ORF TD16820

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160037.1
Annotathon code: ORF_TD16820
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : Maxsmith
Annotated on : 2008-03-19 18:52:37
  • COMBEL maxime
  • MASQUELIER marion

Synopsis

Genomic Sequence

>AACY01160037.1 ORF_TD16820 genomic DNA
AGGTGCTGCATGTTTTTTACTTTTGGCAGGTCCTCCAGCCTCGACTCCTATAAATTCAATTTGTTTTTTATCGTAATCCATAAATTCATTCCAAAATCCA
AAACTTGATGAACCTCCTCCAACACAATTATAAAGCTTTACTTTTTTTGGAATAGAACCAAATTCATCCAATAACTGGACTTTGAGTTCTCTAGAAATTT
GACTTGTACTCCATCCACATATTCGAACAAAAACTGCTGGACCAACTGTACTTCCTACACACATTGCTGTTTTGTCACAGTTTGCTACCCAATACCTCAT
ACATTCTGAAACAGCATCTACAAGAGTTTGACTTCCTGAATAAACCGGCACAACTTCAGCTCCATTTTTTTTCATCGCTCTTACATTTGGTTGTTGTCTT
TGTATATCTTTTGCACCCATAAAAATCTTACATTTTAATCCAAATTTTTTTGCCGCCATACTTAACATTTTGCCTGCATACCCAGCTCCTGTATCACCAC
AAATCATTTTTTTACCTGATCTTTTTGCTAACAAACAATGCACTGTAGCATTGTATATTTTATGTGCTCCTCCATTGGCATCTGAAACTACTTTAGACCA
AATTTGTGCACCTCCAATATGTTCTGTTAGATTATTCAATTTTACAAATCTTGTTGGAGAACCTATCCAATTTTTAAAATATTTGTCCCTCTCTTTGATA
AATTTTTTATCATTTTTCAATTTATTAAATAATATTTCCAAATCTTCAATTGGTTTCTTTAATGTTTCAGGAACAAAATTTCCACCAAATTTTCCACCCC
AGAAACCAAGTTTGTTACCTTGATCGATTACTGGAATTTTTTTTCTTAGTTTCATATTTTAGCCGCTAAATTTAATAACTTA

Translation

[28 - 882/882]   indirect strand
>ORF_TD16820 Translation [28-882   indirect strand]
MKLRKKIPVIDQGNKLGFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHIGGAQIWSKVVSDANGGAHKI
YNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV
GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMDYDKKQIEFIGVEAGGPAKSKKHAAP

[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

-------------------------------------Arbre 1(pas conservé)----------------------

  +-------------AMethanoco
  +---2 
  !   !  +--------AArcheoglo
  !   +--3 
  !      ! +----AKodaKaren
  !      +-4 
  !        ! +--APyrococcu
  !        +-5 
  !          +--APyrococcu
  ! 
  1---------------------------------------ORF_TD1682
  ! 
  +----------------Neurospora 


-------------------------------------Arbre 2------------------------------------
           +------Chlorobium tepidum           (Chlorobi)
    +------2 
    !      +------Chlorobium phaeobacteroides  (Chlorobi)
    ! 
  +-8                                  +-----ORF_TD1682
  ! ! +--------------------------------1 
  ! ! !                                +---CandidatusPelagibacter (Alphaproteo)
  ! +-7 
  !   !   +----------Bacillus subtilis  (Firmicute)
  !   +---3 
  !       +---------Bacillus halodurans  (Firmicute)
  ! 
  !       +--------Stappia aggregata (Alphaproteo)
  !     +-4 
  6-----5 +-------Oceanicola granulosus (Alphaproteo)
  !     ! 
  !     +--------Rhodopseudomonas Palustris (Alphaproteo)
  ! 
  +-------------Oryza Sativa  (Eucaryote)

Annotator commentaries

Pour trouver les ORFs de notre lot, nous avons utilisé ORFfinder sur SMS. Dans un premier temps, nous avons lancé la recherche avec "any codons". Nous trouvons alors 2 ORFs en positions 2 et 3 dans le sens direct et 1 en position 1 dans le sens indirect. Ces ORFs sont placés au milieu du lot, et nous avons relancé la recherche avec ATG en tant que premier codon. Seul l'ORF dans le sens indirect en position 1 est ressorti. Nous le choisissons pour realiser notre etude car il s'agit de l'ORF le plus long. Nous n'avons pas de codon STOP car notre gene doit se prolonger en aval de notre lot. Nous avons donc une séquence codante de 208 aa sur le brin indirect, de la position 28 à la position 882 de notre lot.


Notre recherche de domaines protéiques s'est faite grace à InterproScan disponible sur le site de l'EBI.Nous obtenons 4 résultats dont 3 dans la catégorie noIPR unintegrated.Notre premier résultat nous montre la presence d'un domaine proteique appelé Pyridoxal-5'-phosphate-dependent enzyme. En ouvrant la fiche de ce résultat, on a pu remarquer que ce domaine intégrait les domaines donnés dans la partie noIPR ( Tryptophan synthase beta chain). Nous n'avons donc conservé que ce premier résultat pour le domaine protéique choisi.

Nous avons par la suite réalisé un alignement de notre séquence avec des séquences deja annotées afin de calculer un score(Evalue). Ce qui nous a permis de mettre en évidence les séquences connues se rapprochant le plus de notre séquence. Pour cela nous lancons un BLASTp sur NCBI sur la base de données SwissProt. Nous obtenons environ 100 résultats dont les 3/4 possedent une Evalue entre 1e-55 et 1e-24.Les similitudes entre notre ORF et les séquences obtenues par le BLAST restent plutot bonnes ( environ 42%).Cela nous permet d'obtenir de bonnes informations sur la fonction des homologues les plus proches de notre 0RF. Dans un deuxième temps nous avons fait un Blastp contre NR afin d'avoir plus de choix concernant les homologues présumés de notre ORF. Nous obtenons aussi de très bonnes e-values( 3e-135 pour le premier resultat avec une cassure à 8e-54 pour la suivante). Les similitudes entre notre séquence et les séquences obtenues sont bonnes (voir meme excellente pour la premiere avec 91% et environ 59% pour les autres résultats).

L'alignement multiple a été réalisé à l'aide de ClustalW, disponible sur le site de l'EBI.Notre choix des séquences pour faire notre alignement multiple s'est fait sur plusieurs criteres: l'Evalue (qui doit rester faible), les groupes d'études les plus representés dans les meilleures Evalues( nous avons choisi les bactéries), et le groupe externe ( un eucaryote: Oryza Sativa).

Nous avons fait un arbre phylogénétique avec le logiciel Phylip et par la méthode du NJ.Dans notre premier arbre, nous avons pris uniquement comme groupe d'étude les archae. Notre ORF se retrouvait à l'extérieur de ce groupe. C'est pourquoi nous avons fait un deuxieme arbre avec comme groupe d'étude les bactéries afin de placer correctement notre orf. Apres analyse de notre arbre on peut remarquer que candidatus pelagibacter(alphaproteobacterie) est l'orthologue le plus proche de notre sequence. Cela n'est pas étonnant vu les resultats obtenus dans le blast (meilleure evalue et meilleure similitude, viennent ensuite les 2 Firmicutes, les chlorobis et le groupe exterieur. les alpha proteobacteries placées au niveaux du noeud 6 ne sont pas des orthologues mais des paralogues de notre séquence. Cela serait dû à un evenement de duplication puisqu'on retrouve des alpha à deux endroits dans l'arbre.

D'aprés nos recherches, la proteine Pyridoxal 5 phosphate incluant le domaine tryptophane synthase beta chain(domaine que notre lot permet d'étudier) est une des 6 formes de la vitamine B6.Elle a une activité catalytique, et rentre dans les processus métaboliques pour la croissance cellulaire.

