methylaminomethyl-2-t...   149    1e-34
gi|89895170|ref|YP_518657.1|  hypothetical protein DSY2424 [De...   148    1e-34  
gi|51893527|ref|YP_076218.1|  tRNA (5-methylaminomethyl-2-thio...   147    2e-34  
gi|118061686|ref|ZP_01530040.1|  tRNA (5-methylaminomethyl-2-t...   147    3e-34
gi|67916377|ref|ZP_00510090.1|  tRNA (5-methylaminomethyl-2-th...   147    4e-34
gi|85860139|ref|YP_462341.1|  tRNA (5-methylaminomethyl-2-thio...   146    6e-34  
gi|110802009|ref|YP_699068.1|  tRNA (5-methylaminomethyl-2-thi...   146    7e-34  
gi|91203955|emb|CAJ71608.1|  conserved hypothetical protein [C...   146    7e-34
gi|18310765|ref|NP_562699.1|  tRNA (5-methylaminomethyl-2-thio...   146    8e-34  
gi|110596963|ref|ZP_01385253.1|  tRNA (5-methylaminomethyl-2-t...   146    8e-34
gi|110801338|ref|YP_696468.1|  tRNA (5-methylaminomethyl-2-thi...   145    1e-33  
gi|106888931|ref|ZP_01356131.1|  tRNA (5-methylaminomethyl-2-t...   145    1e-33
gi|78776909|ref|YP_393224.1|  tRNA (5-methylaminomethyl-2-thio...   144    2e-33  
gi|28211134|ref|NP_782078.1|  tRNA (5-methylaminomethyl-2-thio...   144    2e-33  
gi|83590486|ref|YP_430495.1|  tRNA (5-methylaminomethyl-2-thio...   144    3e-33  
gi|22299799|ref|NP_683046.1|  tRNA (5-methylaminomethyl-2-thio...   143    4e-33  
gi|82500377|ref|ZP_00885794.1|  tRNA (5-methylaminomethyl-2-th...   143    5e-33
gi|56752503|ref|YP_173204.1|  tRNA (5-methylaminomethyl-2-thio...   143    6e-33  
gi|114566016|ref|YP_753170.1|  tRNA (5-methylaminomethyl-2-thi...   143    6e-33  
gi|116328677|ref|YP_798397.1|  tRNA (5-methylaminomethyl-2-thi...   142    1e-32  
gi|108804192|ref|YP_644129.1|  tRNA (5-methylaminomethyl-2-thi...   142    1e-32  
gi|113474569|ref|YP_720630.1|  tRNA (5-methylaminomethyl-2-thi...   141    2e-32  
gi|28210754|ref|NP_781698.1|  tRNA (5-methylaminomethyl-2-thio...   140    3e-32  
gi|67918358|ref|ZP_00511957.1|  tRNA (5-methylaminomethyl-2-th...   140    3e-32
gi|72382697|ref|YP_292052.1|  tRNA (5-methylaminomethyl-2-thio...   140    4e-32  
gi|89211872|ref|ZP_01190199.1|  tRNA (5-methylaminomethyl-2-th...   140    5e-32
gi|71837111|ref|ZP_00676877.1|  tRNA (5-methylaminomethyl-2-th...   140    5e-32
gi|78779771|ref|YP_397883.1|  tRNA (5-methylaminomethyl-2-thio...   139    7e-32  
gi|88939835|ref|ZP_01145280.1|  tRNA (5-methylaminomethyl-2-th...   139    8e-32
gi|115250315|emb|CAJ68137.1|  putative tRNA (5-methylaminometh...   139    8e-32
gi|67938352|ref|ZP_00530879.1|  tRNA (5-methylaminomethyl-2-th...   139    1e-31
gi|37520120|ref|NP_923497.1|  tRNA (5-methylaminomethyl-2-thio...   139    1e-31  
gi|108756833|ref|YP_631693.1|  tRNA (5-methylaminomethyl-2-thi...   139    1e-31  
gi|71481145|ref|ZP_00660853.1|  tRNA (5-methylaminomethyl-2-th...   139    1e-31
gi|68548735|ref|ZP_00588204.1|  tRNA (5-methylaminomethyl-2-th...   139    1e-31
gi|33240814|ref|NP_875756.1|  tRNA (5-methylaminomethyl-2-thio...   139    1e-31  
gi|57241962|ref|ZP_00369902.1|  tRNA (5-methylaminomethyl-2-th...   138    1e-31
gi|86604778|ref|YP_473541.1|  tRNA (5-methylaminomethyl-2-thio...   137    3e-31  
gi|82748256|ref|ZP_00910743.1|  tRNA (5-methylaminomethyl-2-th...   137    4e-31
gi|86608667|ref|YP_477429.1|  tRNA (5-methylaminomethyl-2-thio...   136    8e-31  
gi|109690828|ref|ZP_01377899.1|  hypothetical protein Cjejd_01...   136    8e-31
gi|78186206|ref|YP_374249.1|  tRNA (5-methylaminomethyl-2-thio...   135    9e-31  
gi|68536405|ref|YP_251110.1|  tRNA (5-methylaminomethyl-2-thio...   135    1e-30  
gi|15895501|ref|NP_348850.1|  tRNA (5-methylaminomethyl-2-thio...   135    2e-30  
gi|84517594|ref|ZP_01004943.1|  tRNA (5-methylaminomethyl-2-th...   135    2e-30
gi|78212421|ref|YP_381200.1|  tRNA (5-methylaminomethyl-2-thio...   134    2e-30  
gi|33862617|ref|NP_894177.1|  tRNA (5-methylaminomethyl-2-thio...   134    2e-30  
gi|76259215|ref|ZP_00766866.1|  tRNA (5-methylaminomethyl-2-th...   134    3e-30
gi|118047413|ref|ZP_01516050.1|  tRNA (5-methylaminomethyl-2-t...   134    3e-30
gi|87306121|ref|ZP_01088273.1|  tRNA (5-methylaminomethyl-2-th...   134    3e-30
gi|57169043|ref|ZP_00368171.1|  tRNA (5-methylaminomethyl-2-th...   134    3e-30
gi|45658118|ref|YP_002204.1|  tRNA (5-methylaminomethyl-2-thio...   133    6e-30  
gi|94986647|ref|YP_594580.1|  predicted tRNA(5-methylaminometh...   133    7e-30  
gi|41409155|ref|NP_961991.1|  tRNA (5-methylaminomethyl-2-thio...   133    7e-30  
gi|73920128|sp|Q72Q44|TRMU_LEPIC  Probable tRNA (5-methylamino...   132    7e-30
gi|15791445|ref|NP_281268.1|  tRNA (5-methylaminomethyl-2-thio...   132    8e-30  
gi|24214187|ref|NP_711668.1|  Probable tRNA (5-methylaminometh...   132    9e-30  
gi|116073367|ref|ZP_01470629.1|  tRNA (5-methylaminomethyl-2-t...   132    9e-30
gi|33861847|ref|NP_893408.1|  tRNA (5-methylaminomethyl-2-thio...   132    1e-29  
gi|88946318|ref|ZP_01149399.1|  tRNA (5-methylaminomethyl-2-th...   131    3e-29
gi|15606458|ref|NP_213838.1|  hypothetical protein aq_1224 [Aq...   130    4e-29  
gi|118135103|gb|ABK62147.1|  tRNA (5-methylaminomethyl-2-thiou...   130    5e-29
gi|19704100|ref|NP_603662.1|  tRNA (5-methylaminomethyl-2-thio...   130    5e-29  
gi|78185088|ref|YP_377523.1|  tRNA (5-methylaminomethyl-2-thio...   130    5e-29  
gi|88809139|ref|ZP_01124648.1|  tRNA (5-methylaminomethyl-2-th...   130    6e-29
gi|109673713|ref|ZP_01375887.1|  hypothetical protein Ccur5_01...   130    6e-29
gi|118168513|gb|ABK69410.1|  tRNA (5-methylaminomethyl-2-thiou...   129    7e-29
gi|34763143|ref|ZP_00144111.1|  tRNA (5-methylaminomethyl-2-th...   129    7e-29
gi|32474336|ref|NP_867330.1|  tRNA (5-methylaminomethyl-2-thio...   129    9e-29  
gi|19552461|ref|NP_600463.1|  tRNA (5-methylaminomethyl-2-thio...   129    1e-28  
gi|42526204|ref|NP_971302.1|  tRNA (5-methylaminomethyl-2-thio...   129    1e-28  
gi|33866156|ref|NP_897715.1|  tRNA (5-methylaminomethyl-2-thio...   128    2e-28  
gi|116072337|ref|ZP_01469604.1|  tRNA (5-methylaminomethyl-2-t...   128    2e-28
gi|87301094|ref|ZP_01083935.1|  tRNA (5-methylaminomethyl-2-th...   127    3e-28
gi|68551564|ref|ZP_00590959.1|  tRNA (5-methylaminomethyl-2-th...   127    5e-28
gi|57240773|ref|ZP_00368721.1|  tRNA (5-methylaminomethyl-2-th...   126    8e-28
gi|85860332|ref|YP_462534.1|  tRNA (5-methylaminomethyl-2-thio...   126    8e-28  
gi|34557952|ref|NP_907767.1|  tRNA (5-methylaminomethyl-2-thio...   125    1e-27  
gi|114047179|ref|YP_737729.1|  tRNA (5-methylaminomethyl-2-thi...   125    2e-27  
gi|83816248|ref|YP_446592.1|  tRNA (5-methylaminomethyl-2-thio...   124    2e-27  
gi|86157907|ref|YP_464692.1|  tRNA (5-methylaminomethyl-2-thio...   124    4e-27  
gi|98661041|dbj|GAA01827.1|  unnamed protein product [Pelotomacul   124    5e-27
gi|46200029|ref|YP_005696.1|  tRNA (5-methylaminomethyl-2-thio...   123    5e-27  
gi|57234425|ref|YP_181511.1|  tRNA (5-methylaminomethyl-2-thio...   123    6e-27  
gi|88933517|ref|ZP_01139192.1|  tRNA (5-methylaminomethyl-2-th...   123    7e-27
gi|110638005|ref|YP_678212.1|  tRNA (5-methylaminomethyl-2-thi...   123    7e-27  
gi|73748589|ref|YP_307828.1|  tRNA(5-methylaminomethyl-2-thiou...   122    9e-27  
gi|113953824|ref|YP_729973.1|  tRNA (5-methylaminomethyl-2-thi...   122    9e-27  
gi|113969944|ref|YP_733737.1|  tRNA (5-methylaminomethyl-2-thi...   122    1e-26  
gi|50842596|ref|YP_055823.1|  tRNA (5-methylaminomethyl-2-thio...   122    1e-26  
gi|87125503|ref|ZP_01081348.1|  tRNA (5-methylaminomethyl-2-th...   122    1e-26
gi|110005181|emb|CAK99508.1|  probable trna 5-methylaminomethy...   122    1e-26
gi|25027890|ref|NP_737944.1|  tRNA (5-methylaminomethyl-2-thio...   122    2e-26  
gi|24374174|ref|NP_718217.1|  tRNA (5-methylaminomethyl-2-thio...   121    2e-26  
gi|117920194|ref|YP_869386.1|  tRNA (5-methylaminomethyl-2-thi...   121    3e-26  
gi|51246807|ref|YP_066691.1|  tRNA (5-methylaminomethyl-2-thio...   121    3e-26  
gi|118055683|ref|ZP_01524186.1|  tRNA (5-methylaminomethyl-2-t...   120    4e-26
gi|94984899|ref|YP_604263.1|  tRNA (5-methylaminomethyl-2-thio...   120    4e-26  
gi|54026238|ref|YP_120480.1|  tRNA (5-methylaminomethyl-2-thio...   120    6e-26  
gi|109671104|ref|ZP_01373374.1|  hypothetical protein Ccon1_01...   120    6e-26
gi|42523417|ref|NP_968797.1|  tRNA-methyltransferase [Bdellovi...   119    7e-26  
gi|118174880|gb|ABK75776.1|  tRNA (5-methylaminomethyl-2-thiou...   119    7e-26
gi|112799930|gb|EAT97274.1|  tRNA (5-methylaminomethyl-2-thiou...   119    7e-26
gi|117927897|ref|YP_872448.1|  tRNA (5-methylaminomethyl-2-thi...   119    9e-26  
gi|111023428|ref|YP_706400.1|  tRNA (5-methylaminomethyl-2-thi...   119    9e-26  
gi|89337964|ref|ZP_01190742.1|  tRNA (5-methylaminomethyl-2-th...   119    1e-25
gi|89100972|ref|ZP_01173817.1|  TrmU [Bacillus sp. NRRL B-1491...   118    2e-25
gi|15827913|ref|NP_302176.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|15806762|ref|NP_295482.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|14195297|sp|Q9RTK1|TRMU_DEIRA  Probable tRNA (5-methylamino...   117    3e-25
gi|15595027|ref|NP_212816.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|38233668|ref|NP_939435.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|111115515|ref|YP_710133.1|  hypothetical protein BAPKO_0726...   117    4e-25  
gi|90203532|ref|ZP_01206177.1|  tRNA (5-methylaminomethyl-2-th...   117    4e-25
gi|51598937|ref|YP_073125.1|  tRNA (5-methylaminomethyl-2-thio...   117    5e-25  
gi|117617943|ref|YP_855954.1|  tRNA (5-methylaminomethyl-2-thi...   116    7e-25  
gi|28952048|ref|NP_240085.2|  tRNA (5-methylaminomethyl-2-thio...   115    1e-24  
gi|29840118|ref|NP_829224.1|  tRNA (5-methylaminomethyl-2-thio...   115    1e-24  
gi|23099469|ref|NP_692935.1|  tRNA (5-methylaminomethyl-2-thio...   115    2e-24  
gi|25298369|pir||C84960  tRNA (5-methylaminomethyl-2-thiouridy...   114    2e-24
gi|113950832|ref|ZP_01436443.1|  tRNA (5-methylaminomethyl-2-t...   114    3e-24
gi|118075166|ref|ZP_01543306.1|  tRNA (5-methylaminomethyl-2-t...   114    3e-24
gi|53728682|ref|ZP_00131757.2|  COG0482: Predicted tRNA(5-meth...   114    3e-24
gi|68542146|ref|ZP_00581882.1|  tRNA (5-methylaminomethyl-2-th...   114    5e-24
gi|46907740|ref|YP_014129.1|  tRNA (5-methylaminomethyl-2-thio...   113    5e-24  
gi|47093434|ref|ZP_00231199.1|  tRNA (5-methylaminomethyl-2-th...   113    5e-24
gi|28897904|ref|NP_797509.1|  tRNA (5-methylaminomethyl-2-thio...   113    6e-24  
gi|32266455|ref|NP_860487.1|  tRNA (5-methylaminomethyl-2-thio...   113    6e-24  
gi|113461819|ref|YP_719888.1|  tRNA (5-methylaminomethyl-2-thi...   113    7e-24  
gi|77815825|ref|ZP_00815042.1|  tRNA (5-methylaminomethyl-2-th...   113    8e-24
gi|32130287|sp|Q87QL9|TRMU_VIBPA  Probable tRNA (5-methylamino...   112    8e-24
gi|89898460|ref|YP_515570.1|  tRNA/rRNA methyltransferase [Chl...   112    1e-23  
gi|91226036|ref|ZP_01260963.1|  tRNA (5-methylaminomethyl-2-th...   112    1e-23
gi|16800615|ref|NP_470883.1|  hypothetical protein lin1547 [Li...   112    1e-23  
gi|30022472|ref|NP_834103.1|  tRNA (5-methylaminomethyl-2-thio...   112    1e-23  
gi|73919895|sp|Q812R6|TRMU_BACCR  Probable tRNA (5-methylamino...   112    1e-23
gi|16803552|ref|NP_465037.1|  hypothetical protein lmo1512 [Li...   112    1e-23  
gi|68230476|ref|ZP_00569659.1|  tRNA (5-methylaminomethyl-2-th...   112    1e-23
gi|82743670|ref|ZP_00906302.1|  tRNA (5-methylaminomethyl-2-th...   112    1e-23
gi|42783525|ref|NP_980772.1|  tRNA (5-methylaminomethyl-2-thio...   112    2e-23  
gi|116872941|ref|YP_849722.1|  tRNA (5-methylaminomethyl-2-thi...   111    2e-23  
gi|75761642|ref|ZP_00741591.1|  tRNA (5-methylaminomethyl-2-th...   111    2e-23
gi|116747617|ref|YP_844304.1|  tRNA (5-methylaminomethyl-2-thi...   110    3e-23  
gi|84498222|ref|ZP_00997019.1|  tRNA (5-methylaminomethyl-2-th...   110    3e-23
gi|65321763|ref|ZP_00394722.1|  COG0482: Predicted tRNA(5-meth...   110    4e-23
gi|109946881|ref|YP_664109.1|  tRNA (5-methylaminomethyl-2-thi...   110    4e-23  
gi|30264466|ref|NP_846843.1|  tRNA (5-methylaminomethyl-2-thio...   110    4e-23  
gi|56460418|ref|YP_155699.1|  tRNA (5-methylaminomethyl-2-thio...   110    4e-23  
gi|47566584|ref|ZP_00237406.1|  tRNA (5-methylaminomethyl-2-th...   110    5e-23
gi|118418779|gb|ABK87198.1|  tRNA (5-methylaminomethyl-2-thiou...   110    5e-23
gi|114776442|ref|ZP_01451487.1|  tRNA (5-methylaminomethyl-2-t...   110    5e-23
gi|52081229|ref|YP_080020.1|  tRNA (5-methylaminomethyl-2-thio...   110    5e-23  
gi|116671273|ref|YP_832206.1|  tRNA (5-methylaminomethyl-2-thi...   110    5e-23  
gi|86742330|ref|YP_482730.1|  tRNA (5-methylaminomethyl-2-thio...   110    5e-23  
gi|37679527|ref|NP_934136.1|  tRNA (5-methylaminomethyl-2-thio...   110    6e-23  
gi|77360631|ref|YP_340206.1|  tRNA (5-methylaminomethyl-2-thio...   110    6e-23  
gi|15603201|ref|NP_246275.1|  tRNA (5-methylaminomethyl-2-thio...   110    6e-23  
gi|69244797|ref|ZP_00603021.1|  tRNA (5-methylaminomethyl-2-th...   110    6e-23
gi|27366203|ref|NP_761731.1|  tRNA (5-methylaminomethyl-2-thio...   110    7e-23  
gi|7442936|pir||G69978  probable ATPase yrrA - Bacillus subtilis    110    7e-23
gi|71368616|ref|ZP_00659108.1|  tRNA (5-methylaminomethyl-2-th...   109    7e-23
gi|50312295|ref|XP_456180.1|  unnamed protein product [Kluyver...   109    7e-23  
gi|113943010|ref|ZP_01428714.1|  tRNA (5-methylaminomethyl-2-t...   109    7e-23
gi|116184057|ref|ZP_01474010.1|  hypothetical protein VEx2w_02003   109    8e-23
gi|34395981|sp|O35020|TRMU_BACSU  Probable tRNA (5-methylamino...   109    8e-23
gi|33519851|ref|NP_878683.1|  tRNA (5-methylaminomethyl-2-thio...   109    8e-23  
gi|54308340|ref|YP_129360.1|  tRNA (5-methylaminomethyl-2-thio...   109    9e-23  
gi|53728867|ref|ZP_00134691.2|  COG0482: Predicted tRNA(5-meth...   109    9e-23
gi|50812273|ref|NP_390627.2|  tRNA (5-methylaminomethyl-2-thio...   109    9e-23  
gi|89206358|ref|ZP_01184918.1|  tRNA (5-methylaminomethyl-2-th...   109    1e-22
gi|89201369|ref|ZP_01180110.1|  tRNA (5-methylaminomethyl-2-th...   109    1e-22
gi|14195289|sp|Q9PKA7|TRMU_CHLMU  Probable tRNA (5-methylamino...   108    1e-22
gi|78368002|ref|ZP_00838257.1|  tRNA (5-methylaminomethyl-2-th...   108    1e-22
gi|12045151|ref|NP_072962.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|15835177|ref|NP_296936.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|71281561|ref|YP_269601.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|15829029|ref|NP_326389.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|72161001|ref|YP_288658.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|71892171|ref|YP_277903.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|15645948|ref|NP_208127.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|85712895|ref|ZP_01043936.1|  tRNA (5-methylaminomethyl-2-th...   108    2e-22
gi|116492933|ref|YP_804668.1|  Predicted tRNA(5-methylaminomet...   108    2e-22  
gi|84391736|ref|ZP_00991638.1|  tRNA (5-methylaminomethyl-2-th...   108    2e-22
gi|114563431|ref|YP_750944.1|  tRNA (5-methylaminomethyl-2-thi...   108    2e-22  
gi|76789009|ref|YP_328095.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|91793184|ref|YP_562835.1|  tRNA (5-methylaminomethyl-2-thio...   107    3e-22  
gi|83569546|ref|ZP_00920998.1|  COG0482: Predicted tRNA(5-meth...   107    3e-22
gi|16419753|gb|AAL20163.1|  tRNA (5-methylaminomethyl-2-thiour...   107    3e-22  
gi|73662449|ref|YP_301230.1|  putative tRNA methyltransferase ...   107    4e-22  
gi|15605008|ref|NP_219792.1|  tRNA (5-methylaminomethyl-2-thio...   107    4e-22  
gi|118440946|gb|EAV47573.1|  tRNA (5-methylaminomethyl-2-thiou...   107    4e-22
gi|39546313|ref|NP_460204.2|  tRNA (5-methylaminomethyl-2-thio...   107    4e-22  
gi|108563707|ref|YP_628023.1|  tRNA (5-methylaminomethyl-2-thi...   107    5e-22  
gi|62179755|ref|YP_216172.1|  tRNA (5-methylaminomethyl-2-thio...   107    5e-22  
