ORF TK17720

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160119.1
Annotathon code: ORF_TK17720
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : amcha
Annotated on : 2008-03-19 18:52:37
  • INNOCENTI charlene
  • Maradji amandine

Synopsis

Genomic Sequence

>AACY01160119.1 ORF_TK17720 genomic DNA
AAAACCGGGCTGGGGTCAGCTCCAAAAACAATTGTCGAGCTGATCGATGAGCGGGTTGACGTTACGGCTCAAGCCTTAAATCAGCCAAAAGATGAGGTCT
TCAAAAAGTTCATGCAGGGATCAATACCGTTGCTATCGCTTGGCGGCGTAACTTTGCTTGACACTGGGGCTGCACAAACAAATATGGAGGCGGCTGATGG
TCAAGATACTTAAAGAAGGGTTTAAATCATTAGCAGAAGCCACTCGCAAAGCCGAGAACAGAGCGCACGGCATGAAAGTGCCGGATAATGACGTTACCAA
AACGCAAAGCGGTGACCTTGTTATCAAGGCGATGCCAAACGAAGACCTCCAGCTTTTAAATGAATCACTAGCCAAAAACGCTGGCATCAGCAAAGGGTTA
AACCTGGGCCGTATCGGTGACATATTTGAGCTAGAGGGCTTCAACGACATTGTCTTTAATGTTGCTGATGGTGATTTTGGTCTAACTAAAGTTTTAGAAA
ATATAAAAAAGAATAACAAAGAGGTTTTCGATTATCTCAAGCGTGACACCAAGTCGATGGACGATTTGATGAAACTTGCCAACGCTACTGGGTATGAGGG
GATTATCTATAAAATGCTTGGCCGCAAAGCCGGTGATGTAGCCCCGGCAGAAGACACGCTAGCTGGTATTGTAGCTATGATAAAGTTTGGCAAAGAAATT
GAGGCGTTAGCAAAAACAGGGGCCAAGGCAACAGATATAGCTGCCAAAGAAGAAGCGTTTAAAAAGATGCGGCTGCTGGCAACAATTCAGTCTAACCTCG
CCGCGCAAGTGTCTGGAAATGTTAGTGAATATGGACGCGGCCTTGCTGTGGTTCGGCATCTGTCAACAATTGATATTGATG

Translation

[152 - 880/881]   direct strand


Phylogeny


Annotator commentaries

On a fait un blastp vs nr et un blastX vs nr puis une recherche de domaines avec chacun des ORFs trouvés dans la rubrique recherche d'ORFs et nous n'avons rien obtenu de significatif, aucun domaine protéique pertinant.

Notre sequence semble donc être non codante.


Multiple Alignement


BLAST

BLASTP 2.2.15 [Oct-15-2006] 

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1165153791-21912-169737081736.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,198,544 sequences; 1,444,632,299 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  Translation of ORF number 1 in reading frame 2 on the direct strand.
Length=243

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|57238793|ref|YP_179929.1|  5-aminolevulinate synthase [Ehrl...  35.8    1.9   
gi|58578718|ref|YP_196930.1|  5-aminolevulinate synthase [Ehrl...  35.8    1.9   
gi|42782830|ref|NP_980077.1|  glyoxylase family protein [Bacil...  35.8    2.0   
gi|30263749|ref|NP_846126.1|  glyoxylase family protein [Bacil...  34.3    4.9   
gi|115617205|ref|XP_001203518.1|  PREDICTED: similar to ENSANG...  33.9    6.1   
gi|49478939|ref|YP_037813.1|  glyoxylase family protein [Bacil...  33.9    6.4   
gi|89207787|ref|ZP_01186319.1|  Glyoxalase/bleomycin resistanc...  33.9    6.9  

Alignments
     
>gi|57238793|ref|YP_179929.1|  5-aminolevulinate synthase [Ehrlichia ruminantium str. Welgevonden]
 gi|57160872|emb|CAH57774.1|  5-aminolevulinic acid synthase [Ehrlichia ruminantium str. Welgevonden]
Length=398

 Score = 35.8 bits (81),  Expect = 1.9, Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 60/129 (46%), Gaps = 2/129 (1%)

Query  112  TKVLENIKKNNKEVFDYLKRDTKSMDDLMKLANATGYEGIIYKMLGRKAGDVAPAEDT--  169
            + ++E I+ + +E + +   D   ++DL+K  + +  + II++ L    G++AP  +   
Sbjct  139  SSMIEGIRGSKREKYIFKHNDVNHLEDLLKSVDKSLPKIIIFESLYSMDGNIAPIAEICY  198