Multiple Alignement

CLUSTAL W (1.83) multiple sequence alignment


OceanicolaGranulosus                --------------------------------------------------
StappiaAggregata                    --------------------------------------------------
RhodopseudomonasPalustris           --------------------------------------------------
GEOryzagi|2081609|dbj|BAA19928      MAQLASAQIGSGLSAQYQSKQTKNFILACIPFKKLEMPWWRKKSADESDS 50
F1BacillusHalodurans                --------------------------------------------------
F2BacillusSubtilis                  --------------------------------------------------
C1ChlorobiumTepidum                 --------------------------------------------------
C2ChlorobiumPhaeobacteroides        --------------------------------------------------
ORF_TD16820                         --------------------------------------------------
CandidatusPelagibacter              --------------------------------------------------
                                                                                      

OceanicolaGranulosus                ------MPDDLINS----FMTGPDEKGRFG-DFGGRFVSETLMPLILQLE 39
StappiaAggregata                    ----------MANS----IRTGPDDRGHFG-IFGGRYVAETLMPLILDLE 35
RhodopseudomonasPalustris           ------MNQILPNS----FRSGPDERGHFG-IFGGRFVAETLMPLILELE 39
GEOryzagi|2081609|dbj|BAA19928      GTIAKDMHVLMAAGSDPILWQGPDSFGRFG-TFQGKYVGETLMHALSELE 99
F1BacillusHalodurans                -----------------MTVTYPDERGRFG-TFGGKYVPETLMSAIEELE 32
F2BacillusSubtilis                  ------------------MYPYPNEIGRYG-DFGGKFVPETLMQPLDEIQ 31
C1ChlorobiumTepidum                 ---------MKQKV----IYSAPDEFGHFG-TFGGKFIPETLVKNAADLE 36
C2ChlorobiumPhaeobacteroides        ----------MTQS----VYTAPDDTGHFG-KYGGKFIPETLIKNASDLE 35
ORF_TD16820                         ----------MKLRKKIPVIDQGNKLGFWGGKFGGNFVPETLKKPIEDLE 40
CandidatusPelagibacter              ----------MKLKKKIPLIDQHNKNGFWGGKFGGNFIPETLKKPIEDLT 40
                                                           :. * :*  : *.:: ***     :: 

OceanicolaGranulosus                AEYEKAKTDDSFWAEMHDLWTHYVGRPSPLYYAERLTERLG-----GAKI 84
StappiaAggregata                    QHYKDAKNDPAFKAEIESLNKHYTGRPSPLYFAERLTKELG-----GAKV 80
RhodopseudomonasPalustris           KAYAEAKDDPAFRTEMDGYLKHYVGRPSPLYFAERLTEHFG-----GAKI 84
GEOryzagi|2081609|dbj|BAA19928      SAFKKLATDDDFQRELAGILKDYVGRLSPLYFVESLTEHYRRENGTGPLI 149
F1BacillusHalodurans                LALNDAMNDEAFIHDYKEHLREYAGRPTALTYAKNMSETLG-----GAKI 77
F2BacillusSubtilis                  TAFKQIKDDPAFREEYYKLLKDYSGRPTALTYADRVTEYLG-----GAKI 76
C1ChlorobiumTepidum                 EEYLKAKNDPEFHQTLDNLLRHYVGRPTPLYHASRLSEKQG-----GAQI 81
C2ChlorobiumPhaeobacteroides        DEYKKAKEDQAFWNEYEKLLRHYVGRPTPLYHAEHLSRHIG-----GAQI 80
ORF_TD16820                         ILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHIG-----GAQI 85
CandidatusPelagibacter              ELFEKLRYDKKFLKERDYYFKNYIGSPTSFIKLQNLSDHLS-----GAQI 85
                                        .   *  *         .: *  : :   . ::         *. :

OceanicolaGranulosus                YLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATATVC 134
StappiaAggregata                    YFKRDELNHTGSHKINNCIGQILLAKRMGKTRIIAETGAGQHGVATATVC 130
RhodopseudomonasPalustris           YFKREDLNHTGAHKVNNVLGQIMLARRMGKQRIIAETGAGMHGVATATMC 134
GEOryzagi|2081609|dbj|BAA19928      YLKREDNNHTGAHKINNAVAQALSAKRLGKKRIIAETGAGQHGVATATVC 199
F1BacillusHalodurans                YLKREDLLHTGAHKLNNAMGQALLAKRMGKKKIVAETGAGQHGVATATIA 127
F2BacillusSubtilis                  YLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGVAAATVA 126
C1ChlorobiumTepidum                 WLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVATATVC 131
C2ChlorobiumPhaeobacteroides        YLKREDLCHTGAHKINNALGQALLARRMGKKRIIAETGAGQHGVATATVC 130
ORF_TD16820                         WSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAA 135
CandidatusPelagibacter              YAKMVSEANGGAHKIYNATVHCLIAKKAGKKYVVGDTGAGYAGKMLSMAA 135
                                    : *  .  : *:**: *   : : *:: **  : .:****  *   :  .

OceanicolaGranulosus                AKFGMKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDAMNDA 184
StappiaAggregata                    ARFGLPCVVYMGKTDVERQKPNVFRMKLLGAEIVPVTAGAGTLKDAMNEA 180
RhodopseudomonasPalustris           AKFGLQCVVYMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDAMNEA 184
GEOryzagi|2081609|dbj|BAA19928      ASFGLECIIYMGAQDMERQALNVFRMKLLGAEVREVHSGTATLKDATSEA 249
F1BacillusHalodurans                ARFGLECKVFMGEEDMERQALNVFRMELLGAEVVPATSGSKTLKDATNEA 177
F2BacillusSubtilis                  AKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEA 176
C1ChlorobiumTepidum                 ALFGLDCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSRTLKDATSEA 181
C2ChlorobiumPhaeobacteroides        ALFDLDCIVYMGAEDIRRQAPNVARMKLLGAEVRPVENGTKTLKDATSEA 180
ORF_TD16820                         KKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSEC 185
CandidatusPelagibacter              KKFGLKCKIFMGAKDIKRQKPNVDAMKKNGAEVVPVYSGSQTLVDAVSEC 185
                                      *.: * ::**  *: **  **  *.  *:*:  .  *  ** ** .:.

OceanicolaGranulosus                LRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQAIIGKEAKEQMQAAEGRL 234
StappiaAggregata                    LRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGKELREQMMEAEGRL 230
RhodopseudomonasPalustris           LRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQEVIGQEVREQILETEGRL 234
GEOryzagi|2081609|dbj|BAA19928      IRDWVTNVENTHYILGSVAGPHPYPMMVREFHKVIGKETRRQALEKWGGK 299
F1BacillusHalodurans                IRYWVTHADDTFYLIGSVVGPHPYPQMVRDFQRIIGDEARAQFQEITGTL 227
F2BacillusSubtilis                  IRYWVQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEGTM 226
C1ChlorobiumTepidum                 IRDWMNNPEETFYIVGSVIGMHPYPMMVRDFQSVIGRETRQQVLDQAGRL 231
C2ChlorobiumPhaeobacteroides        IRDWINNPEETFYIIGSVVGMHPYPMMVRDFQAVIGRETRQQILEQTGRL 230
ORF_TD16820                         MRYWVANCDKTAMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSI 235
CandidatusPelagibacter              MRYWVSNCDNTHMCVGSTVGPNIFVKICGWSTAQISRELKVQIQSEFKKM 235
                                    :* *: :  .    :*:. *   :  :       *. * : *        