gi|71658016|sp|Q5F7G4|TRMU_NEIG1  Probable tRNA (5-methylamino...   107    5e-22
gi|15677407|ref|NP_274563.1|  tRNA (5-methylaminomethyl-2-thio...   107    5e-22  
gi|59801573|ref|YP_208285.1|  tRNA (5-methylaminomethyl-2-thio...   107    5e-22  
gi|90413208|ref|ZP_01221203.1|  tRNA (5-methylaminomethyl-2-th...   107    6e-22
gi|89105578|ref|ZP_01178095.1|  COG0482: Predicted tRNA(5-meth...   107    6e-22
gi|15612319|ref|NP_223972.1|  tRNA (5-methylaminomethyl-2-thio...   106    6e-22  
gi|71658017|sp|Q57QC0|TRMU_SALCH  tRNA (5-methylaminomethyl-2-thi   106    6e-22
gi|90579124|ref|ZP_01234934.1|  tRNA (5-methylaminomethyl-2-th...   106    6e-22
gi|117673275|ref|ZP_01496333.1|  hypothetical protein YpseI_02...   106    7e-22
gi|77635911|ref|ZP_00797990.1|  COG0482: Predicted tRNA(5-meth...   106    7e-22
gi|111225218|ref|YP_716012.1|  tRNA (5-methylaminomethyl-2-thi...   106    7e-22  
gi|42630476|ref|ZP_00156015.1|  COG0482: Predicted tRNA(5-meth...   106    9e-22
gi|15613824|ref|NP_242127.1|  (5-methylaminomethyl-2-thiouridy...   106    9e-22  
gi|16121906|ref|NP_405219.1|  tRNA (5-methylaminomethyl-2-thio...   106    9e-22  
gi|46128960|ref|ZP_00154707.2|  COG0482: Predicted tRNA(5-meth...   105    1e-21
gi|89073381|ref|ZP_01159905.1|  tRNA (5-methylaminomethyl-2-th...   105    1e-21
gi|68248779|ref|YP_247891.1|  tRNA (5-methylaminomethyl-2-thio...   105    1e-21  
gi|8039809|sp|P44551|TRMU_HAEIN  Probable tRNA (5-methylaminom...   105    1e-21
gi|16272139|ref|NP_438342.1|  tRNA (5-methylaminomethyl-2-thio...   105    1e-21  
gi|113199419|ref|ZP_01410921.1|  hypothetical protein Cfetf_01...   105    1e-21
gi|33151616|ref|NP_872969.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|71735842|ref|YP_275272.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|27468222|ref|NP_764859.1|  (5-methylaminomethyl-2-thiouridy...   105    2e-21  
gi|16760109|ref|NP_455726.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|114846630|ref|ZP_01456966.1|  tRNA (5-methylaminomethyl-2-t...   105    2e-21
gi|88860122|ref|ZP_01134761.1|  tRNA (5-methylaminomethyl-2-th...   105    2e-21
gi|15801330|ref|NP_287347.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|82777256|ref|YP_403605.1|  hypothetical protein SDY_2019 [S...   105    2e-21  
gi|46579220|ref|YP_010028.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|75209213|ref|ZP_00709460.1|  COG0482: Predicted tRNA(5-meth...   105    2e-21
gi|38703944|ref|NP_309632.2|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|34498857|ref|NP_903072.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|26247381|ref|NP_753421.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|56421098|ref|YP_148416.1|  tRNA (5-methylaminomethyl-2-thio...   104    2e-21  
gi|86147101|ref|ZP_01065418.1|  tRNA (5-methylaminomethyl-2-th...   104    2e-21
gi|29348763|ref|NP_812266.1|  tRNA (5-methylaminomethyl-2-thio...   104    2e-21  
gi|24112552|ref|NP_707062.1|  tRNA (5-methylaminomethyl-2-thio...   104    2e-21  
gi|114793688|pdb|2DER|A  Chain A, Cocrystal Structure Of An Rn...   104    2e-21  
gi|30173414|sp|Q8CXZ8|TRMU_ECOL6  Probable tRNA (5-methylamino...   104    2e-21
gi|74311692|ref|YP_310111.1|  hypothetical protein SSO_1151 [S...   104    2e-21  
gi|110805161|ref|YP_688681.1|  hypothetical protein SFV_1168 [...   104    2e-21  
gi|68547819|ref|ZP_00587347.1|  tRNA (5-methylaminomethyl-2-th...   104    3e-21
gi|28870522|ref|NP_793141.1|  tRNA (5-methylaminomethyl-2-thio...   104    3e-21  
gi|75179245|ref|ZP_00699263.1|  COG0482: Predicted tRNA(5-meth...   104    3e-21
gi|75190219|ref|ZP_00703486.1|  COG0482: Predicted tRNA(5-meth...   104    3e-21
gi|82544380|ref|YP_408327.1|  hypothetical protein SBO_1906 [S...   104    3e-21  
gi|7442935|pir||B64858  probable ATPase ycfB - Escherichia coli (   104    3e-21
gi|91210289|ref|YP_540275.1|  probable ATPase YcfB [Escherichi...   104    3e-21  
gi|75239631|ref|ZP_00723598.1|  COG0482: Predicted tRNA(5-meth...   104    3e-21
gi|90961839|ref|YP_535755.1|  tRNA (5-methylaminomethyl-2-thio...   104    3e-21  
gi|118422629|gb|ABK89019.1|  tRNA(5-methylaminomethyl-2-thiour...   104    3e-21
gi|92911107|ref|ZP_01279881.1|  tRNA (5-methylaminomethyl-2-th...   104    3e-21
gi|29829295|ref|NP_823929.1|  tRNA (5-methylaminomethyl-2-thio...   104    3e-21  
gi|88855226|ref|ZP_01129891.1|  tRNA (5-methylaminomethyl-2-th...   104    4e-21
gi|15610161|ref|NP_217540.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|46447434|ref|YP_008799.1|  probable tRNA (5-methylaminometh...   103    4e-21  
gi|72080763|ref|YP_287821.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|27904738|ref|NP_777864.1|  putative tRNA (5-methylaminometh...   103    4e-21  
gi|115314034|ref|YP_762757.1|  tRNA (5-methylaminomethyl-2-thi...   103    4e-21  
gi|89255515|ref|YP_512876.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|56708687|ref|YP_170583.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|71658014|sp|Q5NEF9|TRMU_FRATT  Probable tRNA (5-methylamino...   103    4e-21
gi|92912343|ref|ZP_01280973.1|  tRNA (5-methylaminomethyl-2-th...   103    4e-21
gi|85059063|ref|YP_454765.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|77972866|ref|ZP_00828422.1|  COG0482: Predicted tRNA(5-meth...   103    4e-21
gi|77459818|ref|YP_349325.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|37526694|ref|NP_930038.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|15641141|ref|NP_230773.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|75817331|ref|ZP_00747783.1|  COG0482: Predicted tRNA(5-meth...   103    5e-21
gi|56419544|ref|YP_146862.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|66046419|ref|YP_236260.1|  tRNA (5-methylaminomethyl-2-thio...   103    6e-21  
gi|88195430|ref|YP_500234.1|  tRNA methyl transferase, putativ...   103    6e-21  
gi|87162110|ref|YP_494273.1|  tRNA (5-methylaminomethyl-2-thio...   103    6e-21  
gi|59712391|ref|YP_205167.1|  tRNA (5-methylaminomethyl-2-thio...   103    6e-21  
gi|118058474|ref|ZP_01526935.1|  tRNA (5-methylaminomethyl-2-t...   103    7e-21
gi|15924611|ref|NP_372145.1|  5-methylaminomethyl-2-thiouridyl...   103    7e-21  
gi|15927201|ref|NP_374734.1|  (5-methylaminomethyl-2-thiouridy...   103    7e-21  
gi|82751221|ref|YP_416962.1|  5-methylaminomethyl-2-thiouridyl...   103    7e-21  
gi|68056457|ref|ZP_00540576.1|  tRNA (5-methylaminomethyl-2-th...   103    7e-21
gi|53711506|ref|YP_097498.1|  tRNA (5-methylaminomethyl-2-thio...   103    8e-21  
gi|50365230|ref|YP_053655.1|  tRNA(5-methylaminomethyl-2-thiou...   103    8e-21  
gi|60679769|ref|YP_209913.1|  putative tRNA (5-methylaminometh...   103    8e-21  
gi|116216701|ref|ZP_01482538.1|  hypothetical protein VchoR_02...   103    8e-21
gi|70726299|ref|YP_253213.1|  tRNA(5-methylaminomethyl-2-thiou...   103    8e-21  
gi|94266357|ref|ZP_01290057.1|  tRNA (5-methylaminomethyl-2-th...   102    9e-21
gi|75511661|ref|ZP_00734308.1|  COG0482: Predicted tRNA(5-meth...   102    1e-20
gi|26990719|ref|NP_746144.1|  tRNA (5-methylaminomethyl-2-thio...   102    1e-20  
gi|116334036|ref|YP_795563.1|  Predicted tRNA(5-methylaminomet...   102    1e-20  
gi|116269364|ref|ZP_01493608.1|  tRNA (5-methylaminomethyl-2-t...   102    1e-20
gi|94263083|ref|ZP_01286902.1|  tRNA (5-methylaminomethyl-2-th...   102    1e-20
gi|71893779|ref|YP_279225.1|  tRNA (5-methylaminomethyl-2-thio...   102    1e-20  
gi|29349296|ref|NP_812799.1|  putative tRNA (5-methylaminometh...   102    1e-20  
gi|116629824|ref|YP_814996.1|  Predicted tRNA(5-methylaminomet...   102    1e-20  
gi|70731250|ref|YP_260991.1|  tRNA (5-methylaminomethyl-2-thio...   102    2e-20  
gi|15618353|ref|NP_224638.1|  tRNA (5-methylaminomethyl-2-thio...   102    2e-20  
gi|14195277|sp|Q9JTJ9|TRMU_NEIMA  Probable tRNA (5-methylamino...   101    2e-20
gi|54020202|ref|YP_115943.1|  tRNA (5-methylaminomethyl-2-thio...   101    2e-20  
gi|42518912|ref|NP_964842.1|  probable tRNA (5-methylaminometh...   101    2e-20  
gi|118068864|ref|ZP_01537114.1|  tRNA (5-methylaminomethyl-2-t...   101    2e-20
gi|15794637|ref|NP_284459.1|  tRNA (5-methylaminomethyl-2-thio...   101    2e-20  
gi|77963649|ref|ZP_00827457.1|  COG0482: Predicted tRNA(5-meth...   101    3e-20
gi|84326952|ref|ZP_00974976.1|  COG0482: Predicted tRNA(5-meth...   101    3e-20
gi|15597822|ref|NP_251316.1|  tRNA (5-methylaminomethyl-2-thio...   101    3e-20  
gi|114772808|ref|ZP_01450132.1|  tRNA (5-methylaminomethyl-2-t...   101    3e-20
gi|94413124|ref|ZP_01293015.1|  hypothetical protein PaerP_010...   101    3e-20
gi|82737595|ref|ZP_00900443.1|  tRNA (5-methylaminomethyl-2-th...   101    3e-20
gi|67155879|ref|ZP_00417506.1|  tRNA (5-methylaminomethyl-2-th...   100    3e-20
gi|77959452|ref|ZP_00823472.1|  COG0482: Predicted tRNA(5-meth...   100    3e-20
gi|19705225|ref|NP_602720.1|  tRNA (5-methylaminomethyl-2-thio...   100    3e-20  
gi|89890355|ref|ZP_01201865.1|  tRNA (5-methylaminomethyl-2-th...   100    3e-20
gi|83645146|ref|YP_433581.1|  tRNA (5-methylaminomethyl-2-thio...   100    4e-20  
gi|29376579|ref|NP_815733.1|  tRNA (5-methylaminomethyl-2-thio...   100    4e-20  
gi|52424356|ref|YP_087493.1|  tRNA (5-methylaminomethyl-2-thio...   100    4e-20  
gi|21283300|ref|NP_646388.1|  (5-methylaminomethyl-2-thiouridy...   100    4e-20  
gi|116494783|ref|YP_806517.1|  Predicted tRNA(5-methylaminomet...   100    4e-20  
gi|58337130|ref|YP_193715.1|  tRNA-methyltransferase [Lactobac...   100    5e-20  
gi|90408225|ref|ZP_01216392.1|  tRNA (5-methylaminomethyl-2-th...   100    6e-20
gi|56963351|ref|YP_175082.1|  tRNA (5-methylaminomethyl-2-thio...   100    6e-20  
gi|54294275|ref|YP_126690.1|  hypothetical protein lpl1340 [Le...  99.8    8e-20  
gi|62184976|ref|YP_219761.1|  tRNA (5-methylaminomethyl-2-thio...  99.8    8e-20  
gi|52841619|ref|YP_095418.1|  tRNA (5 methylaminomethyl-2-thio...  99.8    9e-20  
gi|91776467|ref|YP_546223.1|  tRNA (5-methylaminomethyl-2-thio...  99.4    1e-19  
gi|94311890|ref|YP_585100.1|  tRNA (5-methylaminomethyl-2-thio...  99.0    1e-19  
gi|34762114|ref|ZP_00143122.1|  tRNA (5-methylaminomethyl-2-th...  99.0    1e-19
gi|39938611|ref|NP_950377.1|  tRNA(5-methylaminomethyl-2-thiou...  99.0    1e-19  
gi|88796248|ref|ZP_01111926.1|  tRNA (5-methylaminomethyl-2-th...  98.6    2e-19
gi|21223845|ref|NP_629624.1|  tRNA (5-methylaminomethyl-2-thio...  98.6    2e-19  
gi|87122222|ref|ZP_01078105.1|  tRNA methyltransferase [Marino...  98.6    2e-19
gi|60683221|ref|YP_213365.1|  putative tRNA methyltransferase ...  98.6    2e-19  
gi|83746745|ref|ZP_00943793.1|  tRNA (5-methylaminomethyl-2-th...  98.2    2e-19
gi|90588832|ref|ZP_01244483.1|  tRNA (5-methylaminomethyl-2-th...  98.2    3e-19
gi|73542506|ref|YP_297026.1|  tRNA (5-methylaminomethyl-2-thio...  98.2    3e-19  
gi|53804157|ref|YP_114223.1|  tRNA (5-methylaminomethyl-2-thio...  97.8    3e-19  
gi|113869080|ref|YP_727569.1|  tRNA (5-methylaminomethyl-2-thi...  97.8    3e-19  
gi|116628661|ref|YP_821280.1|  Predicted tRNA(5-methylaminomet...  97.8    3e-19  
gi|53715285|ref|YP_101277.1|  putative tRNA (5-methylaminometh...  97.4    4e-19  
gi|75430208|ref|ZP_00732689.1|  tRNA (5-methylaminomethyl-2-th...  97.4    4e-19
gi|78485443|ref|YP_391368.1|  tRNA (5-methylaminomethyl-2-thio...  97.4    4e-19  
gi|69284520|ref|ZP_00616360.1|  tRNA (5-methylaminomethyl-2-th...  97.4    4e-19
gi|62425242|ref|ZP_00380378.1|  COG0482: Predicted tRNA(5-meth...  97.4    4e-19
gi|71894390|ref|YP_278498.1|  tRNA-(5-methylaminomethyl-2-thio...  97.4    5e-19  
gi|50556890|ref|XP_505853.1|  hypothetical protein [Yarrowia l...  97.1    5e-19  
gi|77980028|ref|ZP_00835443.1|  COG0482: Predicted tRNA(5-meth...  97.1    6e-19
gi|54297299|ref|YP_123668.1|  hypothetical protein lpp1344 [Le...  97.1    6e-19  
gi|95926280|ref|ZP_01309082.1|  hypothetical protein CburR_010019  96.7    6e-19
gi|78356066|ref|YP_387515.1|  tRNA (5-methylaminomethyl-2-thio...  96.7    7e-19  
gi|56475956|ref|YP_157545.1|  tRNA 5-methylaminomethyl-2-thiou...  96.7    8e-19  
gi|85057877|ref|YP_456793.1|  tRNA (5-methylaminomethyl-2-thio...  96.3    8e-19  
gi|104781327|ref|YP_607825.1|  tRNA (5-methylaminomethyl-2-thi...  96.3    8e-19  
gi|55821970|ref|YP_140412.1|  tRNA (5-methylaminomethyl-2-thio...  96.3    8e-19  
gi|17547442|ref|NP_520844.1|  tRNA (5-methylaminomethyl-2-thio...  95.9    1e-18  
gi|29654453|ref|NP_820145.1|  tRNA (5-methylaminomethyl-2-thio...  95.5    1e-18  
gi|94491900|ref|ZP_01299109.1|  hypothetical protein CburD_010...  95.5    1e-18
gi|106882895|ref|ZP_01350295.1|  tRNA (5-methylaminomethyl-2-t...  95.5    2e-18
gi|50121369|ref|YP_050536.1|  tRNA (5-methylaminomethyl-2-thio...  95.5    2e-18  
gi|110834136|ref|YP_692995.1|  tRNA (5-methylaminomethyl-2-thi...  95.1    2e-18  
gi|83319617|ref|YP_424495.1|  tRNA (5-methylaminomethyl-2-thio...  95.1    2e-18  
gi|31544324|ref|NP_852902.1|  TrmU [Mycoplasma gallisepticum R...  95.1    2e-18  
gi|109898694|ref|YP_661949.1|  tRNA (5-methylaminomethyl-2-thi...  94.7    2e-18  
gi|13357963|ref|NP_078237.1|  tRNA-(5-methylaminomethyl-2-thio...  94.7    3e-18  
gi|42560982|ref|NP_975433.1|  tRNA (5-methylaminomethyl-2-thio...  94.7    3e-18  
gi|34540110|ref|NP_904589.1|  tRNA (5-methylaminomethyl-2-thio...  94.7    3e-18  
gi|47459275|ref|YP_016137.1|  tRNA (5-methylaminomethyl-2-thio...  94.4    3e-18  
gi|88712370|ref|ZP_01106457.1|  tRNA (5-methylaminomethyl-2-th...  94.4    3e-18
gi|114332296|ref|YP_748518.1|  tRNA (5-methylaminomethyl-2-thi...  94.4    4e-18  
gi|32490853|ref|NP_871107.1|  hypothetical protein WGLp104 [Wi...  94.4    4e-18  
gi|84320594|ref|ZP_00968967.1|  COG0482: Predicted tRNA(5-meth...  94.0    4e-18
gi|77165505|ref|YP_344030.1|  tRNA (5-methylaminomethyl-2-thio...  93.6    6e-18  
gi|104773839|ref|YP_618819.1|  tRNA (5-methylaminomethyl-2-thi...  93.6    6e-18  
gi|94676746|ref|YP_588863.1|  tRNA (5-methylaminomethyl-2-thio...  93.2    7e-18  
gi|30248966|ref|NP_841036.1|  trmU; tRNA 5-methylaminomethyl-2...  93.2    7e-18  
gi|6320172|ref|NP_010251.1|  tRNA-specific 2-thiouridylase, re...  93.2    8e-18  
gi|21672533|ref|NP_660600.1|  tRNA (5-methylaminomethyl-2-thio...  92.8    9e-18  
gi|88798697|ref|ZP_01114280.1|  tRNA (5-methylaminomethyl-2-th...  92.8    9e-18
gi|116513846|ref|YP_812752.1|  Predicted tRNA(5-methylaminomet...  92.8    1e-17  
gi|28378785|ref|NP_785677.1|  tRNA (5-methylaminomethyl-2-thio...  92.8    1e-17  
gi|14195271|sp|Q9CHA1|TRMU_LACLA  Probable tRNA (5-methylamino...  92.4    1e-17
gi|88703376|ref|ZP_01101092.1|  tRNA (5-methylaminomethyl-2-th...  92.4    1e-17
gi|15672819|ref|NP_266993.1|  tRNA (5-methylaminomethyl-2-thio...  92.4    1e-17  
gi|84356799|ref|ZP_00981634.1|  COG0482: Predicted tRNA(5-meth...  92.4    1e-17
gi|86140336|ref|ZP_01058895.1|  tRNA (5-methylaminomethyl-2-th...  92.0    2e-17
gi|74316869|ref|YP_314609.1|  tRNA (5-methylaminomethyl-2-thio...  92.0    2e-17  
gi|28572507|ref|NP_789287.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|28493382|ref|NP_787543.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|115350645|ref|YP_772484.1|  tRNA (5-methylaminomethyl-2-thi...  91.7    2e-17  
gi|77952878|ref|ZP_00817290.1|  tRNA (5-methylaminomethyl-2-th...  91.7    2e-17
gi|15643286|ref|NP_228330.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|93005976|ref|YP_580413.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|81428407|ref|YP_395407.1|  tRNA(5-methylaminomethyl-2-thiou...  91.3    3e-17  
gi|13508161|ref|NP_110110.1|  TRNA (5-METHYLAMINOMETHYL-2-THIO...  91.3    3e-17  
gi|71908904|ref|YP_286491.1|  tRNA (5-methylaminomethyl-2-thio...  91.3    3e-17  
gi|45190520|ref|NP_984774.1|  AEL087Cp [Eremothecium gossypii]...  90.9    3e-17  
gi|68482055|ref|XP_715045.1|  hypothetical protein CaO19.7245 ...  90.9    3e-17 