Query  170  LAGIVAMIKFGKEIEALAKTGAKATDIAAKEEAFKKMRLLATIQSNLAAQVSGNVSEYGR  229
            LA     + +  E+ A+   G +   I+ +E    K+ ++    S     + G ++    
Sbjct  199  LANKYGAMTYLDEVHAVGMYGERGGGISEQENLSDKITIIQGTLSKAYGVMGGYIAGSKS  258

Query  230  GLAVVRHLS  238
             + V+R  +
Sbjct  259  LVDVIRSFA  267


>gi|58578718|ref|YP_196930.1|  5-aminolevulinate synthase [Ehrlichia ruminantium str. Welgevonden]
 gi|58616780|ref|YP_195979.1|  5-aminolevulinate synthase [Ehrlichia ruminantium str. Gardel]
 gi|58416392|emb|CAI27505.1|  5-aminolevulinic acid synthase [Ehrlichia ruminantium str. Gardel]
 gi|58417344|emb|CAI26548.1|  5-aminolevulinic acid synthase [Ehrlichia ruminantium str. Welgevonden]
Length=404

 Score = 35.8 bits (81),  Expect = 1.9, Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 60/129 (46%), Gaps = 2/129 (1%)

Query  112  TKVLENIKKNNKEVFDYLKRDTKSMDDLMKLANATGYEGIIYKMLGRKAGDVAPAEDT--  169
            + ++E I+ + +E + +   D   ++DL+K  + +  + II++ L    G++AP  +   
Sbjct  145  SSMIEGIRGSKREKYIFKHNDVNHLEDLLKSVDKSLPKIIIFESLYSMDGNIAPIAEICY  204

Query  170  LAGIVAMIKFGKEIEALAKTGAKATDIAAKEEAFKKMRLLATIQSNLAAQVSGNVSEYGR  229
            LA     + +  E+ A+   G +   I+ +E    K+ ++    S     + G ++    
Sbjct  205  LANKYGAMTYLDEVHAVGMYGERGGGISEQENLSDKITIIQGTLSKAYGVMGGYIAGSKS  264

Query  230  GLAVVRHLS  238
             + V+R  +
Sbjct  265  LVDVIRSFA  273


>gi|42782830|ref|NP_980077.1|  glyoxylase family protein [Bacillus cereus ATCC 10987]
 gi|42738757|gb|AAS42685.1|  glyoxylase family protein [Bacillus cereus ATCC 10987]
Length=129

 Score = 35.8 bits (81),  Expect = 2.0, Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 9/78 (11%)

Query  81   KGLNLGRIGDIFELEGFNDIVFNVADGDFGL--TKVLENI-----KKNNKEVFDYLKRDT  133
            KGL L RIG+ ++ EG++ ++F + D ++ L  T+ ++        K+N  VF Y+  D+
Sbjct  25   KGLGLKRIGEFYDHEGYDGVMFGLPDEEYHLEFTRHIDGSPCPAPTKDNLLVF-YMHEDS  83

Query  134  KSMDDLMKLANATGYEGI  151
            + M  + K  +A GY+ +
Sbjct  84   E-MKKVSKRLHALGYDEV  100


>gi|30263749|ref|NP_846126.1|  glyoxylase family protein [Bacillus anthracis str. Ames]
 gi|47529168|ref|YP_020517.1|  glyoxylase family protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49186594|ref|YP_029846.1|  glyoxylase family protein [Bacillus anthracis str. Sterne]
 gi|65321072|ref|ZP_00394031.1|  COG0346: Lactoylglutathione lyase and related lyases [Bacillus 
anthracis str. A2012]
 gi|30258393|gb|AAP27612.1|  glyoxylase family protein [Bacillus anthracis str. Ames]
 gi|47504316|gb|AAT32992.1|  glyoxylase family protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49180521|gb|AAT55897.1|  glyoxylase family protein [Bacillus anthracis str. Sterne]
Length=134

 Score = 34.3 bits (77),  Expect = 4.9, Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 9/78 (11%)

Query  81   KGLNLGRIGDIFELEGFNDIVFNVADGDFGL--TKVLENI-----KKNNKEVFDYLKRDT  133
            KGL L RIG+ ++ EG++ ++F + D ++ L  T+ ++        K+N  VF Y+  D+
Sbjct  25   KGLGLKRIGEFYDHEGYDGVMFGLPDEEYHLEFTRHIDGSPCPAPTKDNLLVF-YMSEDS  83