OceanicolaGranulosus                PD--TIIAAIGGGSNAMGLFFPFLDDK--EVNIIGVEAGGKGVNDKMEHC 280
StappiaAggregata                    PD--ALVAAVGGGSNAIGLFHPFLDDK--DVKIYGVEAGGRGLQGE-EHC 275
RhodopseudomonasPalustris           PD--SLIACIGGGSNAMGLFHPFLDDA--GVVIYGVEAAGHGLSKL--HA 278
GEOryzagi|2081609|dbj|BAA19928      PD--VLVACVGGGSNAMGLFHEFVDDQ--EVRMIGVEAAGFGVDSV-KHA 344
F1BacillusHalodurans                PT--EVIACVGGGSNAIGTFYPFLED---DVKLIGVEAAGKGVETS-QHA 271
F2BacillusSubtilis                  PD--KVVACVGGGSNAMGMFQAFLNE---DVELIGAEAAGKGIDTP-LHA 270
C1ChlorobiumTepidum                 PD--VIVACVGGGSNAIGMFYEFLPDAK-EVELIGVEAAGEGLEGK--HA 276
C2ChlorobiumPhaeobacteroides        PD--VITACVGGGSNAIGMFYAFLDSAG-DIEMVGVEAAGEGLEAL--HA 275
ORF_TD16820                         PKKVKLYNCVGGGSSSFGFWNEFMDYDKKQIEFIGVEAGGPAKSKK--HA 283
CandidatusPelagibacter              PKKIKLINCVGGGSSAYGFWSEFIDYDKKQIELIGVEAGGPKNSKL--HA 283
                                    *    :  .:****.: * :  *:      : : *.**.*   .    *.

OceanicolaGranulosus                ASLTG-GRPGVLHG--NRTYLLQDDDGQILEGFSISAGLDYPGIGPEHAW 327
StappiaAggregata                    ASLTA-GKPGVLHG--NRTYLLQDDDGQILEGHSISAGLDYPGIGPEHSW 322
RhodopseudomonasPalustris           ASIAG-GKPGVLHG--NRTYLLMDDDGQIQEAHSISAGLDYPGIGPEHAW 325
GEOryzagi|2081609|dbj|BAA19928      ATLTK-GDVGVLHGSLAMSYLLQDDDGQVIEPHSISAGLDYPGVGPEHSF 393
F1BacillusHalodurans                ATITK-GRVGVIHG--SMTYLLQDDAGQITEPYSISAGLDYPGVGPEHAY 318
F2BacillusSubtilis                  ATISK-GTVGVIHG--SLTYLIQDEFGQIIEPYSISAGLDYPGIGPEHAY 317
C1ChlorobiumTepidum                 ASLTK-GEIGVLHG--SMMKLLQDEYGQVQEAHSISAGLDYPGVGPEHCY 323
C2ChlorobiumPhaeobacteroides        ASLTK-GKKGVLHG--AMMKILQDDFGQVSEAHSISAGLDYPGVGPEHCH 322
ORF_TD16820                         AP------------------------------------------------ 285
CandidatusPelagibacter              APLTNGAKLGILHG--AAAYVCQNSEGQINDTASISAGLDYPGVSPIHCF 331
                                    *.                                                

OceanicolaGranulosus                LHEIGRAEYVAITDAEALEAFQLCCETEGIIPALEPSHALAHVTKIAPTL 377
StappiaAggregata                    LKEIGRVDYVPVMDDEALEAFQMLTRVEGIIPALEPAHALAHVVKLAPQM 372
RhodopseudomonasPalustris           LHDVGRVNFLSATDAEALDAFKLCCRLEGIIPALEPAHALAKVADLAPIL 375
GEOryzagi|2081609|dbj|BAA19928      VKDMGRAEYDSATDEEALAGFKRVSRLEGIIPALETSHALAYLEKLCPTL 443
F1BacillusHalodurans                LASTGRVKYDAVTDKEALDALKQLSVHEGIIPAVESAHALAKAFERAKQL 368
F2BacillusSubtilis                  LHKSGRVTYDSITDEEAVDALKLLSEKEGILPAIESAHALAKAFKLAKGM 367
C1ChlorobiumTepidum                 LQKLGLVCYTSTTDKEALAALDALAKTEGIICALESAHAVHYAMKRAAEM 373
C2ChlorobiumPhaeobacteroides        LQELGIVHYTSATDTQALEALRLLAEKEGIICALESAHAVHYATVRAAEM 372
ORF_TD16820                         --------------------------------------------------
CandidatusPelagibacter              LKDTKRARYTSATDEAALNAYKLVTKLEKINPSLEPSHAFAEAIKIAPKL 381
                                                                                      

OceanicolaGranulosus                PKDHLICMNMCGRGDKDIFTVARALGWNMSGF- 409
StappiaAggregata                    DKDQIIVMNLCGRGDKDVFAVGQMLGFEM---- 401
RhodopseudomonasPalustris           PKDHLMVLNMSGRGDKDLASVAEHLGGKF---- 404
GEOryzagi|2081609|dbj|BAA19928      FDGTRVVFNFSGRGDKDVDTVAKSLDV------ 470
F1BacillusHalodurans                SQEESILVCLSGRGDKDVHTLMKHFRGEGHE-- 399
F2BacillusSubtilis                  DRGQLILVCLSGRGDKDVNTLMNVLEEEVKAHV 400
C1ChlorobiumTepidum                 PKESIIVVNLSGRGDKDMGTIMQELKL------ 400
C2ChlorobiumPhaeobacteroides        PKESMLIVNLSGRGDKDMETIMNRLELK----- 400
ORF_TD16820                         ---------------------------------
CandidatusPelagibacter              NKDTIIIVNSCGDAKKDRDILKERLGKIN---- 410

BLAST

BLASTP 2.2.15 [Oct-15-2006] 
Database: Non-redundant SwissProt sequences
           217,875 sequences; 82,042,039 total letters