gi|71083529|ref|YP_266248.1|  tRNA (5-methylaminomethyl-2-thio...   315    1e-84  
gi|118433757|gb|EAV40418.1|  tRNA (5-methylaminomethyl-2-thiou...   237    4e-61
gi|83942322|ref|ZP_00954783.1|  tRNA (5-methylaminomethyl-2-th...   228    1e-58
gi|83953541|ref|ZP_00962262.1|  tRNA (5-methylaminomethyl-2-th...   228    1e-58
gi|84500833|ref|ZP_00999068.1|  tRNA (5-methylaminomethyl-2-th...   226    4e-58
gi|114569244|ref|YP_755924.1|  tRNA (5-methylaminomethyl-2-thi...   225    1e-57  
gi|84516171|ref|ZP_01003531.1|  tRNA (5-methylaminomethyl-2-th...   224    2e-57
gi|114768812|ref|ZP_01446438.1|  tRNA (5-methylaminomethyl-2-t...   223    7e-57
gi|110679829|ref|YP_682836.1|  tRNA (5-methylaminomethyl-2-thi...   222    8e-57  
gi|99081242|ref|YP_613396.1|  tRNA (5-methylaminomethyl-2-thio...   221    2e-56  
gi|114766932|ref|ZP_01445852.1|  tRNA (5-methylaminomethyl-2-t...   220    3e-56
gi|89069527|ref|ZP_01156871.1|  tRNA (5-methylaminomethyl-2-th...   220    4e-56
gi|84686908|ref|ZP_01014792.1|  tRNA (5-methylaminomethyl-2-th...   218    1e-55
gi|23502454|ref|NP_698581.1|  tRNA (5-methylaminomethyl-2-thio...   218    2e-55  
gi|83859630|ref|ZP_00953150.1|  tRNA (5-methylaminomethyl-2-th...   218    2e-55
gi|85702766|ref|ZP_01033870.1|  tRNA (5-methylaminomethyl-2-th...   217    3e-55
gi|56696559|ref|YP_166916.1|  tRNA (5-methylaminomethyl-2-thio...   216    5e-55  
gi|83951896|ref|ZP_00960628.1|  tRNA (5-methylaminomethyl-2-th...   216    6e-55
gi|17986711|ref|NP_539345.1|  tRNA (5-methylaminomethyl-2-thio...   216    7e-55  
gi|39934381|ref|NP_946657.1|  tRNA (5-methylaminomethyl-2-thio...   215    1e-54  
gi|85713551|ref|ZP_01044541.1|  tRNA (5-methylaminomethyl-2-th...   215    1e-54
gi|86751223|ref|YP_487719.1|  tRNA (5-methylaminomethyl-2-thio...   214    2e-54  
gi|15891245|ref|NP_356917.1|  tRNA (5-methylaminomethyl-2-thio...   214    2e-54  
gi|24638313|sp|Q8U9M5|TRMU_AGRT5  Probable tRNA (5-methylamino...   214    2e-54
gi|17937408|ref|NP_534197.1|  tRNA (5-methylaminomethyl-2-thio...   214    2e-54  
gi|91978423|ref|YP_571082.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|75674801|ref|YP_317222.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|15966466|ref|NP_386819.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|92116313|ref|YP_576042.1|  tRNA (5-methylaminomethyl-2-thio...   213    4e-54  
gi|113872455|ref|ZP_01412584.1|  tRNA (5-methylaminomethyl-2-t...   213    4e-54
gi|110634566|ref|YP_674774.1|  tRNA (5-methylaminomethyl-2-thi...   213    4e-54  
gi|56551665|ref|YP_162504.1|  tRNA (5-methylaminomethyl-2-thio...   213    5e-54  
gi|24638328|sp|Q98HL0|TRMU_RHILO  Probable tRNA (5-methylamino...   213    7e-54
gi|13472503|ref|NP_104070.1|  tRNA (5-methylaminomethyl-2-thio...   213    7e-54  
gi|86138410|ref|ZP_01056984.1|  tRNA (5-methylaminomethyl-2-th...   213    7e-54
gi|83751595|ref|ZP_00948008.1|  COG0482: Predicted tRNA(5-meth...   212    1e-53
gi|89054998|ref|YP_510449.1|  tRNA (5-methylaminomethyl-2-thio...   211    2e-53  
gi|69933484|ref|ZP_00628686.1|  tRNA (5-methylaminomethyl-2-th...   211    3e-53
gi|115523063|ref|YP_779974.1|  tRNA (5-methylaminomethyl-2-thi...   211    3e-53  
gi|84704099|ref|ZP_01017927.1|  tRNA (5-methylaminomethyl-2-th...   211    3e-53
gi|90419040|ref|ZP_01226951.1|  tRNA methyl transferase ((5-me...   210    3e-53
gi|116253697|ref|YP_769535.1|  putative tRNA (5-methylaminomet...   209    8e-53  
gi|90422506|ref|YP_530876.1|  tRNA (5-methylaminomethyl-2-thio...   209    1e-52  
gi|94498089|ref|ZP_01304652.1|  tRNA (5-methylaminomethyl-2-th...   207    2e-52
gi|58698498|ref|ZP_00373403.1|  tRNA (5-methylaminomethyl-2-th...   207    2e-52
gi|103487513|ref|YP_617074.1|  tRNA (5-methylaminomethyl-2-thi...   207    3e-52  
gi|78693408|ref|ZP_00857922.1|  tRNA (5-methylaminomethyl-2-th...   207    3e-52
gi|86359043|ref|YP_470935.1|  tRNA 5-methylaminomethyl-2-thiou...   207    3e-52  
gi|16125150|ref|NP_419714.1|  tRNA (5-methylaminomethyl-2-thio...   206    8e-52  
gi|27382106|ref|NP_773635.1|  tRNA (5-methylaminomethyl-2-thio...   206    9e-52  
gi|49474501|ref|YP_032543.1|  tRNA (5-methylaminomethyl-2-thio...   205    1e-51  
gi|114706635|ref|ZP_01439536.1|  tRNA (5-methylaminomethyl-2-t...   204    2e-51
gi|15892333|ref|NP_360047.1|  tRNA (5-methylaminomethyl-2-thio...   204    3e-51  
gi|67458888|ref|YP_246512.1|  tRNA (5-methylaminomethyl-2-thio...   204    3e-51  
gi|99035878|ref|ZP_01314930.1|  hypothetical protein Wendoof_0...   203    4e-51
gi|42521055|ref|NP_966970.1|  tRNA (5-methylaminomethyl-2-thio...   203    4e-51  
gi|34580653|ref|ZP_00142133.1|  tRNA (5-methylaminomethyl-2-th...   203    4e-51
gi|89361379|ref|ZP_01199194.1|  tRNA (5-methylaminomethyl-2-th...   203    4e-51
gi|53731980|ref|ZP_00153456.2|  COG0482: Predicted tRNA(5-meth...   203    5e-51
gi|83368057|ref|ZP_00912922.1|  tRNA (5-methylaminomethyl-2-th...   203    5e-51
gi|102191989|ref|ZP_01347801.1|  hypothetical protein RcanM_01...   202    7e-51
gi|49475921|ref|YP_033962.1|  tRNA (5-methylaminomethyl-2-thio...   202    1e-50  
gi|88608438|ref|YP_506353.1|  tRNA (5-methylaminomethyl-2-thio...   201    1e-50  
gi|77463173|ref|YP_352677.1|  tRNA (5-methylaminomethyl-2-thio...   201    2e-50  
gi|114798727|ref|YP_759370.1|  tRNA (5-methylaminomethyl-2-thi...   201    2e-50  
gi|23012016|ref|ZP_00052207.1|  COG0482: Predicted tRNA(5-meth...   201    3e-50
gi|91205346|ref|YP_537701.1|  tRNA (5-methylaminomethyl-2-thio...   200    3e-50  
gi|83373958|ref|ZP_00918734.1|  tRNA (5-methylaminomethyl-2-th...   200    3e-50
gi|56416599|ref|YP_153673.1|  tRNA (5-methylaminomethyl-2-thio...   200    4e-50  
gi|52698722|ref|ZP_00340130.1|  COG0482: Predicted tRNA(5-meth...   199    6e-50
gi|113935682|ref|ZP_01421579.1|  tRNA (5-methylaminomethyl-2-t...   199    8e-50
gi|15604175|ref|NP_220690.1|  tRNA (5-methylaminomethyl-2-thio...   199    1e-49  
gi|51473501|ref|YP_067258.1|  tRNA (5-methylaminomethyl-2-thio...   198    1e-49  
gi|58584415|ref|YP_197988.1|  Predicted tRNA(5-methylaminometh...   198    1e-49  
gi|83593359|ref|YP_427111.1|  tRNA (5-methylaminomethyl-2-thio...   197    3e-49  
gi|57238956|ref|YP_180092.1|  tRNA (5-methylaminomethyl-2-thio...   194    2e-48  
gi|58616948|ref|YP_196147.1|  Probable tRNA (5-methylaminometh...   192    6e-48  
gi|68171265|ref|ZP_00544667.1|  tRNA (5-methylaminomethyl-2-th...   191    2e-47
gi|73666857|ref|YP_302873.1|  tRNA(5-methylaminomethyl-2-thiou...   190    4e-47  
gi|88607883|ref|YP_505483.1|  tRNA (5-methylaminomethyl-2-thio...   189    1e-46  
gi|83312118|ref|YP_422382.1|  Predicted tRNA(5-methylaminometh...   185    1e-45  
gi|110808325|gb|ABG91067.1|  tRNA (5-methylaminomethyl-2-thiou...   183    5e-45
gi|46202527|ref|ZP_00053063.2|  COG0482: Predicted tRNA(5-meth...   182    9e-45
gi|87198069|ref|YP_495326.1|  tRNA (5-methylaminomethyl-2-thio...   181    2e-44  
gi|88938014|ref|ZP_01143533.1|  tRNA (5-methylaminomethyl-2-th...   181    3e-44
gi|85709728|ref|ZP_01040793.1|  tRNA (5-methylaminomethyl-2-th...   179    6e-44
gi|78222093|ref|YP_383840.1|  tRNA (5-methylaminomethyl-2-thio...   169    7e-41  
gi|85375520|ref|YP_459582.1|  tRNA (5-methylaminomethyl-2-thio...   169    1e-40  
gi|117924260|ref|YP_864877.1|  tRNA (5-methylaminomethyl-2-thi...   168    2e-40  
gi|110600609|ref|ZP_01388825.1|  tRNA (5-methylaminomethyl-2-t...   167    3e-40
gi|77919454|ref|YP_357269.1|  tRNA (5-methylaminomethyl-2-thio...   166    6e-40  
gi|58039815|ref|YP_191779.1|  tRNA (5-methylaminomethyl-2-thio...   166    7e-40  
gi|94969297|ref|YP_591345.1|  tRNA (5-methylaminomethyl-2-thio...   161    2e-38  
gi|41152729|gb|AAR35942.2|  tRNA (5-methylaminomethyl-2-thiour...   160    4e-38
gi|39997664|ref|NP_953615.1|  tRNA (5-methylaminomethyl-2-thio...   160    4e-38  
gi|23126446|ref|ZP_00108340.1|  COG0482: Predicted tRNA(5-meth...   158    1e-37
gi|116619734|ref|YP_821890.1|  tRNA (5-methylaminomethyl-2-thi...   157    4e-37  
gi|95930240|ref|ZP_01312978.1|  tRNA (5-methylaminomethyl-2-th...   157    4e-37
gi|67922387|ref|ZP_00515898.1|  tRNA (5-methylaminomethyl-2-th...   156    8e-37
gi|27262188|gb|AAN87375.1|  tRNA (5-methylaminomethyl-2-thiour...   155    9e-37
gi|21674668|ref|NP_662733.1|  tRNA (5-methylaminomethyl-2-thio...   155    1e-36  
gi|87306814|ref|ZP_01088960.1|  tRNA (5-methylaminomethyl-2-th...   154    2e-36
gi|78188235|ref|YP_378573.1|  tRNA (5-methylaminomethyl-2-thio...   154    2e-36  
gi|78043170|ref|YP_361010.1|  tRNA (5-methylaminomethyl-2-thio...   154    3e-36  
gi|109645516|ref|ZP_01369436.1|  tRNA (5-methylaminomethyl-2-t...   154    4e-36
gi|17228854|ref|NP_485402.1|  tRNA (5-methylaminomethyl-2-thio...   152    1e-35  
gi|20807693|ref|NP_622864.1|  predicted tRNA(5-methylaminometh...   152    1e-35  
gi|75910268|ref|YP_324564.1|  tRNA (5-methylaminomethyl-2-thio...   151    2e-35  
gi|67935858|ref|ZP_00528875.1|  tRNA (5-methylaminomethyl-2-th...   150    3e-35
gi|16330399|ref|NP_441127.1|  tRNA (5-methylaminomethyl-2-thio...   149    6e-35  
gi|114844534|ref|ZP_01454980.1|  tRNA (5-methylaminomethyl-2-t...   149    8e-35
gi|76796111|ref|ZP_00778479.1|  tRNA (5-methylaminomethyl-2-th...   149    8e-35
gi|20808819|ref|NP_623990.1|  predicted tRNA(5-methylaminometh...   149    1e-34  
gi|113940343|ref|ZP_01426179.1|  tRNA (5-methylaminomethyl-2-t...   149    1e-34
gi|89895170|ref|YP_518657.1|  hypothetical protein DSY2424 [De...   148    1e-34  
gi|51893527|ref|YP_076218.1|  tRNA (5-methylaminomethyl-2-thio...   147    2e-34  
gi|118061686|ref|ZP_01530040.1|  tRNA (5-methylaminomethyl-2-t...   147    3e-34
gi|67916377|ref|ZP_00510090.1|  tRNA (5-methylaminomethyl-2-th...   147    4e-34
gi|85860139|ref|YP_462341.1|  tRNA (5-methylaminomethyl-2-thio...   146    6e-34  
gi|110802009|ref|YP_699068.1|  tRNA (5-methylaminomethyl-2-thi...   146    7e-34  
gi|91203955|emb|CAJ71608.1|  conserved hypothetical protein [C...   146    7e-34
gi|18310765|ref|NP_562699.1|  tRNA (5-methylaminomethyl-2-thio...   146    8e-34  
gi|110596963|ref|ZP_01385253.1|  tRNA (5-methylaminomethyl-2-t...   146    8e-34
gi|110801338|ref|YP_696468.1|  tRNA (5-methylaminomethyl-2-thi...   145    1e-33  
gi|106888931|ref|ZP_01356131.1|  tRNA (5-methylaminomethyl-2-t...   145    1e-33
gi|78776909|ref|YP_393224.1|  tRNA (5-methylaminomethyl-2-thio...   144    2e-33  
gi|28211134|ref|NP_782078.1|  tRNA (5-methylaminomethyl-2-thio...   144    2e-33  
gi|83590486|ref|YP_430495.1|  tRNA (5-methylaminomethyl-2-thio...   144    3e-33  
gi|22299799|ref|NP_683046.1|  tRNA (5-methylaminomethyl-2-thio...   143    4e-33  
gi|82500377|ref|ZP_00885794.1|  tRNA (5-methylaminomethyl-2-th...   143    5e-33
gi|56752503|ref|YP_173204.1|  tRNA (5-methylaminomethyl-2-thio...   143    6e-33  
gi|114566016|ref|YP_753170.1|  tRNA (5-methylaminomethyl-2-thi...   143    6e-33  
gi|116328677|ref|YP_798397.1|  tRNA (5-methylaminomethyl-2-thi...   142    1e-32  
gi|108804192|ref|YP_644129.1|  tRNA (5-methylaminomethyl-2-thi...   142    1e-32  
gi|113474569|ref|YP_720630.1|  tRNA (5-methylaminomethyl-2-thi...   141    2e-32  
gi|28210754|ref|NP_781698.1|  tRNA (5-methylaminomethyl-2-thio...   140    3e-32  
gi|67918358|ref|ZP_00511957.1|  tRNA (5-methylaminomethyl-2-th...   140    3e-32
gi|72382697|ref|YP_292052.1|  tRNA (5-methylaminomethyl-2-thio...   140    4e-32  
gi|89211872|ref|ZP_01190199.1|  tRNA (5-methylaminomethyl-2-th...   140    5e-32
gi|71837111|ref|ZP_00676877.1|  tRNA (5-methylaminomethyl-2-th...   140    5e-32
gi|78779771|ref|YP_397883.1|  tRNA (5-methylaminomethyl-2-thio...   139    7e-32  
gi|88939835|ref|ZP_01145280.1|  tRNA (5-methylaminomethyl-2-th...   139    8e-32
gi|115250315|emb|CAJ68137.1|  putative tRNA (5-methylaminometh...   139    8e-32
gi|67938352|ref|ZP_00530879.1|  tRNA (5-methylaminomethyl-2-th...   139    1e-31
gi|37520120|ref|NP_923497.1|  tRNA (5-methylaminomethyl-2-thio...   139    1e-31  
gi|108756833|ref|YP_631693.1|  tRNA (5-methylaminomethyl-2-thi...   139    1e-31  
gi|71481145|ref|ZP_00660853.1|  tRNA (5-methylaminomethyl-2-th...   139    1e-31
gi|68548735|ref|ZP_00588204.1|  tRNA (5-methylaminomethyl-2-th...   139    1e-31
gi|33240814|ref|NP_875756.1|  tRNA (5-methylaminomethyl-2-thio...   139    1e-31  
gi|57241962|ref|ZP_00369902.1|  tRNA (5-methylaminomethyl-2-th...   138    1e-31
gi|86604778|ref|YP_473541.1|  tRNA (5-methylaminomethyl-2-thio...   137    3e-31  
gi|82748256|ref|ZP_00910743.1|  tRNA (5-methylaminomethyl-2-th...   137    4e-31
gi|86608667|ref|YP_477429.1|  tRNA (5-methylaminomethyl-2-thio...   136    8e-31  
gi|109690828|ref|ZP_01377899.1|  hypothetical protein Cjejd_01...   136    8e-31
gi|78186206|ref|YP_374249.1|  tRNA (5-methylaminomethyl-2-thio...   135    9e-31  
gi|68536405|ref|YP_251110.1|  tRNA (5-methylaminomethyl-2-thio...   135    1e-30  
gi|15895501|ref|NP_348850.1|  tRNA (5-methylaminomethyl-2-thio...   135    2e-30  
gi|84517594|ref|ZP_01004943.1|  tRNA (5-methylaminomethyl-2-th...   135    2e-30
gi|78212421|ref|YP_381200.1|  tRNA (5-methylaminomethyl-2-thio...   134    2e-30  
gi|33862617|ref|NP_894177.1|  tRNA (5-methylaminomethyl-2-thio...   134    2e-30  
gi|76259215|ref|ZP_00766866.1|  tRNA (5-methylaminomethyl-2-th...   134    3e-30
gi|118047413|ref|ZP_01516050.1|  tRNA (5-methylaminomethyl-2-t...   134    3e-30
gi|87306121|ref|ZP_01088273.1|  tRNA (5-methylaminomethyl-2-th...   134    3e-30
gi|57169043|ref|ZP_00368171.1|  tRNA (5-methylaminomethyl-2-th...   134    3e-30
gi|45658118|ref|YP_002204.1|  tRNA (5-methylaminomethyl-2-thio...   133    6e-30  
gi|94986647|ref|YP_594580.1|  predicted tRNA(5-methylaminometh...   133    7e-30  