Query  134  KSMDDLMKLANATGYEGI  151
            + M  + K  +  GY+ +
Sbjct  84   E-MKKMSKRLHTLGYDEV  100


>gi|115617205|ref|XP_001203518.1|  PREDICTED: similar to ENSANGP00000018221, partial [Strongylocentrotus 
purpuratus]
 gi|115623790|ref|XP_799236.2|  PREDICTED: similar to ENSANGP00000018221, partial [Strongylocentrotus 
purpuratus]
Length=359

 Score = 33.9 bits (76),  Expect = 6.1, Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query  105  ADGDFGLTKVLENIKKNNKEVFDYLKRDTKSMDDL------------MKLANATGYEGII  152
            A+GD  L K    ++ N    +DY+ R  KS   L             K A   G +GII
Sbjct  200  AEGDSKLIKYFRKMQYNPTATWDYI-RWMKSQTSLPIVCKGILTSESAKAAADAGVDGII  258

Query  153  YKMLGRKAGDVAPAE-DTLAGIVAMIKFGKEIEALAKTGAK-ATDI  196
                G +  D APA  D LA +V  ++ G++IE     G +  TD+
Sbjct  259  VSAHGGRQMDGAPAPIDALAEVVDAVR-GRDIEVYMDGGVRTGTDV  303


>gi|49478939|ref|YP_037813.1|  glyoxylase family protein [Bacillus thuringiensis serovar konkukian 
str. 97-27]
 gi|52141741|ref|YP_085087.1|  glyoxylase family protein [Bacillus cereus E33L]
 gi|49330495|gb|AAT61141.1|  glyoxylase family protein [Bacillus thuringiensis serovar konkukian 
str. 97-27]
 gi|51975210|gb|AAU16760.1|  glyoxylase family protein [Bacillus cereus E33L]
Length=134

 Score = 33.9 bits (76),  Expect = 6.4, Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 9/78 (11%)

Query  81   KGLNLGRIGDIFELEGFNDIVFNVADGDFGL--TKVLENI-----KKNNKEVFDYLKRDT  133
            KGL L RIG+ ++ EG++ ++F + D ++ L  T+ ++        K+N  VF Y+  D+
Sbjct  25   KGLGLKRIGEFYDHEGYDGVMFGLPDEEYHLEFTRHIDGSPCPAPTKDNLLVF-YMSEDS  83

Query  134  KSMDDLMKLANATGYEGI  151
            + M  + K  +  GY+ +
Sbjct  84   E-MKKVSKRLHTLGYDEV  100


>gi|89207787|ref|ZP_01186319.1|  Glyoxalase/bleomycin resistance protein/dioxygenase [Bacillus 
weihenstephanensis KBAB4]
 gi|89154286|gb|EAR74323.1|  Glyoxalase/bleomycin resistance protein/dioxygenase [Bacillus 
weihenstephanensis KBAB4]
Length=129

 Score = 33.9 bits (76),  Expect = 6.9, Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 9/75 (12%)

Query  81   KGLNLGRIGDIFELEGFNDIVFNVADGDFGL--TKVLENI-----KKNNKEVFDYLKRDT  133
            KGL L RIG+ +  EG++ ++F + D ++ L  T+ ++        K+N  VF Y++ D+
Sbjct  25   KGLGLKRIGEFYGHEGYDGVMFGLPDEEYHLEFTRYIDGSPCPAPTKDNLLVF-YMREDS  83

Query  134  KSMDDLMKLANATGY  148
            + M  + K  +  GY
Sbjct  84   E-MKKVSKRLHTMGY  97


BLASTX 2.2.15 [Oct-15-2006] 

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1165240091-18996-104560550590.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,201,456 sequences; 1,445,405,603 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  ORF number 1 in reading frame 2 on the direct strand extends from base 
152 to base 880.
Length=729

 Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|117621851|ref|YP_854487.1|  hypothetical protein BAPKO_5516...  39.3    0.18  
gi|56560998|ref|YP_161414.1|  hypothetical protein BGP129 [Bor...  38.9    0.23 
gi|56560892|ref|YP_161312.1|  hypothetical protein BGP027 [Bor...  38.9    0.23 
gi|5453178|gb|AAD43467.1|AF113608_1  UspA1 [Moraxella catarrhalis  36.6    1.1  
gi|42782830|ref|NP_980077.1|  glyoxylase family protein [Bacil...  35.8    2.0   
gi|58578718|ref|YP_196930.1|  5-aminolevulinate synthase [Ehrl...  35.8    2.0   
gi|57238793|ref|YP_179929.1|  5-aminolevulinate synthase [Ehrl...  35.8    2.0   
gi|74025566|ref|XP_829349.1|  hypothetical protein Tb11.52.000...  35.8    2.0   
gi|47568764|ref|ZP_00239459.1|  membrane protein, MmpL family,...  35.4    2.5  
gi|88602913|ref|YP_503091.1|  methyl-accepting chemotaxis sens...  35.0    3.3   
gi|52142573|ref|YP_084257.1|  conserved hypothetical protein; ...  35.0    3.3   
gi|11498022|ref|NP_069246.1|  signal-transducing histidine kin...  35.0    3.3   
gi|30263749|ref|NP_846126.1|  glyoxylase family protein [Bacil...  35.0    3.3   
gi|118028956|ref|ZP_01500417.1|  PpiC-type peptidyl-prolyl cis...  34.7    4.3  
gi|115372852|ref|ZP_01460157.1|  DifA protein [Stigmatella aur...  34.7    4.3  
gi|13111594|gb|AAK12392.1|AF296098_1  polyprotein [Porcine tescho  34.7    4.3  
gi|49478939|ref|YP_037813.1|  glyoxylase family protein [Bacil...  34.7    4.3   
gi|29165184|emb|CAD67982.1|  variable membrane protein precursor   34.7    4.3  
gi|545660|gb|AAB30051.1|  Hkr1p [Saccharomyces cerevisiae]         34.3    5.7  
gi|6320628|ref|NP_010708.1|  Serine/threonine rich cell surfac...  34.3    5.7   
gi|15828753|ref|NP_326113.1|  LIPOPROTEIN [Mycoplasma pulmonis...  34.3    5.7   
gi|117673663|ref|ZP_01496721.1|  hypothetical protein YpseI_02...  34.3    5.7  
gi|67482131|ref|XP_656415.1|  hypothetical protein 13.t00005 [...  34.3    5.7   
gi|113940238|ref|ZP_01426076.1|  Copper-translocating P-type A...  33.9    7.4  
gi|91787604|ref|YP_548556.1|  Uncharacterized protein UPF0065 ...  33.9    7.4   
gi|91783524|ref|YP_558730.1|  Putative PpiC-type peptidyl-prol...  33.9    7.4   
gi|82736622|ref|ZP_00899479.1|  ATPase, E1-E2 type:Copper-tran...  33.9    7.4  
gi|49185747|ref|YP_028999.1|  hypothetical protein BAS2741 [Ba...  33.9    7.4   
gi|85091281|ref|XP_958825.1|  hypothetical protein [Neurospora...  33.9    7.4   
gi|118038226|ref|ZP_01509631.1|  PpiC-type peptidyl-prolyl cis...  33.5    9.7  
gi|115617205|ref|XP_001203518.1|  PREDICTED: similar to ENSANG...  33.5    9.7   
gi|92877547|gb|ABE84625.1|  Prefoldin; t-snare; Protein kinase...  33.5    9.7  
gi|86157113|ref|YP_463898.1|  type II secretion system protein...  33.5    9.7   
gi|84489047|ref|YP_447279.1|  hypothetical protein Msp_0219 [M...  33.5    9.7   
gi|42782046|ref|NP_979293.1|  membrane protein, MmpL family, p...  33.5    9.7   
gi|18976728|ref|NP_578085.1|  beta-galactosidase [Pyrococcus f...  33.5    9.7   
gi|68075221|ref|XP_679527.1|  hypothetical protein [Plasmodium...  33.5    9.7   
gi|26554475|ref|NP_758409.1|  ABC transporter ATP-binding prot...  33.5    9.7   
gi|5545323|dbj|BAA82538.1|  ORF12 [Actinobacillus actinomycetemco  33.5    9.7  
gi|89207787|ref|ZP_01186319.1|  Glyoxalase/bleomycin resistanc...  33.5    9.7  
gi|116512420|ref|YP_809636.1|  hypothetical protein LACR_1718 ...  33.5    9.7   



ORF finding

Recherche d'ORF avec any codons par ORF Finder.

brin direct

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 213.
AAAACCGGGCTGGGGTCAGCTCCAAAAACAATTGTCGAGCTGATCGATGAGCGGGTTGAC
GTTACGGCTCAAGCCTTAAATCAGCCAAAAGATGAGGTCTTCAAAAAGTTCATGCAGGGA
TCAATACCGTTGCTATCGCTTGGCGGCGTAACTTTGCTTGACACTGGGGCTGCACAAACA
AATATGGAGGCGGCTGATGGTCAAGATACTTAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
KTGLGSAPKTIVELIDERVDVTAQALNQPKDEVFKKFMQGSIPLLSLGGVTLLDTGAAQT
NMEAADGQDT*