                                                                 Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|14423982|sp|Q9V1G8|TRPB1_PYRAB  Tryptophan synthase beta chain   213    6e-55
gi|34222901|sp|Q8KF11|TRPB_CHLTE  Tryptophan synthase beta chain    212    1e-54
gi|24212542|sp|Q8U093|TRPB1_PYRFU  Tryptophan synthase beta chain   212    1e-54
gi|20140839|sp|Q9KCB0|TRPB_BACHD  Tryptophan synthase beta chain    207    2e-53
gi|136372|sp|P13228|TRP_NEUCR  Tryptophan synthase                  205    2e-52
gi|6226273|sp|O66923|TRPB1_AQUAE  Tryptophan synthase beta chain    203    4e-52
gi|39932386|sp|Q89WE5|TRPB_BRAJA  Tryptophan synthase beta chain    203    4e-52
gi|34395985|sp|P07600|TRPB_BACSU  Tryptophan synthase beta chain    203    5e-52
gi|136268|sp|P16706|TRPB_ACICA  Tryptophan synthase beta chain      201    2e-51
gi|38258737|sp|Q88B61|TRPB_PSESM  Tryptophan synthase beta chain    201    3e-51
gi|136280|sp|P11080|TRPB_PSEPU  Tryptophan synthase beta chain      199    9e-51
gi|38258743|sp|Q88RP6|TRPB_PSEPK  Tryptophan synthase beta chain    199    9e-51  
gi|33301708|sp|Q822W3|TRPB2_CHLCV  Tryptophan synthase beta chain   199    1e-50
gi|39932289|sp|Q7UKG9|TRPB_RHOBA  Tryptophan synthase beta chain    199    1e-50
gi|39932269|sp|Q7NGX9|TRPB_GLOVI  Tryptophan synthase beta chain    198    2e-50
gi|7674397|sp|Q9YGB0|TRPB1_PYRKO  Tryptophan synthase beta chain    197    2e-50  
gi|136269|sp|P19868|TRPB_BACST  Tryptophan synthase beta chain      197    3e-50
gi|24212526|sp|Q8P7R8|TRPB_XANCP  Tryptophan synthase beta chain    197    3e-50
gi|24212534|sp|Q8R9M9|TRPB_THETN  Tryptophan synthase beta chain    196    1e-49
gi|7674389|sp|Q9X4E5|TRPB_RHOS4  Tryptophan synthase beta chain     194    2e-49  
gi|12230946|sp|P07345|TRPB_PSEAE  Tryptophan synthase beta chain    194    2e-49
gi|24212528|sp|Q8PJ28|TRPB_XANAC  Tryptophan synthase beta chain    194    3e-49
gi|39932411|sp|Q8ESU4|TRPB_OCEIH  Tryptophan synthase beta chain    194    3e-49
gi|24212578|sp|Q97EF5|TRPB_CLOAB  Tryptophan synthase beta chain    194    3e-49
gi|38258731|sp|Q849P2|TRPB_PSESH  Tryptophan synthase beta chain    194    4e-49
gi|3915157|sp|O13831|TRP_SCHPO  Tryptophan synthase                 193    5e-49
gi|34222824|sp|Q84GJ9|TRPB_NEIGO  Tryptophan synthase beta chain    192    1e-48
gi|39932276|sp|Q7NUD8|TRPB_CHRVO  Tryptophan synthase beta chain    192    1e-48
gi|136278|sp|P14638|TRPB_METVO  Tryptophan synthase beta chain      191    2e-48
gi|20140604|sp|Q8Y6Q6|TRPB_LISMO  Tryptophan synthase beta chain    191    3e-48
gi|20140602|sp|Q8XXY0|TRPB_RALSO  Tryptophan synthase beta chain    191    3e-48
gi|24212590|sp|Q9JVC0|TRPB_NEIMA  Tryptophan synthase beta chain    191    3e-48
gi|136282|sp|P16609|TRPB_THET2  Tryptophan synthase beta chain      191    3e-48
gi|3334387|sp|O28672|TRPB1_ARCFU  Tryptophan synthase beta chain    190    4e-48
gi|24212556|sp|Q8YZP7|TRPB1_ANASP  Tryptophan synthase beta chain   189    7e-48  
gi|464937|sp|P34817|TRPB_PSESY  Tryptophan synthase beta chain      189    7e-48
gi|24212591|sp|Q9K0B5|TRPB_NEIMB  Tryptophan synthase beta chain    189    8e-48
gi|20140655|sp|Q92B81|TRPB_LISIN  Tryptophan synthase beta chain    189    9e-48
gi|67461974|sp|Q71Z40|TRPB_LISMF  Tryptophan synthase beta chain    189    9e-48  
gi|32130278|sp|Q87DR9|TRPB_XYLFT  Tryptophan synthase beta chain    189    1e-47  
gi|3915165|sp|O50046|TRPB_CAMAC  Tryptophan synthase beta chain 2   188    1e-47
gi|39932279|sp|Q7TUH0|TRPB_PROMP  Tryptophan synthase beta chain    188    2e-47  
gi|24212595|sp|Q9PDK4|TRPB_XYLFA  Tryptophan synthase beta chain    187    3e-47
gi|39932396|sp|Q8DNM8|TRPB_STRR6  Tryptophan synthase beta chain    187    4e-47  
gi|24212554|sp|Q8YQM6|TRPB2_ANASP  Tryptophan synthase beta chain   186    6e-47  
gi|1174780|sp|P43284|TRPB2_MAIZE  Tryptophan synthase beta cha...   186    8e-47  
gi|24212580|sp|Q97P32|TRPB_STRPN  Tryptophan synthase beta chain    186    9e-47
gi|1174779|sp|P25269|TRBP2_ARATH  Tryptophan synthase beta chain    185    1e-46  
gi|3334383|sp|O27696|TRPB1_METTH  Tryptophan synthase beta chain    184    2e-46  
gi|1174778|sp|P43283|TRPB1_MAIZE  Tryptophan synthase beta chain    184    3e-46  
gi|2501412|sp|Q60179|TRPB_METJA  Tryptophan synthase beta chain     184    3e-46
gi|24212535|sp|Q8RGH8|TRPB_FUSNN  Tryptophan synthase beta chain    184    3e-46
gi|22002074|sp|P06561|TRPB_CORGL  Tryptophan synthase beta chain    184    3e-46
gi|39932417|sp|Q8FLJ6|TRPB1_COREF  Tryptophan synthase beta chain   184    3e-46
gi|136373|sp|P00931|TRP_YEAST  Tryptophan synthase                  184    4e-46  
gi|34222853|sp|Q8DG49|TRPB_SYNEL  Tryptophan synthase beta chain    182    9e-46
gi|39932249|sp|Q7M8W7|TRPB2_WOLSU  Tryptophan synthase beta chain   182    1e-45
gi|39932405|sp|Q8ECV0|TRPB_SHEON  Tryptophan synthase beta chain    182    1e-45
gi|136251|sp|P14671|TRPB1_ARATH  Tryptophan synthase beta chain 1   181    2e-45  
gi|56749742|sp|Q6GH33|TRPB_STAAR  Tryptophan synthase beta chain    181    3e-45  
gi|6226274|sp|O84172|TRPB_CHLTR  Tryptophan synthase beta chain     181    3e-45
gi|54039760|sp|P66987|TRPB_STAAN  Tryptophan synthase beta cha...   181    3e-45  
gi|24212525|sp|Q8NWU2|TRPB_STAAW  Tryptophan synthase beta cha...   181    3e-45  
gi|38258754|sp|Q88WI0|TRPB_LACPL  Tryptophan synthase beta chain    181    3e-45
gi|39932323|sp|Q7W5G8|TRPB_BORPA  Tryptophan synthase beta cha...   180    4e-45
gi|39932429|sp|Q8PT95|TRPB1_METMA  Tryptophan synthase beta chain   180    6e-45
gi|20140723|sp|Q98CN7|TRPB_RHILO  Tryptophan synthase beta chain    180    6e-45
gi|39932264|sp|Q7N486|TRPB_PHOLL  Tryptophan synthase beta chain    179    1e-44
gi|39932317|sp|Q7VTF1|TRPB_BORPE  Tryptophan synthase beta chain    179    1e-44
gi|56749713|sp|Q6G9I7|TRPB_STAAS  Tryptophan synthase beta chain    179    1e-44  
gi|38258790|sp|Q8FXY4|TRPB_BRUSU  Tryptophan synthase beta chain    179    1e-44
gi|20140677|sp|Q92TC9|TRPB_RHIME  Tryptophan synthase beta chain    178    2e-44
gi|20140579|sp|Q8X7B6|TRPB_ECO57  Tryptophan synthase beta chain    178    2e-44
gi|67473583|sp|P0A879|TRPB_ECOLI  Tryptophan synthase beta cha...   178    2e-44
gi|29428205|sp|Q8FHV9|TRPB_ECOL6  Tryptophan synthase beta chain    178    2e-44
gi|7674380|sp|P56929|TRPB_RHIET  Tryptophan synthase beta chain     178    2e-44
gi|61248983|sp|P0A2K1|TRPB_SALTY  Tryptophan synthase beta cha...   178    2e-44
gi|24212545|sp|Q8UJB0|TRPB_AGRT5  Tryptophan synthase beta chain    177    3e-44  
gi|38258945|sp|Q8YE60|TRPB_BRUME  Tryptophan synthase beta chain    177    5e-44
gi|39932351|sp|Q82A82|TRPB_STRAW  Tryptophan synthase beta chain    176    8e-44