gi|41409155|ref|NP_961991.1|  tRNA (5-methylaminomethyl-2-thio...   133    7e-30  
gi|73920128|sp|Q72Q44|TRMU_LEPIC  Probable tRNA (5-methylamino...   132    7e-30
gi|15791445|ref|NP_281268.1|  tRNA (5-methylaminomethyl-2-thio...   132    8e-30  
gi|24214187|ref|NP_711668.1|  Probable tRNA (5-methylaminometh...   132    9e-30  
gi|116073367|ref|ZP_01470629.1|  tRNA (5-methylaminomethyl-2-t...   132    9e-30
gi|33861847|ref|NP_893408.1|  tRNA (5-methylaminomethyl-2-thio...   132    1e-29  
gi|88946318|ref|ZP_01149399.1|  tRNA (5-methylaminomethyl-2-th...   131    3e-29
gi|15606458|ref|NP_213838.1|  hypothetical protein aq_1224 [Aq...   130    4e-29  
gi|118135103|gb|ABK62147.1|  tRNA (5-methylaminomethyl-2-thiou...   130    5e-29
gi|19704100|ref|NP_603662.1|  tRNA (5-methylaminomethyl-2-thio...   130    5e-29  
gi|78185088|ref|YP_377523.1|  tRNA (5-methylaminomethyl-2-thio...   130    5e-29  
gi|88809139|ref|ZP_01124648.1|  tRNA (5-methylaminomethyl-2-th...   130    6e-29
gi|109673713|ref|ZP_01375887.1|  hypothetical protein Ccur5_01...   130    6e-29
gi|118168513|gb|ABK69410.1|  tRNA (5-methylaminomethyl-2-thiou...   129    7e-29
gi|34763143|ref|ZP_00144111.1|  tRNA (5-methylaminomethyl-2-th...   129    7e-29
gi|32474336|ref|NP_867330.1|  tRNA (5-methylaminomethyl-2-thio...   129    9e-29  
gi|19552461|ref|NP_600463.1|  tRNA (5-methylaminomethyl-2-thio...   129    1e-28  
gi|42526204|ref|NP_971302.1|  tRNA (5-methylaminomethyl-2-thio...   129    1e-28  
gi|33866156|ref|NP_897715.1|  tRNA (5-methylaminomethyl-2-thio...   128    2e-28  
gi|116072337|ref|ZP_01469604.1|  tRNA (5-methylaminomethyl-2-t...   128    2e-28
gi|87301094|ref|ZP_01083935.1|  tRNA (5-methylaminomethyl-2-th...   127    3e-28
gi|68551564|ref|ZP_00590959.1|  tRNA (5-methylaminomethyl-2-th...   127    5e-28
gi|57240773|ref|ZP_00368721.1|  tRNA (5-methylaminomethyl-2-th...   126    8e-28
gi|85860332|ref|YP_462534.1|  tRNA (5-methylaminomethyl-2-thio...   126    8e-28  
gi|34557952|ref|NP_907767.1|  tRNA (5-methylaminomethyl-2-thio...   125    1e-27  
gi|114047179|ref|YP_737729.1|  tRNA (5-methylaminomethyl-2-thi...   125    2e-27  
gi|83816248|ref|YP_446592.1|  tRNA (5-methylaminomethyl-2-thio...   124    2e-27  
gi|86157907|ref|YP_464692.1|  tRNA (5-methylaminomethyl-2-thio...   124    4e-27  
gi|98661041|dbj|GAA01827.1|  unnamed protein product [Pelotomacul   124    5e-27
gi|46200029|ref|YP_005696.1|  tRNA (5-methylaminomethyl-2-thio...   123    5e-27  
gi|57234425|ref|YP_181511.1|  tRNA (5-methylaminomethyl-2-thio...   123    6e-27  
gi|88933517|ref|ZP_01139192.1|  tRNA (5-methylaminomethyl-2-th...   123    7e-27
gi|110638005|ref|YP_678212.1|  tRNA (5-methylaminomethyl-2-thi...   123    7e-27  
gi|73748589|ref|YP_307828.1|  tRNA(5-methylaminomethyl-2-thiou...   122    9e-27  
gi|113953824|ref|YP_729973.1|  tRNA (5-methylaminomethyl-2-thi...   122    9e-27  
gi|113969944|ref|YP_733737.1|  tRNA (5-methylaminomethyl-2-thi...   122    1e-26  
gi|50842596|ref|YP_055823.1|  tRNA (5-methylaminomethyl-2-thio...   122    1e-26  
gi|87125503|ref|ZP_01081348.1|  tRNA (5-methylaminomethyl-2-th...   122    1e-26
gi|110005181|emb|CAK99508.1|  probable trna 5-methylaminomethy...   122    1e-26
gi|25027890|ref|NP_737944.1|  tRNA (5-methylaminomethyl-2-thio...   122    2e-26  
gi|24374174|ref|NP_718217.1|  tRNA (5-methylaminomethyl-2-thio...   121    2e-26  
gi|117920194|ref|YP_869386.1|  tRNA (5-methylaminomethyl-2-thi...   121    3e-26  
gi|51246807|ref|YP_066691.1|  tRNA (5-methylaminomethyl-2-thio...   121    3e-26  
gi|118055683|ref|ZP_01524186.1|  tRNA (5-methylaminomethyl-2-t...   120    4e-26
gi|94984899|ref|YP_604263.1|  tRNA (5-methylaminomethyl-2-thio...   120    4e-26  
gi|54026238|ref|YP_120480.1|  tRNA (5-methylaminomethyl-2-thio...   120    6e-26  
gi|109671104|ref|ZP_01373374.1|  hypothetical protein Ccon1_01...   120    6e-26
gi|42523417|ref|NP_968797.1|  tRNA-methyltransferase [Bdellovi...   119    7e-26  
gi|118174880|gb|ABK75776.1|  tRNA (5-methylaminomethyl-2-thiou...   119    7e-26
gi|112799930|gb|EAT97274.1|  tRNA (5-methylaminomethyl-2-thiou...   119    7e-26
gi|117927897|ref|YP_872448.1|  tRNA (5-methylaminomethyl-2-thi...   119    9e-26  
gi|111023428|ref|YP_706400.1|  tRNA (5-methylaminomethyl-2-thi...   119    9e-26  
gi|89337964|ref|ZP_01190742.1|  tRNA (5-methylaminomethyl-2-th...   119    1e-25
gi|89100972|ref|ZP_01173817.1|  TrmU [Bacillus sp. NRRL B-1491...   118    2e-25
gi|15827913|ref|NP_302176.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|15806762|ref|NP_295482.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|14195297|sp|Q9RTK1|TRMU_DEIRA  Probable tRNA (5-methylamino...   117    3e-25
gi|15595027|ref|NP_212816.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|38233668|ref|NP_939435.1|  tRNA (5-methylaminomethyl-2-thio...   117    3e-25  
gi|111115515|ref|YP_710133.1|  hypothetical protein BAPKO_0726...   117    4e-25  
gi|90203532|ref|ZP_01206177.1|  tRNA (5-methylaminomethyl-2-th...   117    4e-25
gi|51598937|ref|YP_073125.1|  tRNA (5-methylaminomethyl-2-thio...   117    5e-25  
gi|117617943|ref|YP_855954.1|  tRNA (5-methylaminomethyl-2-thi...   116    7e-25  
gi|28952048|ref|NP_240085.2|  tRNA (5-methylaminomethyl-2-thio...   115    1e-24  
gi|29840118|ref|NP_829224.1|  tRNA (5-methylaminomethyl-2-thio...   115    1e-24  
gi|23099469|ref|NP_692935.1|  tRNA (5-methylaminomethyl-2-thio...   115    2e-24  
gi|25298369|pir||C84960  tRNA (5-methylaminomethyl-2-thiouridy...   114    2e-24
gi|113950832|ref|ZP_01436443.1|  tRNA (5-methylaminomethyl-2-t...   114    3e-24
gi|118075166|ref|ZP_01543306.1|  tRNA (5-methylaminomethyl-2-t...   114    3e-24
gi|53728682|ref|ZP_00131757.2|  COG0482: Predicted tRNA(5-meth...   114    3e-24
gi|68542146|ref|ZP_00581882.1|  tRNA (5-methylaminomethyl-2-th...   114    5e-24
gi|46907740|ref|YP_014129.1|  tRNA (5-methylaminomethyl-2-thio...   113    5e-24  
gi|47093434|ref|ZP_00231199.1|  tRNA (5-methylaminomethyl-2-th...   113    5e-24
gi|28897904|ref|NP_797509.1|  tRNA (5-methylaminomethyl-2-thio...   113    6e-24  
gi|32266455|ref|NP_860487.1|  tRNA (5-methylaminomethyl-2-thio...   113    6e-24  
gi|113461819|ref|YP_719888.1|  tRNA (5-methylaminomethyl-2-thi...   113    7e-24  
gi|77815825|ref|ZP_00815042.1|  tRNA (5-methylaminomethyl-2-th...   113    8e-24
gi|32130287|sp|Q87QL9|TRMU_VIBPA  Probable tRNA (5-methylamino...   112    8e-24
gi|89898460|ref|YP_515570.1|  tRNA/rRNA methyltransferase [Chl...   112    1e-23  
gi|91226036|ref|ZP_01260963.1|  tRNA (5-methylaminomethyl-2-th...   112    1e-23
gi|16800615|ref|NP_470883.1|  hypothetical protein lin1547 [Li...   112    1e-23  
gi|30022472|ref|NP_834103.1|  tRNA (5-methylaminomethyl-2-thio...   112    1e-23  
gi|73919895|sp|Q812R6|TRMU_BACCR  Probable tRNA (5-methylamino...   112    1e-23
gi|16803552|ref|NP_465037.1|  hypothetical protein lmo1512 [Li...   112    1e-23  
gi|68230476|ref|ZP_00569659.1|  tRNA (5-methylaminomethyl-2-th...   112    1e-23
gi|82743670|ref|ZP_00906302.1|  tRNA (5-methylaminomethyl-2-th...   112    1e-23
gi|42783525|ref|NP_980772.1|  tRNA (5-methylaminomethyl-2-thio...   112    2e-23  
gi|116872941|ref|YP_849722.1|  tRNA (5-methylaminomethyl-2-thi...   111    2e-23  
gi|75761642|ref|ZP_00741591.1|  tRNA (5-methylaminomethyl-2-th...   111    2e-23
gi|116747617|ref|YP_844304.1|  tRNA (5-methylaminomethyl-2-thi...   110    3e-23  
gi|84498222|ref|ZP_00997019.1|  tRNA (5-methylaminomethyl-2-th...   110    3e-23
gi|65321763|ref|ZP_00394722.1|  COG0482: Predicted tRNA(5-meth...   110    4e-23
gi|109946881|ref|YP_664109.1|  tRNA (5-methylaminomethyl-2-thi...   110    4e-23  
gi|30264466|ref|NP_846843.1|  tRNA (5-methylaminomethyl-2-thio...   110    4e-23  
gi|56460418|ref|YP_155699.1|  tRNA (5-methylaminomethyl-2-thio...   110    4e-23  
gi|47566584|ref|ZP_00237406.1|  tRNA (5-methylaminomethyl-2-th...   110    5e-23
gi|118418779|gb|ABK87198.1|  tRNA (5-methylaminomethyl-2-thiou...   110    5e-23
gi|114776442|ref|ZP_01451487.1|  tRNA (5-methylaminomethyl-2-t...   110    5e-23
gi|52081229|ref|YP_080020.1|  tRNA (5-methylaminomethyl-2-thio...   110    5e-23  
gi|116671273|ref|YP_832206.1|  tRNA (5-methylaminomethyl-2-thi...   110    5e-23  
gi|86742330|ref|YP_482730.1|  tRNA (5-methylaminomethyl-2-thio...   110    5e-23  
gi|37679527|ref|NP_934136.1|  tRNA (5-methylaminomethyl-2-thio...   110    6e-23  
gi|77360631|ref|YP_340206.1|  tRNA (5-methylaminomethyl-2-thio...   110    6e-23  
gi|15603201|ref|NP_246275.1|  tRNA (5-methylaminomethyl-2-thio...   110    6e-23  
gi|69244797|ref|ZP_00603021.1|  tRNA (5-methylaminomethyl-2-th...   110    6e-23
gi|27366203|ref|NP_761731.1|  tRNA (5-methylaminomethyl-2-thio...   110    7e-23  
gi|7442936|pir||G69978  probable ATPase yrrA - Bacillus subtilis    110    7e-23
gi|71368616|ref|ZP_00659108.1|  tRNA (5-methylaminomethyl-2-th...   109    7e-23
gi|50312295|ref|XP_456180.1|  unnamed protein product [Kluyver...   109    7e-23  
gi|113943010|ref|ZP_01428714.1|  tRNA (5-methylaminomethyl-2-t...   109    7e-23
gi|116184057|ref|ZP_01474010.1|  hypothetical protein VEx2w_02003   109    8e-23
gi|34395981|sp|O35020|TRMU_BACSU  Probable tRNA (5-methylamino...   109    8e-23
gi|33519851|ref|NP_878683.1|  tRNA (5-methylaminomethyl-2-thio...   109    8e-23  
gi|54308340|ref|YP_129360.1|  tRNA (5-methylaminomethyl-2-thio...   109    9e-23  
gi|53728867|ref|ZP_00134691.2|  COG0482: Predicted tRNA(5-meth...   109    9e-23
gi|50812273|ref|NP_390627.2|  tRNA (5-methylaminomethyl-2-thio...   109    9e-23  
gi|89206358|ref|ZP_01184918.1|  tRNA (5-methylaminomethyl-2-th...   109    1e-22
gi|89201369|ref|ZP_01180110.1|  tRNA (5-methylaminomethyl-2-th...   109    1e-22
gi|14195289|sp|Q9PKA7|TRMU_CHLMU  Probable tRNA (5-methylamino...   108    1e-22
gi|78368002|ref|ZP_00838257.1|  tRNA (5-methylaminomethyl-2-th...   108    1e-22
gi|12045151|ref|NP_072962.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|15835177|ref|NP_296936.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|71281561|ref|YP_269601.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|15829029|ref|NP_326389.1|  tRNA (5-methylaminomethyl-2-thio...   108    1e-22  
gi|72161001|ref|YP_288658.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|71892171|ref|YP_277903.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|15645948|ref|NP_208127.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|85712895|ref|ZP_01043936.1|  tRNA (5-methylaminomethyl-2-th...   108    2e-22
gi|116492933|ref|YP_804668.1|  Predicted tRNA(5-methylaminomet...   108    2e-22  
gi|84391736|ref|ZP_00991638.1|  tRNA (5-methylaminomethyl-2-th...   108    2e-22
gi|114563431|ref|YP_750944.1|  tRNA (5-methylaminomethyl-2-thi...   108    2e-22  
gi|76789009|ref|YP_328095.1|  tRNA (5-methylaminomethyl-2-thio...   108    2e-22  
gi|91793184|ref|YP_562835.1|  tRNA (5-methylaminomethyl-2-thio...   107    3e-22  
gi|83569546|ref|ZP_00920998.1|  COG0482: Predicted tRNA(5-meth...   107    3e-22
gi|16419753|gb|AAL20163.1|  tRNA (5-methylaminomethyl-2-thiour...   107    3e-22  
gi|73662449|ref|YP_301230.1|  putative tRNA methyltransferase ...   107    4e-22  
gi|15605008|ref|NP_219792.1|  tRNA (5-methylaminomethyl-2-thio...   107    4e-22  
gi|118440946|gb|EAV47573.1|  tRNA (5-methylaminomethyl-2-thiou...   107    4e-22
gi|39546313|ref|NP_460204.2|  tRNA (5-methylaminomethyl-2-thio...   107    4e-22  
gi|108563707|ref|YP_628023.1|  tRNA (5-methylaminomethyl-2-thi...   107    5e-22  
gi|62179755|ref|YP_216172.1|  tRNA (5-methylaminomethyl-2-thio...   107    5e-22  
gi|71658016|sp|Q5F7G4|TRMU_NEIG1  Probable tRNA (5-methylamino...   107    5e-22
gi|15677407|ref|NP_274563.1|  tRNA (5-methylaminomethyl-2-thio...   107    5e-22  
gi|59801573|ref|YP_208285.1|  tRNA (5-methylaminomethyl-2-thio...   107    5e-22  
gi|90413208|ref|ZP_01221203.1|  tRNA (5-methylaminomethyl-2-th...   107    6e-22
gi|89105578|ref|ZP_01178095.1|  COG0482: Predicted tRNA(5-meth...   107    6e-22
gi|15612319|ref|NP_223972.1|  tRNA (5-methylaminomethyl-2-thio...   106    6e-22  
gi|71658017|sp|Q57QC0|TRMU_SALCH  tRNA (5-methylaminomethyl-2-thi   106    6e-22
gi|90579124|ref|ZP_01234934.1|  tRNA (5-methylaminomethyl-2-th...   106    6e-22
gi|117673275|ref|ZP_01496333.1|  hypothetical protein YpseI_02...   106    7e-22
gi|77635911|ref|ZP_00797990.1|  COG0482: Predicted tRNA(5-meth...   106    7e-22
gi|111225218|ref|YP_716012.1|  tRNA (5-methylaminomethyl-2-thi...   106    7e-22  
gi|42630476|ref|ZP_00156015.1|  COG0482: Predicted tRNA(5-meth...   106    9e-22
gi|15613824|ref|NP_242127.1|  (5-methylaminomethyl-2-thiouridy...   106    9e-22  
gi|16121906|ref|NP_405219.1|  tRNA (5-methylaminomethyl-2-thio...   106    9e-22  
gi|46128960|ref|ZP_00154707.2|  COG0482: Predicted tRNA(5-meth...   105    1e-21
gi|89073381|ref|ZP_01159905.1|  tRNA (5-methylaminomethyl-2-th...   105    1e-21
gi|68248779|ref|YP_247891.1|  tRNA (5-methylaminomethyl-2-thio...   105    1e-21  
gi|8039809|sp|P44551|TRMU_HAEIN  Probable tRNA (5-methylaminom...   105    1e-21
gi|16272139|ref|NP_438342.1|  tRNA (5-methylaminomethyl-2-thio...   105    1e-21  
gi|113199419|ref|ZP_01410921.1|  hypothetical protein Cfetf_01...   105    1e-21
gi|33151616|ref|NP_872969.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|71735842|ref|YP_275272.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|27468222|ref|NP_764859.1|  (5-methylaminomethyl-2-thiouridy...   105    2e-21  
gi|16760109|ref|NP_455726.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|114846630|ref|ZP_01456966.1|  tRNA (5-methylaminomethyl-2-t...   105    2e-21
gi|88860122|ref|ZP_01134761.1|  tRNA (5-methylaminomethyl-2-th...   105    2e-21