>ORF number 1 in reading frame 2 on the direct strand extends from base 152 to base 880.
CTTTGCTTGACACTGGGGCTGCACAAACAAATATGGAGGCGGCTGATGGTCAAGATACTT
AAAGAAGGGTTTAAATCATTAGCAGAAGCCACTCGCAAAGCCGAGAACAGAGCGCACGGC
ATGAAAGTGCCGGATAATGACGTTACCAAAACGCAAAGCGGTGACCTTGTTATCAAGGCG
ATGCCAAACGAAGACCTCCAGCTTTTAAATGAATCACTAGCCAAAAACGCTGGCATCAGC
AAAGGGTTAAACCTGGGCCGTATCGGTGACATATTTGAGCTAGAGGGCTTCAACGACATT
GTCTTTAATGTTGCTGATGGTGATTTTGGTCTAACTAAAGTTTTAGAAAATATAAAAAAG
AATAACAAAGAGGTTTTCGATTATCTCAAGCGTGACACCAAGTCGATGGACGATTTGATG
AAACTTGCCAACGCTACTGGGTATGAGGGGATTATCTATAAAATGCTTGGCCGCAAAGCC
GGTGATGTAGCCCCGGCAGAAGACACGCTAGCTGGTATTGTAGCTATGATAAAGTTTGGC
AAAGAAATTGAGGCGTTAGCAAAAACAGGGGCCAAGGCAACAGATATAGCTGCCAAAGAA
GAAGCGTTTAAAAAGATGCGGCTGCTGGCAACAATTCAGTCTAACCTCGCCGCGCAAGTG
TCTGGAAATGTTAGTGAATATGGACGCGGCCTTGCTGTGGTTCGGCATCTGTCAACAATT
GATATTGAT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
LCLTLGLHKQIWRRLMVKILKEGFKSLAEATRKAENRAHGMKVPDNDVTKTQSGDLVIKA
MPNEDLQLLNESLAKNAGISKGLNLGRIGDIFELEGFNDIVFNVADGDFGLTKVLENIKK
NNKEVFDYLKRDTKSMDDLMKLANATGYEGIIYKMLGRKAGDVAPAEDTLAGIVAMIKFG
KEIEALAKTGAKATDIAAKEEAFKKMRLLATIQSNLAAQVSGNVSEYGRGLAVVRHLSTI
DID

No ORFs were found in reading frame 3.

brin indirect
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 96 to base 275.
ATTGTTGCCAGCAGCCGCATCTTTTTAAACGCTTCTTCTTTGGCAGCTATATCTGTTGCC
TTGGCCCCTGTTTTTGCTAACGCCTCAATTTCTTTGCCAAACTTTATCATAGCTACAATA
CCAGCTAGCGTGTCTTCTGCCGGGGCTACATCACCGGCTTTGCGGCCAAGCATTTTATAG


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
IVASSRIFLNASSLAAISVALAPVFANASISLPNFIIATIPASVSSAGATSPALRPSIL*


>ORF number 2 in reading frame 3 on the reverse strand extends from base 351 to base 749.
TCGAAAACCTCTTTGTTATTCTTTTTTATATTTTCTAAAACTTTAGTTAGACCAAAATCA
CCATCAGCAACATTAAAGACAATGTCGTTGAAGCCCTCTAGCTCAAATATGTCACCGATA
CGGCCCAGGTTTAACCCTTTGCTGATGCCAGCGTTTTTGGCTAGTGATTCATTTAAAAGC
TGGAGGTCTTCGTTTGGCATCGCCTTGATAACAAGGTCACCGCTTTGCGTTTTGGTAACG
TCATTATCCGGCACTTTCATGCCGTGCGCTCTGTTCTCGGCTTTGCGAGTGGCTTCTGCT
AATGATTTAAACCCTTCTTTAAGTATCTTGACCATCAGCCGCCTCCATATTTGTTTGTGC
AGCCCCAGTGTCAAGCAAAGTTACGCCGCCAAGCGATAG

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
SKTSLLFFFIFSKTLVRPKSPSATLKTMSLKPSSSNMSPIRPRFNPLLMPAFLASDSFKS
WRSSFGIALITRSPLCVLVTSLSGTFMPCALFSALRVASANDLNPSLSILTISRLHICLC
SPSVKQSYAAKR*