gi|39932346|sp|Q81TL8|TRPB_BACAN  Tryptophan synthase beta chain    176    8e-44
gi|39932360|sp|Q82WI2|TRPB_NITEU  Tryptophan synthase beta chain    176    8e-44
gi|39932306|sp|Q7VE26|TRPB_PROMA  Tryptophan synthase beta chain    176    1e-43
gi|39932399|sp|Q8DVF3|TRPB_STRMU  Tryptophan synthase beta chain    175    1e-43
gi|24212537|sp|Q8TLP3|TRPB1_METAC  Tryptophan synthase beta chain   175    2e-43
gi|39932343|sp|Q81GG5|TRPB_BACCR  Tryptophan synthase beta chain    175    2e-43  
gi|136276|sp|P17167|TRPB_LACCA  Tryptophan synthase beta chain      174    3e-43
gi|1174784|sp|P42391|TRPB_BUCAP  Tryptophan synthase beta chain     174    4e-43
gi|71658021|sp|Q6AF67|TRPB_LEIXX  Tryptophan synthase beta chain    174    4e-43
gi|267168|sp|Q01998|TRPB_LACLA  Tryptophan synthase beta chain      174    4e-43
gi|6226276|sp|O05625|TRPB_STRCO  Tryptophan synthase beta chain     173    5e-43
gi|29611947|sp|P22097|TRPB1_VIBPA  Tryptophan synthase beta chain   173    5e-43
gi|24212560|sp|Q8ZEG9|TRPB_YERPE  Tryptophan synthase beta chain    173    6e-43
gi|39932278|sp|Q7TTS6|TRPB_SYNPX  Tryptophan synthase beta chain    173    7e-43  
gi|1717761|sp|P50909|TRPB1_THEMA  Tryptophan synthase beta chain    172    9e-43
gi|1174785|sp|P43760|TRPB_HAEIN  Tryptophan synthase beta chain     172    1e-42
gi|24212593|sp|Q9KST6|TRPB_VIBCH  Tryptophan synthase beta chain    172    1e-42
gi|24212600|sp|Q9RVT1|TRPB_DEIRA  Tryptophan synthase beta chain    171    2e-42
gi|29611888|sp|Q8D8B2|TRPB_VIBVU  Tryptophan synthase beta cha...   171    2e-42
gi|54039759|sp|P66985|TRPB_MYCBO  Tryptophan synthase beta cha...   171    2e-42
gi|136277|sp|P26921|TRPB_METTM  Tryptophan synthase beta chain      171    3e-42
gi|2822116|sp|P16578|TRP_COPCI  Tryptophan synthase                 170    6e-42
gi|39932280|sp|Q7TUL2|TRPB_PROMM  Tryptophan synthase beta chain    169    8e-42  
gi|24212539|sp|Q8TX91|TRPB_METKA  Tryptophan synthase beta chain    169    9e-42
gi|32130292|sp|Q8CPB1|TRPB_STAES  Tryptophan synthase beta cha...   169    9e-42  
gi|39932307|sp|Q7VGA7|TRPB_HELHP  Tryptophan synthase beta chain    169    1e-41
gi|136274|sp|P18285|TRPB_HALVO  Tryptophan synthase beta chain      168    2e-41
gi|136272|sp|P12290|TRPB_CAUCR  Tryptophan synthase beta chain      168    2e-41
gi|13432266|sp|P54203|TRPB_PASMU  Tryptophan synthase beta chain    166    1e-40
gi|18202770|sp|Q9CC54|TRPB_MYCLE  Tryptophan synthase beta chain    166    1e-40
gi|39932419|sp|Q8FT12|TRPB2_COREF  Tryptophan synthase beta chain   166    1e-40
gi|2501413|sp|Q59992|TRPB_SYNY3  Tryptophan synthase beta chain     163    5e-40  
gi|7674376|sp|O68428|TRPB_BUCDN  Tryptophan synthase beta chain     163    7e-40
gi|6226275|sp|O68905|TRPB_MYCIT  Tryptophan synthase beta chain     160    4e-39
gi|7674399|sp|Q9ZJU9|TRPB_HELPJ  Tryptophan synthase beta chain     159    7e-39  
gi|2501411|sp|P56142|TRPB_HELPY  Tryptophan synthase beta chain     159    1e-38
gi|29428170|sp|P59458|TRPB_BUCBP  Tryptophan synthase beta chain    159    1e-38
gi|33301712|sp|Q822W9|TRPB1_CHLCV  Tryptophan synthase beta chain   158    2e-38
gi|39932251|sp|Q7M9S1|TRPB1_WOLSU  Tryptophan synthase beta chain   154    4e-37
gi|11182450|sp|Q44685|TRPB_BUCAI  Tryptophan synthase beta chain    153    5e-37
gi|39932413|sp|Q8F149|TRPB_LEPIN  Tryptophan synthase beta cha...   152    9e-37
gi|14423973|sp|Q9HSC0|TRPB_HALSA  Tryptophan synthase beta chain    152    2e-36
gi|39932390|sp|Q8AAD2|TRPB_BACTN  Tryptophan synthase beta chain    151    2e-36
gi|7674387|sp|Q59169|TRPB_BUCSC  Tryptophan synthase beta chain     151    2e-36
gi|7674385|sp|Q44687|TRPB_BUCMH  Tryptophan synthase beta chain     148    2e-35
gi|39932314|sp|Q7VR00|TRPB_BLOFL  Tryptophan synthase beta chain    144    4e-34  
gi|24212597|sp|Q9PIF2|TRPB_CAMJE  Tryptophan synthase beta cha...   142    1e-33
gi|31077038|sp|Q9RCE8|TRPB_VIBME  Tryptophan synthase beta chain    141    3e-33
gi|39932378|sp|Q87IM1|TRPB2_VIBPA  Tryptophan synthase beta chain   136    7e-32
gi|7674384|sp|Q44686|TRPB_BUCRM  Tryptophan synthase beta chain     115    2e-25
gi|7674386|sp|Q44688|TRPB_BUCRP  Tryptophan synthase beta chain     111    2e-24
gi|24212543|sp|Q8U0J5|TRPB2_PYRFU  Tryptophan synthase beta chain  68.2    3e-11
gi|24212576|sp|Q97A51|TRPB_THEVO  Tryptophan synthase beta chain   66.2    1e-10
gi|24212571|sp|Q970N1|TRPB2_SULTO  Tryptophan synthase beta chain  64.3    5e-10
gi|14424473|sp|P50383|TRPB1_SULSO  Tryptophan synthase beta chain  63.5    7e-10
gi|7674373|sp|O59265|TRPB_PYRHO  Tryptophan synthase beta chain    62.4    2e-09
gi|24212581|sp|Q97TX6|TRPB2_SULSO  Tryptophan synthase beta chain  62.0    2e-09
gi|73920133|sp|Q6L271|TRPB_PICTO  Tryptophan synthase beta chain   60.5    7e-09
gi|7674388|sp|Q9WZ09|TRPB2_THEMA  Tryptophan synthase beta chain   59.7    1e-08
gi|13878841|sp|Q9HKD2|TRPB_THEAC  Tryptophan synthase beta chain   59.7    1e-08
gi|7674393|sp|Q9Y8T5|TRPB1_AERPE  Tryptophan synthase beta chain   56.6    8e-08
gi|7674372|sp|O29028|TRPB2_ARCFU  Tryptophan synthase beta chain   56.6    9e-08
gi|7674371|sp|O27520|TRPB2_METTH  Tryptophan synthase beta chain   55.5    2e-07  
gi|24212572|sp|Q971Z5|TRPB1_SULTO  Tryptophan synthase beta chain  54.7    4e-07
gi|14423981|sp|Q9V150|TRPB2_PYRAB  Tryptophan synthase beta chain  54.3    4e-07
gi|24212562|sp|Q8ZV44|TRPB_PYRAE  Tryptophan synthase beta chain   54.3    5e-07
gi|7674374|sp|O67409|TRPB2_AQUAE  Tryptophan synthase beta chain   53.1    9e-07
gi|73920132|sp|Q5JDJ1|TRPB2_PYRKO  Tryptophan synthase beta chain  50.1    9e-06  
gi|7674395|sp|Q9Y9H2|TRPB2_AERPE  Tryptophan synthase beta chain   49.7    1e-05
gi|24212531|sp|Q8Q001|TRPB2_METMA  Tryptophan synthase beta chain  45.8    2e-04
gi|24212536|sp|Q8TL44|TRPB2_METAC  Tryptophan synthase beta chain  42.4    0.002
gi|60389610|sp|Q6GAB8|DLDH_STAAS  Dihydrolipoyl dehydrogenase ...  38.5    0.029  
gi|20978805|sp|O94404|YJ3C_SCHPO  UPF0135 protein C126.12          32.7    1.5  
gi|549627|sp|P36148|GPT2_YEAST  Glycerol-3-phosphate O-acyltra...  32.3    1.7    
gi|74583564|sp|Q06629|HDA2_YEAST  HDA1 complex subunit 2 (Hist...  32.0    2.6    
gi|60416388|sp|Q24592|JAK_DROME  Tyrosine-protein kinase hopscotc  31.6    2.8    
gi|62286586|sp|O59701|CYSK1_SCHPO  Cysteine synthase 1 (O-acet...  31.6    2.9  
gi|18203091|sp|Q9J5C4|V096_FOWPV  Protein FPV096                   31.2    4.7    
gi|465963|sp|P34510|YMX2_CAEEL  Hypothetical protein K06H7.2       30.4    6.6    
gi|118671|sp|P11959|DLDH1_BACST  Dihydrolipoyl dehydrogenase (...  30.4    6.7  
gi|75028407|sp|Q9XUM6|BAT34_CAEEL  BTB and MATH domain-containing  30.0    9.6    