gi|15801330|ref|NP_287347.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|82777256|ref|YP_403605.1|  hypothetical protein SDY_2019 [S...   105    2e-21  
gi|46579220|ref|YP_010028.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|75209213|ref|ZP_00709460.1|  COG0482: Predicted tRNA(5-meth...   105    2e-21
gi|38703944|ref|NP_309632.2|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|34498857|ref|NP_903072.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|26247381|ref|NP_753421.1|  tRNA (5-methylaminomethyl-2-thio...   105    2e-21  
gi|56421098|ref|YP_148416.1|  tRNA (5-methylaminomethyl-2-thio...   104    2e-21  
gi|86147101|ref|ZP_01065418.1|  tRNA (5-methylaminomethyl-2-th...   104    2e-21
gi|29348763|ref|NP_812266.1|  tRNA (5-methylaminomethyl-2-thio...   104    2e-21  
gi|24112552|ref|NP_707062.1|  tRNA (5-methylaminomethyl-2-thio...   104    2e-21  
gi|114793688|pdb|2DER|A  Chain A, Cocrystal Structure Of An Rn...   104    2e-21  
gi|30173414|sp|Q8CXZ8|TRMU_ECOL6  Probable tRNA (5-methylamino...   104    2e-21
gi|74311692|ref|YP_310111.1|  hypothetical protein SSO_1151 [S...   104    2e-21  
gi|110805161|ref|YP_688681.1|  hypothetical protein SFV_1168 [...   104    2e-21  
gi|68547819|ref|ZP_00587347.1|  tRNA (5-methylaminomethyl-2-th...   104    3e-21
gi|28870522|ref|NP_793141.1|  tRNA (5-methylaminomethyl-2-thio...   104    3e-21  
gi|75179245|ref|ZP_00699263.1|  COG0482: Predicted tRNA(5-meth...   104    3e-21
gi|75190219|ref|ZP_00703486.1|  COG0482: Predicted tRNA(5-meth...   104    3e-21
gi|82544380|ref|YP_408327.1|  hypothetical protein SBO_1906 [S...   104    3e-21  
gi|7442935|pir||B64858  probable ATPase ycfB - Escherichia coli (   104    3e-21
gi|91210289|ref|YP_540275.1|  probable ATPase YcfB [Escherichi...   104    3e-21  
gi|75239631|ref|ZP_00723598.1|  COG0482: Predicted tRNA(5-meth...   104    3e-21
gi|90961839|ref|YP_535755.1|  tRNA (5-methylaminomethyl-2-thio...   104    3e-21  
gi|118422629|gb|ABK89019.1|  tRNA(5-methylaminomethyl-2-thiour...   104    3e-21
gi|92911107|ref|ZP_01279881.1|  tRNA (5-methylaminomethyl-2-th...   104    3e-21
gi|29829295|ref|NP_823929.1|  tRNA (5-methylaminomethyl-2-thio...   104    3e-21  
gi|88855226|ref|ZP_01129891.1|  tRNA (5-methylaminomethyl-2-th...   104    4e-21
gi|15610161|ref|NP_217540.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|46447434|ref|YP_008799.1|  probable tRNA (5-methylaminometh...   103    4e-21  
gi|72080763|ref|YP_287821.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|27904738|ref|NP_777864.1|  putative tRNA (5-methylaminometh...   103    4e-21  
gi|115314034|ref|YP_762757.1|  tRNA (5-methylaminomethyl-2-thi...   103    4e-21  
gi|89255515|ref|YP_512876.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|56708687|ref|YP_170583.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|71658014|sp|Q5NEF9|TRMU_FRATT  Probable tRNA (5-methylamino...   103    4e-21
gi|92912343|ref|ZP_01280973.1|  tRNA (5-methylaminomethyl-2-th...   103    4e-21
gi|85059063|ref|YP_454765.1|  tRNA (5-methylaminomethyl-2-thio...   103    4e-21  
gi|77972866|ref|ZP_00828422.1|  COG0482: Predicted tRNA(5-meth...   103    4e-21
gi|77459818|ref|YP_349325.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|37526694|ref|NP_930038.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|15641141|ref|NP_230773.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|75817331|ref|ZP_00747783.1|  COG0482: Predicted tRNA(5-meth...   103    5e-21
gi|56419544|ref|YP_146862.1|  tRNA (5-methylaminomethyl-2-thio...   103    5e-21  
gi|66046419|ref|YP_236260.1|  tRNA (5-methylaminomethyl-2-thio...   103    6e-21  
gi|88195430|ref|YP_500234.1|  tRNA methyl transferase, putativ...   103    6e-21  
gi|87162110|ref|YP_494273.1|  tRNA (5-methylaminomethyl-2-thio...   103    6e-21  
gi|59712391|ref|YP_205167.1|  tRNA (5-methylaminomethyl-2-thio...   103    6e-21  
gi|118058474|ref|ZP_01526935.1|  tRNA (5-methylaminomethyl-2-t...   103    7e-21
gi|15924611|ref|NP_372145.1|  5-methylaminomethyl-2-thiouridyl...   103    7e-21  
gi|15927201|ref|NP_374734.1|  (5-methylaminomethyl-2-thiouridy...   103    7e-21  
gi|82751221|ref|YP_416962.1|  5-methylaminomethyl-2-thiouridyl...   103    7e-21  
gi|68056457|ref|ZP_00540576.1|  tRNA (5-methylaminomethyl-2-th...   103    7e-21
gi|53711506|ref|YP_097498.1|  tRNA (5-methylaminomethyl-2-thio...   103    8e-21  
gi|50365230|ref|YP_053655.1|  tRNA(5-methylaminomethyl-2-thiou...   103    8e-21  
gi|60679769|ref|YP_209913.1|  putative tRNA (5-methylaminometh...   103    8e-21  
gi|116216701|ref|ZP_01482538.1|  hypothetical protein VchoR_02...   103    8e-21
gi|70726299|ref|YP_253213.1|  tRNA(5-methylaminomethyl-2-thiou...   103    8e-21  
gi|94266357|ref|ZP_01290057.1|  tRNA (5-methylaminomethyl-2-th...   102    9e-21
gi|75511661|ref|ZP_00734308.1|  COG0482: Predicted tRNA(5-meth...   102    1e-20
gi|26990719|ref|NP_746144.1|  tRNA (5-methylaminomethyl-2-thio...   102    1e-20  
gi|116334036|ref|YP_795563.1|  Predicted tRNA(5-methylaminomet...   102    1e-20  
gi|116269364|ref|ZP_01493608.1|  tRNA (5-methylaminomethyl-2-t...   102    1e-20
gi|94263083|ref|ZP_01286902.1|  tRNA (5-methylaminomethyl-2-th...   102    1e-20
gi|71893779|ref|YP_279225.1|  tRNA (5-methylaminomethyl-2-thio...   102    1e-20  
gi|29349296|ref|NP_812799.1|  putative tRNA (5-methylaminometh...   102    1e-20  
gi|116629824|ref|YP_814996.1|  Predicted tRNA(5-methylaminomet...   102    1e-20  
gi|70731250|ref|YP_260991.1|  tRNA (5-methylaminomethyl-2-thio...   102    2e-20  
gi|15618353|ref|NP_224638.1|  tRNA (5-methylaminomethyl-2-thio...   102    2e-20  
gi|14195277|sp|Q9JTJ9|TRMU_NEIMA  Probable tRNA (5-methylamino...   101    2e-20
gi|54020202|ref|YP_115943.1|  tRNA (5-methylaminomethyl-2-thio...   101    2e-20  
gi|42518912|ref|NP_964842.1|  probable tRNA (5-methylaminometh...   101    2e-20  
gi|118068864|ref|ZP_01537114.1|  tRNA (5-methylaminomethyl-2-t...   101    2e-20
gi|15794637|ref|NP_284459.1|  tRNA (5-methylaminomethyl-2-thio...   101    2e-20  
gi|77963649|ref|ZP_00827457.1|  COG0482: Predicted tRNA(5-meth...   101    3e-20
gi|84326952|ref|ZP_00974976.1|  COG0482: Predicted tRNA(5-meth...   101    3e-20
gi|15597822|ref|NP_251316.1|  tRNA (5-methylaminomethyl-2-thio...   101    3e-20  
gi|114772808|ref|ZP_01450132.1|  tRNA (5-methylaminomethyl-2-t...   101    3e-20
gi|94413124|ref|ZP_01293015.1|  hypothetical protein PaerP_010...   101    3e-20
gi|82737595|ref|ZP_00900443.1|  tRNA (5-methylaminomethyl-2-th...   101    3e-20
gi|67155879|ref|ZP_00417506.1|  tRNA (5-methylaminomethyl-2-th...   100    3e-20
gi|77959452|ref|ZP_00823472.1|  COG0482: Predicted tRNA(5-meth...   100    3e-20
gi|19705225|ref|NP_602720.1|  tRNA (5-methylaminomethyl-2-thio...   100    3e-20  
gi|89890355|ref|ZP_01201865.1|  tRNA (5-methylaminomethyl-2-th...   100    3e-20
gi|83645146|ref|YP_433581.1|  tRNA (5-methylaminomethyl-2-thio...   100    4e-20  
gi|29376579|ref|NP_815733.1|  tRNA (5-methylaminomethyl-2-thio...   100    4e-20  
gi|52424356|ref|YP_087493.1|  tRNA (5-methylaminomethyl-2-thio...   100    4e-20  
gi|21283300|ref|NP_646388.1|  (5-methylaminomethyl-2-thiouridy...   100    4e-20  
gi|116494783|ref|YP_806517.1|  Predicted tRNA(5-methylaminomet...   100    4e-20  
gi|58337130|ref|YP_193715.1|  tRNA-methyltransferase [Lactobac...   100    5e-20  
gi|90408225|ref|ZP_01216392.1|  tRNA (5-methylaminomethyl-2-th...   100    6e-20
gi|56963351|ref|YP_175082.1|  tRNA (5-methylaminomethyl-2-thio...   100    6e-20  
gi|54294275|ref|YP_126690.1|  hypothetical protein lpl1340 [Le...  99.8    8e-20  
gi|62184976|ref|YP_219761.1|  tRNA (5-methylaminomethyl-2-thio...  99.8    8e-20  
gi|52841619|ref|YP_095418.1|  tRNA (5 methylaminomethyl-2-thio...  99.8    9e-20  
gi|91776467|ref|YP_546223.1|  tRNA (5-methylaminomethyl-2-thio...  99.4    1e-19  
gi|94311890|ref|YP_585100.1|  tRNA (5-methylaminomethyl-2-thio...  99.0    1e-19  
gi|34762114|ref|ZP_00143122.1|  tRNA (5-methylaminomethyl-2-th...  99.0    1e-19
gi|39938611|ref|NP_950377.1|  tRNA(5-methylaminomethyl-2-thiou...  99.0    1e-19  
gi|88796248|ref|ZP_01111926.1|  tRNA (5-methylaminomethyl-2-th...  98.6    2e-19
gi|21223845|ref|NP_629624.1|  tRNA (5-methylaminomethyl-2-thio...  98.6    2e-19  
gi|87122222|ref|ZP_01078105.1|  tRNA methyltransferase [Marino...  98.6    2e-19
gi|60683221|ref|YP_213365.1|  putative tRNA methyltransferase ...  98.6    2e-19  
gi|83746745|ref|ZP_00943793.1|  tRNA (5-methylaminomethyl-2-th...  98.2    2e-19
gi|90588832|ref|ZP_01244483.1|  tRNA (5-methylaminomethyl-2-th...  98.2    3e-19
gi|73542506|ref|YP_297026.1|  tRNA (5-methylaminomethyl-2-thio...  98.2    3e-19  
gi|53804157|ref|YP_114223.1|  tRNA (5-methylaminomethyl-2-thio...  97.8    3e-19  
gi|113869080|ref|YP_727569.1|  tRNA (5-methylaminomethyl-2-thi...  97.8    3e-19  
gi|116628661|ref|YP_821280.1|  Predicted tRNA(5-methylaminomet...  97.8    3e-19  
gi|53715285|ref|YP_101277.1|  putative tRNA (5-methylaminometh...  97.4    4e-19  
gi|75430208|ref|ZP_00732689.1|  tRNA (5-methylaminomethyl-2-th...  97.4    4e-19
gi|78485443|ref|YP_391368.1|  tRNA (5-methylaminomethyl-2-thio...  97.4    4e-19  
gi|69284520|ref|ZP_00616360.1|  tRNA (5-methylaminomethyl-2-th...  97.4    4e-19
gi|62425242|ref|ZP_00380378.1|  COG0482: Predicted tRNA(5-meth...  97.4    4e-19
gi|71894390|ref|YP_278498.1|  tRNA-(5-methylaminomethyl-2-thio...  97.4    5e-19  
gi|50556890|ref|XP_505853.1|  hypothetical protein [Yarrowia l...  97.1    5e-19  
gi|77980028|ref|ZP_00835443.1|  COG0482: Predicted tRNA(5-meth...  97.1    6e-19
gi|54297299|ref|YP_123668.1|  hypothetical protein lpp1344 [Le...  97.1    6e-19  
gi|95926280|ref|ZP_01309082.1|  hypothetical protein CburR_010019  96.7    6e-19
gi|78356066|ref|YP_387515.1|  tRNA (5-methylaminomethyl-2-thio...  96.7    7e-19  
gi|56475956|ref|YP_157545.1|  tRNA 5-methylaminomethyl-2-thiou...  96.7    8e-19  
gi|85057877|ref|YP_456793.1|  tRNA (5-methylaminomethyl-2-thio...  96.3    8e-19  
gi|104781327|ref|YP_607825.1|  tRNA (5-methylaminomethyl-2-thi...  96.3    8e-19  
gi|55821970|ref|YP_140412.1|  tRNA (5-methylaminomethyl-2-thio...  96.3    8e-19  
gi|17547442|ref|NP_520844.1|  tRNA (5-methylaminomethyl-2-thio...  95.9    1e-18  
gi|29654453|ref|NP_820145.1|  tRNA (5-methylaminomethyl-2-thio...  95.5    1e-18  
gi|94491900|ref|ZP_01299109.1|  hypothetical protein CburD_010...  95.5    1e-18
gi|106882895|ref|ZP_01350295.1|  tRNA (5-methylaminomethyl-2-t...  95.5    2e-18
gi|50121369|ref|YP_050536.1|  tRNA (5-methylaminomethyl-2-thio...  95.5    2e-18  
gi|110834136|ref|YP_692995.1|  tRNA (5-methylaminomethyl-2-thi...  95.1    2e-18  
gi|83319617|ref|YP_424495.1|  tRNA (5-methylaminomethyl-2-thio...  95.1    2e-18  
gi|31544324|ref|NP_852902.1|  TrmU [Mycoplasma gallisepticum R...  95.1    2e-18  
gi|109898694|ref|YP_661949.1|  tRNA (5-methylaminomethyl-2-thi...  94.7    2e-18  
gi|13357963|ref|NP_078237.1|  tRNA-(5-methylaminomethyl-2-thio...  94.7    3e-18  
gi|42560982|ref|NP_975433.1|  tRNA (5-methylaminomethyl-2-thio...  94.7    3e-18  
gi|34540110|ref|NP_904589.1|  tRNA (5-methylaminomethyl-2-thio...  94.7    3e-18  
gi|47459275|ref|YP_016137.1|  tRNA (5-methylaminomethyl-2-thio...  94.4    3e-18  
gi|88712370|ref|ZP_01106457.1|  tRNA (5-methylaminomethyl-2-th...  94.4    3e-18
gi|114332296|ref|YP_748518.1|  tRNA (5-methylaminomethyl-2-thi...  94.4    4e-18  
gi|32490853|ref|NP_871107.1|  hypothetical protein WGLp104 [Wi...  94.4    4e-18  
gi|84320594|ref|ZP_00968967.1|  COG0482: Predicted tRNA(5-meth...  94.0    4e-18
gi|77165505|ref|YP_344030.1|  tRNA (5-methylaminomethyl-2-thio...  93.6    6e-18  
gi|104773839|ref|YP_618819.1|  tRNA (5-methylaminomethyl-2-thi...  93.6    6e-18  
gi|94676746|ref|YP_588863.1|  tRNA (5-methylaminomethyl-2-thio...  93.2    7e-18  
gi|30248966|ref|NP_841036.1|  trmU; tRNA 5-methylaminomethyl-2...  93.2    7e-18  
gi|6320172|ref|NP_010251.1|  tRNA-specific 2-thiouridylase, re...  93.2    8e-18  
gi|21672533|ref|NP_660600.1|  tRNA (5-methylaminomethyl-2-thio...  92.8    9e-18  
gi|88798697|ref|ZP_01114280.1|  tRNA (5-methylaminomethyl-2-th...  92.8    9e-18
gi|116513846|ref|YP_812752.1|  Predicted tRNA(5-methylaminomet...  92.8    1e-17  
gi|28378785|ref|NP_785677.1|  tRNA (5-methylaminomethyl-2-thio...  92.8    1e-17  
gi|14195271|sp|Q9CHA1|TRMU_LACLA  Probable tRNA (5-methylamino...  92.4    1e-17
gi|88703376|ref|ZP_01101092.1|  tRNA (5-methylaminomethyl-2-th...  92.4    1e-17
gi|15672819|ref|NP_266993.1|  tRNA (5-methylaminomethyl-2-thio...  92.4    1e-17  
gi|84356799|ref|ZP_00981634.1|  COG0482: Predicted tRNA(5-meth...  92.4    1e-17
gi|86140336|ref|ZP_01058895.1|  tRNA (5-methylaminomethyl-2-th...  92.0    2e-17
gi|74316869|ref|YP_314609.1|  tRNA (5-methylaminomethyl-2-thio...  92.0    2e-17  
gi|28572507|ref|NP_789287.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|28493382|ref|NP_787543.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|115350645|ref|YP_772484.1|  tRNA (5-methylaminomethyl-2-thi...  91.7    2e-17  
gi|77952878|ref|ZP_00817290.1|  tRNA (5-methylaminomethyl-2-th...  91.7    2e-17
gi|15643286|ref|NP_228330.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|93005976|ref|YP_580413.1|  tRNA (5-methylaminomethyl-2-thio...  91.7    2e-17  
gi|81428407|ref|YP_395407.1|  tRNA(5-methylaminomethyl-2-thiou...  91.3    3e-17  
gi|13508161|ref|NP_110110.1|  TRNA (5-METHYLAMINOMETHYL-2-THIO...  91.3    3e-17  
gi|71908904|ref|YP_286491.1|  tRNA (5-methylaminomethyl-2-thio...  91.3    3e-17  
gi|45190520|ref|NP_984774.1|  AEL087Cp [Eremothecium gossypii]...  90.9    3e-17  
gi|68482055|ref|XP_715045.1|  hypothetical protein CaO19.7245 ...  90.9    3e-17 