>gi|14423982|sp|Q9V1G8|TRPB1_PYRAB  Tryptophan synthase beta chain 1
Length=388

 Score =  213 bits (542),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 115/267 (43%), Positives = 163/267 (61%), Gaps = 5/267 (1%)

Query  19   WGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTE  78
            W GKFGG +VPETL +P+ +LE  + +LKND++F ++ D Y + W G PT       LT+
Sbjct  2    WFGKFGGQYVPETLMEPLRELEKAYKRLKNDEEFNRQLDYYLRTWAGRPTPLYYAERLTK  61

Query  79   HIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKF  138
             +GGA+I+ K     +GGAHK  NA    LLAK  GK  +  +TGAG  G   +MA    
Sbjct  62   KVGGAKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGALL  121

Query  139  GLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAM  198
            G+K  I+MGA+D++RQ+ NV  MK  GA V+PV++GS+TL DA++E +R WVA  + +  
Sbjct  122  GMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVHTGSKTLKDAINEALRDWVATFEYSHY  181

Query  199  CVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEF  258
             +GS VGP  +  I     S I RE + Q+L+  G +P  +    CVGGGS++ G +  F
Sbjct  182  LIGSVVGPHPYPIIVRDFQSVIGREAREQILEAEGDLPDVI--VACVGGGSNAMGIFYPF  239

Query  259  MDYDKKQIEFIGVEAGGPA-KSKKHAA  284
            +    K +  IGVEAGG   +S KH+A
Sbjct  240  V--KDKSVRLIGVEAGGKGIESGKHSA  264


>gi|34222901|sp|Q8KF11|TRPB_CHLTE  Tryptophan synthase beta chain
Length=400

 Score =  212 bits (540),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 119/264 (45%), Positives = 156/264 (59%), Gaps = 3/264 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG F+PETL K   DLE  + K KND +F +  D   ++++G PT     + L+E  
Sbjct  17   GTFGGKFIPETLVKNAADLEEEYLKAKNDPEFHQTLDNLLRHYVGRPTPLYHASRLSEKQ  76

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGAQIW K     + GAHKI NA    LLAKR GKK I  +TGAG  G   +     FGL
Sbjct  77   GGAQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVATATVCALFGL  136

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
             C ++MG +DI+RQ PNV  MK  G EV PV +GS+TL DA SE +R W+ N ++T   V
Sbjct  137  DCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSRTLKDATSEAIRDWMNNPEETFYIV  196

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS +G   +  +     S I RE + Q+LD+ G +P  +    CVGGGS++ G + EF+ 
Sbjct  197  GSVIGMHPYPMMVRDFQSVIGRETRQQVLDQAGRLPDVI--VACVGGGSNAIGMFYEFLP  254

Query  261  YDKKQIEFIGVEAGGPAKSKKHAA  284
             D K++E IGVEA G     KHAA
Sbjct  255  -DAKEVELIGVEAAGEGLEGKHAA  277


>gi|24212542|sp|Q8U093|TRPB1_PYRFU  Tryptophan synthase beta chain 1
Length=388

 Score =  212 bits (540),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 116/267 (43%), Positives = 165/267 (61%), Gaps = 5/267 (1%)

Query  19   WGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTE  78
            W G+FGG +VPETL +P+++LE  + + K+D++F ++ + Y K W G PT       LTE
Sbjct  2    WFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLTE  61

Query  79   HIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKF  138
             IGGA+I+ K     +GGAHK  NA    LLAK  GK  +  +TGAG  G   +MA    
Sbjct  62   KIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGALL  121

Query  139  GLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAM  198
            G+K  I+MGA+D++RQ+ NV  MK  GA V+PV SGS+TL DA++E +R WVA  + T  
Sbjct  122  GMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTHY  181

Query  199  CVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEF  258
             +GS VGP  +  I     S I RE K Q+L+  G +P  +    CVGGGS++ G +  F
Sbjct  182  LIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVI--VACVGGGSNAMGIFYPF  239

Query  259  MDYDKKQIEFIGVEAGGPA-KSKKHAA  284
            +  + K+++ +GVEAGG   +S KH+A
Sbjct  240  V--NDKKVKLVGVEAGGKGLESGKHSA  264


>gi|20140839|sp|Q9KCB0|TRPB_BACHD  Tryptophan synthase beta chain
Length=399

 Score =  207 bits (528),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 112/265 (42%), Positives = 160/265 (60%), Gaps = 6/265 (2%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG +VPETL   IE+LE+  N   ND+ FI +  ++ + + G PT      N++E +
Sbjct  13   GTFGGKYVPETLMSAIEELELALNDAMNDEAFIHDYKEHLREYAGRPTALTYAKNMSETL  72

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA+I+ K     + GAHK+ NA    LLAKR GKK I  +TGAG  G   +  A +FGL
Sbjct  73   GGAKIYLKREDLLHTGAHKLNNAMGQALLAKRMGKKKIVAETGAGQHGVATATIAARFGL  132

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +CK+FMG +D++RQ  NV  M+  GAEVVP  SGS+TL DA +E +RYWV + D T   +
Sbjct  133  ECKVFMGEEDMERQALNVFRMELLGAEVVPATSGSKTLKDATNEAIRYWVTHADDTFYLI  192

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS VGP  + ++       I  E + Q  +  G++P +V    CVGGGS++ G +  F++
Sbjct  193  GSVVGPHPYPQMVRDFQRIIGDEARAQFQEITGTLPTEV--IACVGGGSNAIGTFYPFLE  250

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAA  284
             D   ++ IGVEA G   ++ +HAA
Sbjct  251  DD---VKLIGVEAAGKGVETSQHAA  272


>gi|136372|sp|P13228|TRP_NEUCR  Tryptophan synthase
Length=708

 Score =  205 bits (521),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 115/265 (43%), Positives = 158/265 (59%), Gaps = 6/265 (2%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G+FGG +VPE L   + +LE  FNK+K+D  F +E   Y+  W+G P +  K   LTE+ 
Sbjct  315  GEFGGQYVPEALMDCLSELEEGFNKIKDDPAFWEEYRSYYP-WMGRPGQLHKAERLTEYA  373