>gi|71083529|ref|YP_266248.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Candidatus Pelagibacter ubique HTCC1062]
 gi|91762051|ref|ZP_01264016.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Candidatus Pelagibacter ubique HTCC1002]
 gi|71062642|gb|AAZ21645.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Candidatus Pelagibacter ubique HTCC1062]
 gi|91717853|gb|EAS84503.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Candidatus Pelagibacter ubique HTCC1002]
Length=371

 Score =  315 bits (807),  Expect = 1e-84, Method: Composition-based stats.
 Identities = 157/219 (71%), Positives = 195/219 (89%), Gaps = 2/219 (0%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            MYR ID NRDQSYFLF+TT++QLN+LRFPLG +LK ETR IA++LDLNVA+KPDSQDICF
Sbjct  153  MYRGIDLNRDQSYFLFNTTKDQLNFLRFPLGNLLKDETRNIARELDLNVADKPDSQDICF  212

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VPNGDY SVIEK RP++F KGNIK++ G+VIGVHDGI+N+TIGQRKGI ++ K+PLYV++
Sbjct  213  VPNGDYASVIEKFRPNSFSKGNIKNMNGEVIGVHDGIINYTIGQRKGIGVSDKNPLYVVK  272

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGN-KREFQREIFVKVRSTGKLLKSKINIIND  179
            I ADKNEIIVG+K+HLVK +I LKDLN++ N + +F+ E+FVKVRSTG+L+K+KI+ IND
Sbjct  273  IIADKNEIIVGAKEHLVKTKINLKDLNIITNDQNDFKNELFVKVRSTGRLIKAKID-IND  331