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA IW K     + G+HKI NA    LLA+R GKK I  +TGAG  G   +    KFG+
Sbjct  374  GGANIWLKREDLNHTGSHKINNALGQLLLARRLGKKKIIAETGAGQHGVATATVCAKFGM  433

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +C +FMGA+D++RQ  NV  MK  GA+VV V +GS+TL DAV+E +RYWV N   T   +
Sbjct  434  ECTVFMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVNEALRYWVVNLADTHYII  493

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS +GP  F  I     S I  E K Q+L++ G +P  V    CVGGGS++ G +  F  
Sbjct  494  GSAIGPHPFPTIVRTFQSVIGNETKQQMLEKRGKLPDAV--VACVGGGSNAVGMFYPFS-  550

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAA  284
             +   ++ +GVEAGG    + +H+A
Sbjct  551  -NDPSVKLLGVEAGGDGVDTPRHSA  574


>gi|6226273|sp|O66923|TRPB1_AQUAE  Tryptophan synthase beta chain 1
Length=397

 Score =  203 bits (517),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 116/265 (43%), Positives = 160/265 (60%), Gaps = 5/265 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG FVPETL   +E+LE  + +LK+D +F KE D Y + + G PT       LT+++
Sbjct  12   GPFGGKFVPETLMYALEELEEKYRELKSDPEFQKELDYYLREYAGRPTPLYFAEKLTKYV  71

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA+I+ K     + GAHKI N    CLL KR GKK +  +TGAG  G   + A+  FGL
Sbjct  72   GGAKIYLKREDLLHTGAHKINNTIGQCLLTKRMGKKRVIAETGAGQHGVATATASALFGL  131

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +C ++MG +D +RQ  NV  MK  GA+V  V SGS+TL DA++E +R WV N + T   +
Sbjct  132  ECVVYMGEEDAERQALNVFRMKLLGAKVEIVKSGSRTLKDAINEALRDWVTNVESTHYVI  191

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS VGP  F  I     S I RE K Q+L + G +P  +    CVGGGS++ G +  F+ 
Sbjct  192  GSVVGPHPFPMIVRDFQSVIGRETKEQILQKEGRLPDAI--VACVGGGSNAMGIFYPFV-  248

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAA  284
             + K ++ IGVEAGG   ++ +HAA
Sbjct  249  -EDKGVQLIGVEAGGYGLETGQHAA  272


>gi|39932386|sp|Q89WE5|TRPB_BRAJA  Tryptophan synthase beta chain
Length=405

 Score =  203 bits (517),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 109/264 (41%), Positives = 153/264 (57%), Gaps = 4/264 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG FV ETL   I DLE  +   K D  F  E + Y KN++G P+       LTEH+
Sbjct  20   GIFGGRFVAETLMPLILDLEKAYTAAKADPAFQAEMNGYLKNYVGRPSPLYFAERLTEHL  79

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA+I+ K     + G+HK+ N     +LA+R GKK I  +TGAG  G   +    +FGL
Sbjct  80   GGAKIYLKREELNHTGSHKVNNVLGQIMLARRMGKKRIIAETGAGQHGVATATLCARFGL  139

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +C ++MGA D++RQQPNV  M+  GA+VVPV SG++TL DA++E +R WV N   T  C+
Sbjct  140  ECVVYMGAVDVERQQPNVIRMEMLGAKVVPVQSGTRTLKDAMNEALRDWVTNVHNTFYCI  199

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            G+  GP  +  +     S I  E K Q+ +  G +P    L  C+GGGS++ G ++ F+ 
Sbjct  200  GTVAGPHPYPTLVRDFQSIIGNETKAQMQEVEGRLPD--SLVACIGGGSNAMGLFHPFL-  256

Query  261  YDKKQIEFIGVEAGGPAKSKKHAA  284
             D   +E  GVEA G   ++ HAA
Sbjct  257  -DDPSVEIFGVEAAGHGLTQLHAA  279


>gi|34395985|sp|P07600|TRPB_BACSU  Tryptophan synthase beta chain
Length=400

 Score =  203 bits (517),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 114/272 (41%), Positives = 161/272 (59%), Gaps = 7/272 (2%)

Query  14   NKLGFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKL  73
            N++G +G  FGG FVPETL +P+++++  F ++K+D  F +E  K  K++ G PT     
Sbjct  6    NEIGRYG-DFGGKFVPETLMQPLDEIQTAFKQIKDDPAFREEYYKLLKDYSGRPTALTYA  64

Query  74   NNLTEHIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSM  133
            + +TE++GGA+I+ K     + G+HKI NA    LLAK+ GK  I  +TGAG  G   + 
Sbjct  65   DRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGVAAAT  124

Query  134  AAKKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANC  193
             A KFG  C +FMG +D+ RQ  NV  MK  GAEVVPV SG+ TL DA +E +RYWV +C
Sbjct  125  VAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYWVQHC  184

Query  194  DKTAMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFG  253
            +     +GS VGP  + ++       I  E K QL    G++P KV    CVGGGS++ G
Sbjct  185  EDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEGTMPDKV--VACVGGGSNAMG  242

Query  254  FWNEFMDYDKKQIEFIGVEAGGPA-KSKKHAA  284
             +  F++ D   +E IG EA G    +  HAA
Sbjct  243  MFQAFLNED---VELIGAEAAGKGIDTPLHAA  271


>gi|136268|sp|P16706|TRPB_ACICA  Tryptophan synthase beta chain
Length=403

 Score =  201 bits (512),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 108/266 (40%), Positives = 160/266 (60%), Gaps = 5/266 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G  GG FV ETL   +EDLE L+N++KND++F+ E D+    ++G P+        ++ +
Sbjct  15   GIHGGRFVSETLMAALEDLENLYNRMKNDEQFLAEFDRDLAYYVGRPSPLYYAERWSKKL  74

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGAQI+ K     + G+HK+ N     LLAK SGKK I  +TGAG  G   +  A + GL
Sbjct  75   GGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQHGVATATIAARLGL  134

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +C +FMGA+D++RQ  NV  M+  GA V+PV SGS+TL DA++E MR WV N D T   +
Sbjct  135  ECVVFMGAEDVKRQAMNVYRMRLLGATVIPVQSGSKTLKDAMNEAMRDWVTNVDSTYYVI  194

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            G+  GP  + ++     S I RE + Q+ ++ G +P    L  CVGGGS++ G +  F+ 
Sbjct  195  GTVAGPHPYPQLVRDFQSIIGREARRQIQEQAGRLPD--ALVACVGGGSNAIGLFYPFL-  251

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAAP  285
             + + ++  GVEA G   ++ KH+AP
Sbjct  252  -NDQDVKMYGVEAAGHGIETGKHSAP  276


>gi|38258737|sp|Q88B61|TRPB_PSESM  Tryptophan synthase beta chain
Length=409

 Score =  201 bits (510),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 115/265 (43%), Positives = 153/265 (57%), Gaps = 5/265 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG +V ETL   + DL   +   K D +FIKE   + +++IG P        LTE  
Sbjct  17   GSFGGRYVAETLMPLVLDLNREYEAAKADPEFIKEMAYFQRDYIGRPNPLYFAERLTEFC  76

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA+I+ K     + GAHKI N     LLAKR GKK +  +TGAG  G   +  A +FGL
Sbjct  77   GGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGAGMHGVATATVAARFGL  136

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
             C I+MGA DI+RQQ NV  MK  GAE+VPV SG+ TL DA++E +R WV N D T   +
Sbjct  137  PCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTGTLKDAMNEALRDWVTNVDDTFYLI  196

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            G+  GP  +  +     S I +E K Q+ ++ G +P    L  CVGGGS++ G ++ F+ 
Sbjct  197  GTVAGPHPYPAMVRDFQSVIGKETKEQMQEKEGRLPD--SLIACVGGGSNAMGLFHPFL-  253