Query  180  NEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIK  218
              A +NL EEE+GI+PGQACVFY+K+ NGYKVLGGGWIK
Sbjct  332  TNANVNLLEEEHGIAPGQACVFYAKNNNGYKVLGGGWIK  370


>gi|118433757|gb|EAV40418.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Stappia aggregata IAM 12614]
Length=392

 Score =  237 bits (604),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 107/222 (48%), Positives = 158/222 (71%), Gaps = 4/222 (1%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            ++R  D +RDQSYFLF TT++QL+++RFPLGG+ KS+ RE+A +  L VA KPDSQDICF
Sbjct  151  LFRPADLDRDQSYFLFATTQDQLDFIRFPLGGMPKSKVRELAAEFGLTVANKPDSQDICF  210

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VPNGDY  VI K+RP+A + G I  + G+V+G HDGI+++TIGQR+G+ +AT DPLYV+ 
Sbjct  211  VPNGDYAEVIRKLRPNAAEPGEIVHMDGRVLGEHDGIIHYTIGQRRGLGVATGDPLYVVR  270

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNK---REFQREIFVKVRSTGKLLKSKINII  177
            ++ D+  ++VG ++ L  + I L+++N +G++      + E+F KVRST     + + I+
Sbjct  271  LDPDERRVVVGPREALATRTILLREMNWIGDQPLDEGDEIELFAKVRSTRPPAPATLRIL  330

Query  178  NDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
            N  +  ++L   E G++PGQACVF+  D    +VLGGGWI K
Sbjct  331  N-GKGFVDLANGETGVAPGQACVFFDTDDETARVLGGGWIHK  371


>gi|83942322|ref|ZP_00954783.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Sulfitobacter sp. EE-36]
 gi|83846415|gb|EAP84291.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Sulfitobacter sp. EE-36]
Length=380

 Score =  228 bits (582),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 114/224 (50%), Positives = 154/224 (68%), Gaps = 7/224 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL+YLRFPLG +  K++TR +A K  L+VA+KPDSQDIC
Sbjct  158  LHCAADANRDQSYFLFSTTPEQLDYLRFPLGHLPSKNDTRALAAKYGLSVADKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNGDY SVI K+RP+A   GNI D  G V+  HDG++N+TIGQR+G+ +    DPLYV
Sbjct  218  FVPNGDYASVIRKLRPEAANPGNIVDTDGNVLAQHDGVINYTIGQRRGLGIGGLADPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNK---REFQREIFVKVRSTGKLLKSKIN  175
            ++++AD  +++VG K  L  + + +K++N LG+     + +  I V+VRST     + + 
Sbjct  278  VKLDADNAQVVVGPKSMLATRTVPVKEINWLGDTPLMSQSEWPIAVRVRSTRPPTDAILR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
             I+D EA + L   E GISPGQACVFY  D    ++ GGGWI K
Sbjct  338  PISDTEATVELLTPEEGISPGQACVFY--DPESTRIFGGGWIHK  379


>gi|83953541|ref|ZP_00962262.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Sulfitobacter sp. NAS-14.1]
 gi|83841486|gb|EAP80655.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Sulfitobacter sp. NAS-14.1]
Length=380

 Score =  228 bits (582),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 114/224 (50%), Positives = 154/224 (68%), Gaps = 7/224 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL+YLRFPLG +  K++TR +A K  L+VA+KPDSQDIC
Sbjct  158  LHCAADANRDQSYFLFSTTPEQLDYLRFPLGHLPSKNDTRALAAKYGLSVADKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNGDY SVI K+RP+A   GNI D  G V+  HDG++N+TIGQR+G+ +    DPLYV
Sbjct  218  FVPNGDYASVIRKLRPEAANPGNIVDTDGNVLAQHDGVINYTIGQRRGLGIGGLADPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNK---REFQREIFVKVRSTGKLLKSKIN  175
            ++++AD  +++VG K  L  + + +K++N LG+     + +  I V+VRST     + + 
Sbjct  278  VKLDADNAQVVVGPKSMLATRTVPVKEINWLGDTPLMSQSEWPIAVRVRSTRPPTDAILR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
             I+D EA + L   E GISPGQACVFY  D    ++ GGGWI K
Sbjct  338  PISDTEATVELLTPEEGISPGQACVFY--DPESTRIFGGGWIHK  379


>gi|84500833|ref|ZP_00999068.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Oceanicola batsensis HTCC2597]
 gi|84390900|gb|EAQ03318.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Oceanicola batsensis HTCC2597]
Length=382

 Score =  226 bits (577),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 111/224 (49%), Positives = 158/224 (70%), Gaps = 7/224 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGIL-KSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D  RDQSYFLF TT EQL++LRFPLG +  K+ETR +A K  L VA+KPDSQDIC
Sbjct  158  LHSAADAARDQSYFLFSTTPEQLSFLRFPLGHLASKAETRALAAKYGLPVADKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNG+Y SVIEK+RP A + G I D  G+V+G H+G++++TIGQR+G+ +    DPLYV
Sbjct  218  FVPNGNYASVIEKLRPGAAEPGEIVDTSGRVLGHHEGVIHYTIGQRRGLGIGGLSDPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGN---KREFQREIFVKVRSTGKLLKSKIN  175
            + ++ D   ++VG K+ L  +++ ++++N LG      + +REI VKVRST    ++ + 
Sbjct  278  VRLDVDARRVVVGPKELLATRQVPVREINWLGEGAFTDQPEREISVKVRSTRPPREAILR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
             ++D EA++ L   E G+SPGQACVFY  +  G ++LGGGWI K
Sbjct  338  PVSDTEAVVELLTPEEGVSPGQACVFY--ETGGTRILGGGWIWK  379


>gi|114569244|ref|YP_755924.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Maricaulis maris MCS10]
 gi|114339706|gb|ABI64986.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Maricaulis maris MCS10]
Length=405

 Score =  225 bits (573),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 107/218 (49%), Positives = 155/218 (71%), Gaps = 3/218 (1%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            + RA D  +DQSYFLF TT +QL++LRFPLG + K +TRE+A+   L VA+KPDSQDICF
Sbjct  173  LRRAADAGKDQSYFLFATTHDQLDFLRFPLGHLNKDQTRELAEAFGLIVADKPDSQDICF  232

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VPNG YV ++EK+RP A + G I  + G+V+G H+G++ +T+GQR+G+K+A  DPLYV+ 
Sbjct  233  VPNGRYVDIVEKVRPGASRPGEIVHVDGRVLGTHEGVIRYTVGQRRGLKIAVGDPLYVVR  292

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQ-REIFVKVRSTGKLLKSKINIIND  179
            ++A K E++VG ++ L    I LKD+N LG++       + VKVRST   + + +++  D
Sbjct  293  LDAAKAEVVVGPREALEIDTIALKDINWLGDEAPLDGAPVRVKVRSTRPPVPAALSVDGD  352

Query  180  NEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
            +  ++  + EE G++PGQACVFYS D    +VLGGGWI
Sbjct  353  DIRVVLARGEE-GVAPGQACVFYSSDDED-RVLGGGWI  388


>gi|84516171|ref|ZP_01003531.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Loktanella vestfoldensis SKA53]
 gi|84509867|gb|EAQ06324.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Loktanella vestfoldensis SKA53]
Length=379

 Score =  224 bits (571),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 110/222 (49%), Positives = 154/222 (69%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGG-ILKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D  +DQSYFLF TT++QL+YLRFPLG    K ETR +A K  L+VA+KPDSQDIC
Sbjct  156  LHSAADAAKDQSYFLFSTTQDQLDYLRFPLGHHKSKDETRALAAKYGLSVADKPDSQDIC  215

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNGDY +VIEK+RP A   G I D+ G+V+G H+G++++T+GQR+G+ +    DPLYV
Sbjct  216  FVPNGDYAAVIEKLRPGAASPGTIVDINGQVLGQHNGVIHYTVGQRRGLGIGGLADPLYV  275

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREF---QREIFVKVRSTGKLLKSKIN  175
            + ++ DK ++IVG K  L  + + L+++N +G  +     +R+I V+VRST     + + 
Sbjct  276  VRLDVDKKQVIVGPKDMLATRRVPLREINWIGGGKLTDIAERQIAVRVRSTRPPTDAILR  335

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             I+D EA + L   E G+SPGQACVFY  D    +VLGGGWI
Sbjct  336  PISDTEAEVELLVAEQGVSPGQACVFYDTDST--RVLGGGWI  375


>gi|114768812|ref|ZP_01446438.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[alpha proteobacterium HTCC2255]
 gi|114549729|gb|EAU52610.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[alpha proteobacterium HTCC2255]
Length=382

 Score =  223 bits (567),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 111/221 (50%), Positives = 153/221 (69%), Gaps = 6/221 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGIL-KSETREIAKKLDLNVAEKPDSQDIC  59
            +++A D++RDQSYFLF T +EQL+YLRFPLG +  K +TRE+A K  L VA+KPDSQDIC
Sbjct  161  LHKAADQDRDQSYFLFSTKQEQLDYLRFPLGHLKSKKDTRELAHKYGLPVADKPDSQDIC  220

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVI  119
            FVPNG Y +VIEK+RP+A   G I    G V+G H GI+N+T+GQR+G+ +   DPLYVI
Sbjct  221  FVPNGSYAAVIEKLRPEAANPGQIVSQDGAVLGEHKGIINYTVGQRRGLGIGGGDPLYVI  280

Query  120  EINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREF---QREIFVKVRSTGKLLKSKINI  176
            +++AD  E+IVG K+ L  + + +K++N LG        +R + V+VRST    ++ I  
Sbjct  281  KLDADSREVIVGPKEALATRTVLIKEINWLGEDNFLDSKERTLAVRVRSTRSPKEAIIKP  340

Query  177  INDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
            I++  A + L   E GI+PGQACVFY  D  G ++ GGGWI
Sbjct  341  ISETTATVELVMAEEGIAPGQACVFY--DIEGTRIYGGGWI  379


>gi|110679829|ref|YP_682836.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseobacter denitrificans OCh 114]
 gi|109455945|gb|ABG32150.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseobacter denitrificans OCh 114]
Length=380

 Score =  222 bits (566),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 112/224 (50%), Positives = 154/224 (68%), Gaps = 7/224 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL +LRFPLG +  K +TR +A+K  L+VA KPDSQDIC
Sbjct  158  LHSAADANRDQSYFLFSTTPEQLAFLRFPLGHLPSKEDTRALAEKYGLSVANKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVP+GDY SVI K+RP+A   G+I D  G+V+  HDG+VN+TIGQR+G+ +     PLYV
Sbjct  218  FVPDGDYASVIRKLRPEAAAPGDIVDTDGRVLARHDGVVNYTIGQRRGLGIGGLATPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQREIF---VKVRSTGKLLKSKIN  175
            I+++A+  +++VG K  L  + + ++++N LG++    R+ +   VKVRST     + I 
Sbjct  278  IKLDAEARQVVVGPKSMLSTRTVPVREINWLGDEPFQSRDAWHLAVKVRSTRPPTDAIIR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
             I+D EA + L   E GISPGQACVFY  D +  ++ GGGWI K
Sbjct  338  PISDTEATVELTSPEEGISPGQACVFYDTDSS--RIYGGGWIHK  379


>gi|99081242|ref|YP_613396.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Silicibacter sp. TM1040]
 gi|99037522|gb|ABF64134.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Silicibacter sp. TM1040]
Length=381

 Score =  221 bits (563),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 111/224 (49%), Positives = 157/224 (70%), Gaps = 7/224 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL++LRFPLG +  K  TRE+A +  L+VA+KPDSQDIC
Sbjct  158  LHSAEDANRDQSYFLFSTTPEQLDFLRFPLGHLPSKDATREMAAQYGLSVADKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNGDY SVI+K+RP A + G I    G+V+G H+G++++TIGQR+G+ +    +PLYV
Sbjct  218  FVPNGDYASVIQKLRPGAAEPGQIVHADGRVLGEHNGVIHYTIGQRRGLGIGGLSEPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQRE---IFVKVRSTGKLLKSKIN  175
            ++++ D+ ++IVG K+ L  + + ++++N LG+     R+   + VKVRST     + I 
Sbjct  278  VKLDVDQKQVIVGPKEMLATRRVPVREINWLGDAPFTSRDEWHLSVKVRSTRPPRDAIIR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
             I++ EA + L   E GISPGQACVFY  D NG ++ GGGWI K
Sbjct  338  PISETEAEVELFSAEEGISPGQACVFY--DPNGSRIYGGGWIWK  379


>gi|114766932|ref|ZP_01445852.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseovarius sp. HTCC2601]
 gi|114540839|gb|EAU43901.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseovarius sp. HTCC2601]
Length=380

 Score =  220 bits (561),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 109/222 (49%), Positives = 157/222 (70%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGIL-KSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL+YLRFPLG +  K+ETRE+A K  L+VA+KPDSQDIC
Sbjct  157  LHSAADANRDQSYFLFSTTPEQLDYLRFPLGHLKSKAETRELAAKYGLSVADKPDSQDIC  216

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVP+G+Y SVIEK+RP A + G I    G+V+G H G++++TIGQR+G+ +    +PLYV
Sbjct  217  FVPDGNYASVIEKLRPGAAEPGEIVHADGRVLGEHRGVIHYTIGQRRGLGIGGLTEPLYV  276

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQRE---IFVKVRSTGKLLKSKIN  175
            ++++ D  ++IVG K+ L  +++ ++++N LG+     RE   + VKVRST    ++ + 
Sbjct  277  VKLDVDNKQVIVGPKEMLATRKVPVREINWLGDAPFTSREEWHLSVKVRSTRPPREAIVR  336

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             I++ EA + L   E G+SPGQACVFY  D +  ++ GGGWI
Sbjct  337  PISETEAEVELVVAEEGVSPGQACVFYDPDSS--RIFGGGWI  376


>gi|89069527|ref|ZP_01156871.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Oceanicola granulosus HTCC2516]
 gi|89044862|gb|EAR50952.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Oceanicola granulosus HTCC2516]
Length=379

 Score =  220 bits (560),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 111/222 (50%), Positives = 155/222 (69%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGIL-KSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D  RDQSYFLF TT EQL YLRFPLG +  K+ETR +A +  L VA+KPDSQDIC
Sbjct  156  LHSAADAARDQSYFLFSTTPEQLAYLRFPLGHLASKAETRALAGRHGLPVADKPDSQDIC  215

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNG+Y SVIEK+RP A + G+I D +G+V+G H G++++TIGQR+G+ +    DPLYV
Sbjct  216  FVPNGNYASVIEKLRPGAAEPGDIVDTEGRVLGTHRGLIHYTIGQRRGLGIGGLADPLYV  275

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQ---REIFVKVRSTGKLLKSKIN  175
            ++++ D   ++VG K+ L  + + ++++N LG+    +   REI VKVRST    ++ + 
Sbjct  276  VKLDVDTRRVVVGPKELLATRTVPVREINWLGDGGFLEGGPREISVKVRSTRPPTEALLR  335

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             I+  EA + L   E G+SPGQACVFY  +  G +VLGGGWI
Sbjct  336  PISATEAEVELLTPEEGVSPGQACVFY--ETGGTRVLGGGWI  375


>gi|84686908|ref|ZP_01014792.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Rhodobacterales bacterium HTCC2654]
 gi|84665105|gb|EAQ11585.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Rhodobacterales bacterium HTCC2654]
Length=381

 Score =  218 bits (555),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 106/222 (47%), Positives = 155/222 (69%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++RA D NRDQSYFLF TT EQL++LRFPLG +  K ETR +A++  L VA+KPDSQDIC
Sbjct  158  LHRAADANRDQSYFLFSTTPEQLSFLRFPLGHLKTKDETRALAREFGLEVADKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVP+G+Y  VIEK+RP A + G I    G+V+G HDG++++TIGQR+G+ +    DPLYV
Sbjct  218  FVPDGNYAGVIEKLRPGAAEPGEIVHADGRVLGRHDGVIHYTIGQRRGLGIGGLSDPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGN---KREFQREIFVKVRSTGKLLKSKIN  175
            + ++ +  +++VG K+ L  + I ++++N LG+     + +  + VKVRST    ++ I 
Sbjct  278  VRLDTETRQVVVGPKEMLATRTIPVREINWLGDAPFTSQGEWHLSVKVRSTRPPREAVIR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             I++ EA + L   E G+SPGQACVFY+ D +  ++ GGGWI
Sbjct  338  PISETEAEVELLTPEEGVSPGQACVFYAPDSS--RIFGGGWI  377


>gi|23502454|ref|NP_698581.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella suis 1330]
 gi|62290471|ref|YP_222264.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella abortus biovar 1 str. 9-941]
 gi|82700395|ref|YP_414969.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella melitensis biovar Abortus 2308]
 gi|38258585|sp|Q8CY38|TRMU_BRUSU  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
 gi|71658011|sp|Q57BT1|TRMU_BRUAB  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
 gi|23348445|gb|AAN30496.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella suis 1330]
 gi|62196603|gb|AAX74903.1|  TrmU, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella abortus biovar 1 str. 9-941]
 gi|82616496|emb|CAJ11563.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella abortus]
Length=398

 Score =  218 bits (555),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 104/224 (46%), Positives = 154/224 (68%), Gaps = 6/224 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR +D +RDQSYFLF TT+EQ++YLRFPLG + K++ REIA++L L VA+K DSQDICF
Sbjct  152  LYRPVDTDRDQSYFLFATTQEQIDYLRFPLGHLPKAQVREIAEELGLTVAKKQDSQDICF  211

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  +I +++P+A   G+I  + G+ +G HDGIV++T+GQR+GI +AT + LYV+ 
Sbjct  212  VPQGKYSDIISRLKPEAANPGDIVHIDGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVH  271

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNK-----REFQREIFVKVRSTGKLLKSKIN  175
            ++A    +IVG ++ L   ++FL+D+N LG+       +   E+F KVRST +  +  + 
Sbjct  272  LDAANARVIVGPREALETHKVFLRDVNWLGDTPIADLPKSGMEVFAKVRST-RPPRPAVL  330

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
               D +  + L + E GI+PGQACV YS D N  +V GGG+I +
Sbjct  331  RHADGQTWVELVDGESGIAPGQACVLYSDDSNAARVFGGGFIGR  374


>gi|83859630|ref|ZP_00953150.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Oceanicaulis alexandrii HTCC2633]
 gi|83851989|gb|EAP89843.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Oceanicaulis alexandrii HTCC2633]
Length=433

 Score =  218 bits (555),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 106/221 (47%), Positives = 154/221 (69%), Gaps = 5/221 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            + RA D  +DQSYFLF TT EQL+YLRFPLG + K +TRE+A  L L VA KPDSQDICF
Sbjct  212  LRRAADAGKDQSYFLFATTEEQLDYLRFPLGHLNKEQTRELAAALGLIVAAKPDSQDICF  271

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP+GDY +V+EK+RP A + G I  L G+V+G H+G++ +T+GQR+G+ +AT +PLYV+ 
Sbjct  272  VPDGDYAAVVEKVRPGASRPGEIVHLDGRVMGEHEGVLRYTVGQRRGLGIATGEPLYVVR  331

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQRE---IFVKVRSTGKLLKSKINII  177
            ++A+  ++IVG ++ L  + I L D+N +G+    + +   + +KVRST     + + + 
Sbjct  332  LDAENAQVIVGPREALQVRRITLTDVNWIGDGDLSEADGLTVGIKVRSTRPPKPAILEVT  391

Query  178  NDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIK  218
             D   +L L+  E G++PGQACVFYS   +  +VLGGGWI+
Sbjct  392  GDGVFVL-LETGEEGVAPGQACVFYSHPDHD-RVLGGGWIR  430


>gi|85702766|ref|ZP_01033870.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseovarius sp. 217]
 gi|85671694|gb|EAQ26551.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseovarius sp. 217]
Length=383

 Score =  217 bits (552),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 109/222 (49%), Positives = 154/222 (69%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D  RDQSYFLF TT EQL+YLRFPLG +  K+ TRE+A +  L VA+KPDSQDIC
Sbjct  158  LHCASDSARDQSYFLFSTTPEQLDYLRFPLGHLPSKAATRELAAQYGLQVADKPDSQDIC  217

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNG+Y SVIEK+RP A + G I    G+V+G H+G++++TIGQR+G+ +   ++PLYV
Sbjct  218  FVPNGNYASVIEKLRPGAAEPGEIVHADGRVLGQHEGVIHYTIGQRRGLGIGGLEEPLYV  277

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGN---KREFQREIFVKVRSTGKLLKSKIN  175
            + ++ D   +IVG K+ L  + + L+++N LG+     + + ++ VKVRST    ++ + 
Sbjct  278  VRLDVDARRVIVGPKEMLSTRTVPLREINWLGDVPMTSQTEWQVSVKVRSTRPPREAVLR  337

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             I+  EA + L   E G+SPGQACVFY  D  G +VLGGGWI
Sbjct  338  PISATEATVELLTPEEGVSPGQACVFYETD--GSRVLGGGWI  377


>gi|56696559|ref|YP_166916.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Silicibacter pomeroyi DSS-3]
 gi|56678296|gb|AAV94962.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Silicibacter pomeroyi DSS-3]
Length=375

 Score =  216 bits (550),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 153/222 (68%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL+YLRFPLG +  K  TRE+A +  L VA+KPDSQDIC
Sbjct  152  LHCAEDANRDQSYFLFSTTPEQLDYLRFPLGHLPSKDATREMAAQYGLAVADKPDSQDIC  211

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNG+Y SVIEK+RP A + G I    G+V+G H+G++++TIGQR+G+ +    +PLYV
Sbjct  212  FVPNGNYASVIEKLRPGAAEPGEIVHADGRVLGSHEGVIHYTIGQRRGLGIGGLSEPLYV  271

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQR---EIFVKVRSTGKLLKSKIN  175
            + ++ D+ +++VG K+ L  + I ++++N LG+     R    + VKVRST    ++ + 
Sbjct  272  VRLDVDRKQVVVGPKELLATRTIPVREINWLGDAPFTSRPEWHLSVKVRSTRPPREAIVR  331

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             I++ EA + L   E G+SPGQACVFY  D  G ++ GGGWI
Sbjct  332  PISETEAEVELLTPEEGVSPGQACVFYESD--GSRIFGGGWI  371


>gi|83951896|ref|ZP_00960628.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseovarius nubinhibens ISM]
 gi|83836902|gb|EAP76199.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Roseovarius nubinhibens ISM]
Length=380

 Score =  216 bits (550),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 154/222 (69%), Gaps = 7/222 (3%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGI-LKSETREIAKKLDLNVAEKPDSQDIC  59
            ++ A D NRDQSYFLF TT EQL +LRFPLG +  K  TRE+A K  L+VA+KPDSQDIC
Sbjct  156  LHCATDANRDQSYFLFSTTPEQLEFLRFPLGHLPSKDATRELAAKYGLSVADKPDSQDIC  215

Query  60   FVPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKL-ATKDPLYV  118
            FVPNG+Y +VIEK+RP A + G I    G+V+G H+G++++TIGQR+G+ +    DPLYV
Sbjct  216  FVPNGNYAAVIEKLRPGAAEPGEIVHADGRVLGTHNGVIHYTIGQRRGLGIGGLSDPLYV  275

Query  119  IEINADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQR---EIFVKVRSTGKLLKSKIN  175
            ++++ DK  ++VG K+ L  + + ++++N LG++    R   ++ VKVRST    ++ I 
Sbjct  276  VKLDVDKKHVVVGPKEMLSTRNVPVREINWLGDEPFDSRAEWQVSVKVRSTRPPREAVIR  335

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWI  217
             ++   A + L   E GISPGQACVFY  +  G ++LGGGWI
Sbjct  336  PLSPTTAEVELLSPEDGISPGQACVFYETE--GSRILGGGWI  375


>gi|17986711|ref|NP_539345.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Brucella melitensis 16M]
 gi|24638318|sp|Q8YIL6|TRMU_BRUME  Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
 gi|17982334|gb|AAL51609.1|  TRNA (5-METHYLAMINOMETHYL-2-THIOURIDYLATE) -METHYLTRANSFERASE 
[Brucella melitensis 16M]
Length=398

 Score =  216 bits (549),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 104/224 (46%), Positives = 153/224 (68%), Gaps = 6/224 (2%)

Query  1    MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF  60
            +YR +D +RDQSYFLF TT+EQ++YLRFPLG + K++ REIA++L L VA+K DSQDICF
Sbjct  152  LYRPVDTDRDQSYFLFATTQEQIDYLRFPLGHLPKAQVREIAEELGLTVAKKQDSQDICF  211

Query  61   VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE  120
            VP G Y  +I +++P+A   G+I  + G+ +G HDGIV++T+GQR+GI +AT + LYV+ 
Sbjct  212  VPQGKYSDIISRLKPEAANPGDIVHIDGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVH  271

Query  121  INADKNEIIVGSKQHLVKKEIFLKDLNLLGNK-----REFQREIFVKVRSTGKLLKSKIN  175
            ++A    +IVG ++ L   ++FL+D+N LG+       +   E+F KVRST +  +  + 
Sbjct  272  LDAANARVIVGPREALETHKVFLRDVNWLGDTPIADLPKSGMEVFAKVRST-RPPRPAVL  330

Query  176  IINDNEAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK  219
               D +  + L + E GI+PGQACV YS D N   V GGG+I +
Sbjct  331  RHADGQTWVELVDGESGIAPGQACVLYSDDSNAACVFGGGFIGR  374

ORF finding

------------------------------any codon---------------------------------

brin direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 806.
AAAGGAGAGACTCCAATACCATGTGTACAGTGCAATAAAACTGTAAAGTTTAATGATTTG
TTTAATGAATCAAAAAATTTGAGGGCAGATGCTTTGATTACAGGTCATTATGTTAAAAGT
GTAACTAAAAATAATATAACCAACATGTATAGAGCAATTGATGAAAATCGCGATCAAAGT
TATTTTTTGTTTGATACAACTAGGGAGCAATTAAATTATTTAAGATTTCCTTTAGGCGGT
ATTTTAAAATCTGAAACTAGAGAAATAGCAAAAAAATTAGATTTAAATGTTGCAGAAAAA
CCAGATAGTCAAGATATATGTTTTGTTCCAAACGGTGATTACGTTTCAGTAATAGAAAAA
ATAAGACCAGATGCTTTTAAAAAAGGTAACATAAAAGATTTAAAAGGAAAAGTTATTGGT
GTTCACGACGGTATTGTAAATTTTACTATAGGACAAAGGAAAGGGATAAAGCTAGCTACA
AAAGACCCTTTATATGTTATTGAAATTAATGCAGATAAAAATGAAATTATTGTAGGTTCA
AAGCAGCATCTTGTTAAGAAGGAAATTTTTTTGAAAGATCTAAATTTACTTGGTAATAAA
AGAGAATTTCAAAGAGAAATTTTTGTAAAAGTAAGATCTACTGGAAAGTTACTAAAATCA
AAAATCAATATTATAAATGACAATGAGGCAATTTTAAATTTACAAGAAGAGGAATATGGT
ATCTCTCCAGGACAAGCGTGTGTTTTTTATTCCAAGGATCAAAATGGTTATAAAGTTCTT
GGTGGAGGCTGGATAAAAAAGTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
KGETPIPCVQCNKTVKFNDLFNESKNLRADALITGHYVKSVTKNNITNMYRAIDENRDQS
YFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICFVPNGDYVSVIEK
IRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIEINADKNEIIVGS
KQHLVKKEIFLKDLNLLGNKREFQREIFVKVRSTGKLLKSKINIINDNEAILNLQEEEYG
ISPGQACVFYSKDQNGYKVLGGGWIKK*

brin reverse

>ORF number 1 in reading frame 1 on the reverse strand extends from base 277 to base 462.
AATTCTCTTTTATTACCAAGTAAATTTAGATCTTTCAAAAAAATTTCCTTCTTAACAAGA
TGCTGCTTTGAACCTACAATAATTTCATTTTTATCTGCATTAATTTCAATAACATATAAA
GGGTCTTTTGTAGCTAGCTTTATCCCTTTCCTTTGTCCTATAGTAAAATTTACAATACCG
TCGTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
NSLLLPSKFRSFKKISFLTRCCFEPTIISFLSALISITYKGSFVASFIPFLCPIVKFTIP
S*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 214.
ATAAGAATGGGATTATTTTCTAGGTGTCATTTTTTTCTATTTTTTAACTTTCTTATGTGG
GAAAAAAAGAAAAGCTTAATTACTTTTTTATCCAGCCTCCACCAAGAACTTTATAACCAT
TTTGATCCTTGGAATAAAAAACACACGCTTGTCCTGGAGAGATACCATATTCCTCTTCTT
GTAAATTTAAAATTGCCTCATTGTCATTTATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
IRMGLFSRCHFFLFFNFLMWEKKKSLITFLSSLHQELYNHFDPWNKKHTLVLERYHIPLL
VNLKLPHCHL*

No ORFs were found in reading frame 3.


-----------------------------ATG-----------------------------------

brin direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 147 to base 806.
ATGTATAGAGCAATTGATGAAAATCGCGATCAAAGTTATTTTTTGTTTGATACAACTAGG
GAGCAATTAAATTATTTAAGATTTCCTTTAGGCGGTATTTTAAAATCTGAAACTAGAGAA
ATAGCAAAAAAATTAGATTTAAATGTTGCAGAAAAACCAGATAGTCAAGATATATGTTTT
GTTCCAAACGGTGATTACGTTTCAGTAATAGAAAAAATAAGACCAGATGCTTTTAAAAAA
GGTAACATAAAAGATTTAAAAGGAAAAGTTATTGGTGTTCACGACGGTATTGTAAATTTT
ACTATAGGACAAAGGAAAGGGATAAAGCTAGCTACAAAAGACCCTTTATATGTTATTGAA
ATTAATGCAGATAAAAATGAAATTATTGTAGGTTCAAAGCAGCATCTTGTTAAGAAGGAA
ATTTTTTTGAAAGATCTAAATTTACTTGGTAATAAAAGAGAATTTCAAAGAGAAATTTTT
GTAAAAGTAAGATCTACTGGAAAGTTACTAAAATCAAAAATCAATATTATAAATGACAAT
GAGGCAATTTTAAATTTACAAGAAGAGGAATATGGTATCTCTCCAGGACAAGCGTGTGTT
TTTTATTCCAAGGATCAAAATGGTTATAAAGTTCTTGGTGGAGGCTGGATAAAAAAGTAA


>Translation of ORF number 1 in reading frame 3 on the direct strand.
MYRAIDENRDQSYFLFDTTREQLNYLRFPLGGILKSETREIAKKLDLNVAEKPDSQDICF
VPNGDYVSVIEKIRPDAFKKGNIKDLKGKVIGVHDGIVNFTIGQRKGIKLATKDPLYVIE
INADKNEIIVGSKQHLVKKEIFLKDLNLLGNKREFQREIFVKVRSTGKLLKSKINIINDN
EAILNLQEEEYGISPGQACVFYSKDQNGYKVLGGGWIKK*


brin reverse

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 8 to base 214.
ATGGGATTATTTTCTAGGTGTCATTTTTTTCTATTTTTTAACTTTCTTATGTGGGAAAAA
AAGAAAAGCTTAATTACTTTTTTATCCAGCCTCCACCAAGAACTTTATAACCATTTTGAT
CCTTGGAATAAAAAACACACGCTTGTCCTGGAGAGATACCATATTCCTCTTCTTGTAAAT
TTAAAATTGCCTCATTGTCATTTATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MGLFSRCHFFLFFNFLMWEKKKSLITFLSSLHQELYNHFDPWNKKHTLVLERYHIPLLVN
LKLPHCHL*

No ORFs were found in reading frame 3.