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAA  284
             D   +E IGVEAGG    + KHAA
Sbjct  254  -DDASVEIIGVEAGGHGVDTDKHAA  277





BlastP

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,251,557 sequences; 1,462,657,958 total letters


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|71083194|ref|YP_265913.1|  Tryptophan synthase beta chain 1...   483    3e-135 
gi|14520675|ref|NP_126150.1|  tryptophan synthase subunit beta...   213    8e-54  
gi|73535403|pdb|1WDW|B  Chain B, Structural Basis Of Mutual Ac...   212    1e-53  
gi|21673356|ref|NP_661421.1|  tryptophan synthase subunit beta...   212    2e-53  
gi|18978078|ref|NP_579435.1|  tryptophan synthase subunit beta...   212    2e-53  
gi|15614226|ref|NP_242529.1|  tryptophan synthase subunit beta...   207    3e-52  
gi|67940045|ref|ZP_00532518.1|  Tryptophan synthase, beta chai...   207    6e-52 
gi|118684657|gb|EAV91013.1|  tryptophan synthase, beta subunit [M   207    6e-52 
gi|51245483|ref|YP_065367.1|  tryptophan synthase subunit beta...   206    8e-52  
gi|85110137|ref|XP_963281.1|  TRYPTOPHAN SYNTHASE [Neurospora ...   205    2e-51  
gi|87120417|ref|ZP_01076312.1|  tryptophan synthase subunit be...   205    2e-51 
gi|421535|pir||JN0593  tryptophan synthase (EC 4.2.1.20) beta ...   204    3e-51 
gi|15606106|ref|NP_213483.1|  tryptophan synthase subunit beta...   203    6e-51  
gi|27375856|ref|NP_767385.1|  tryptophan synthase subunit beta...   203    6e-51  
gi|50812257|ref|NP_390145.2|  tryptophan synthase subunit beta...   203    7e-51  
gi|91974679|ref|YP_567338.1|  tryptophan synthase, beta subuni...   203    8e-51  
gi|143772|gb|AAA22869.1|  TrpB protein >gi|143812|gb|AAA20865....   203    9e-51 
gi|52080772|ref|YP_079563.1|  tryptophan synthase subunit beta...   202    1e-50  
gi|116205607|ref|XP_001228614.1|  tryptophan synthase [Chaetom...   202    1e-50  
gi|87312112|ref|ZP_01094218.1|  tryptophan synthase beta chain...   202    1e-50 
gi|56420735|ref|YP_148053.1|  tryptophan synthase subunit beta...   202    1e-50  
gi|90421916|ref|YP_530286.1|  tryptophan synthase, beta subuni...   202    2e-50  
gi|86747761|ref|YP_484257.1|  tryptophan synthase, beta subuni...   202    2e-50  
gi|77919834|ref|YP_357649.1|  tryptophan synthase, beta subuni...   202    2e-50  
gi|50083869|ref|YP_045379.1|  tryptophan synthase subunit beta...   201    2e-50  
gi|94263413|ref|ZP_01287227.1|  Tryptophan synthase, beta chai...   201    3e-50 
gi|68491800|ref|XP_710312.1|  tryptophan synthetase subunit al...   201    4e-50  
gi|28867398|ref|NP_790017.1|  tryptophan synthase subunit beta...   201    4e-50  
gi|66043305|ref|YP_233146.1|  tryptophan synthase subunit beta...   201    4e-50  
gi|76797361|ref|ZP_00779686.1|  Tryptophan synthase, beta chai...   201    4e-50 
gi|115522482|ref|YP_779393.1|  tryptophan synthase, beta subun...   200    7e-50  
gi|70733550|ref|YP_257189.1|  tryptophan synthase subunit beta...   200    8e-50  
gi|77164533|ref|YP_343058.1|  Tryptophan synthase, beta chain ...   199    1e-49  
gi|114568647|ref|YP_755327.1|  tryptophan synthase, beta subun...   199    1e-49  
gi|71065002|ref|YP_263729.1|  tryptophan synthase subunit beta...   199    1e-49  
gi|136280|sp|P11080|TRPB_PSEPU  Tryptophan synthase beta chain...   199    1e-49 
gi|26986828|ref|NP_742253.1|  tryptophan synthase subunit beta...   199    1e-49  
gi|82737351|ref|ZP_00900201.1|  Tryptophan synthase, beta chai...   199    1e-49 
gi|39933149|ref|NP_945425.1|  tryptophan synthase subunit beta...   199    1e-49  
gi|68551248|ref|ZP_00590668.1|  Tryptophan synthase, beta chai...   199    1e-49 
gi|104779351|ref|YP_605849.1|  tryptophan synthase beta subuni...   199    1e-49  
gi|114770174|ref|ZP_01447712.1|  tryptophan synthase subunit b...   199    1e-49 
gi|29840324|ref|NP_829430.1|  tryptophan synthase subunit beta...   199    2e-49  
gi|32476540|ref|NP_869534.1|  tryptophan synthase subunit beta...   199    2e-49  
gi|94498943|ref|ZP_01305481.1|  tryptophan synthase, beta subu...   199    2e-49 
gi|37522327|ref|NP_925704.1|  tryptophan synthase subunit beta...   198    2e-49  
gi|67935199|ref|ZP_00528222.1|  Tryptophan synthase, beta chai...   198    2e-49 
gi|89898243|ref|YP_515353.1|  tryptophan synthase beta chain [...   198    3e-49  
gi|92113387|ref|YP_573315.1|  tryptophan synthase, beta subuni...   198    3e-49  
gi|87121854|ref|ZP_01077740.1|  tryptophan synthase, beta subu...   198    3e-49 
gi|28800025|gb|AAO47003.1|  tryptophan synthetase [Nodulisporium    198    3e-49 
gi|57640192|ref|YP_182670.1|  tryptophan synthase subunit beta...   197    3e-49  
gi|78044818|ref|YP_360411.1|  tryptophan synthase, beta subuni...   197    4e-49  
gi|136269|sp|P19868|TRPB_BACST  Tryptophan synthase beta chain...   197    4e-49 
gi|21231974|ref|NP_637891.1|  tryptophan synthase subunit beta...   197    4e-49  
gi|114843846|ref|ZP_01454306.1|  tryptophan synthase, beta sub...   197    5e-49 
gi|226585|prf||1603216A  Trp synthase                               197    6e-49 
gi|58427469|gb|AAW76506.1|  tryptophan synthase beta chain [Xa...   197    6e-49  
gi|77760770|ref|YP_201891.2|  tryptophan synthase subunit beta...   197    6e-49  
gi|90021724|ref|YP_527551.1|  Tryptophan synthase [Saccharopha...   197    7e-49  
gi|87199323|ref|YP_496580.1|  tryptophan synthase, beta subuni...   196    7e-49  
gi|114799821|ref|YP_762148.1|  tryptophan synthase, beta subun...   196    8e-49  
gi|110596724|ref|ZP_01385014.1|  tryptophan synthase, beta sub...   196    8e-49 
gi|78694222|ref|ZP_00858735.1|  Tryptophan synthase, beta chai...   196    8e-49 
gi|88797223|ref|ZP_01112813.1|  tryptophan synthase, beta subu...   196    8e-49 
gi|94968187|ref|YP_590235.1|  tryptophan synthase, beta subuni...   196    9e-49  
gi|91204154|emb|CAJ71807.1|  strongly similair to tryptophan s...   196    1e-48 
gi|93005297|ref|YP_579734.1|  tryptophan synthase, beta subuni...   196    1e-48  
gi|59800724|ref|YP_207436.1|  tryptophan synthase subunit beta...   196    1e-48  
gi|78048425|ref|YP_364600.1|  tryptophan synthase subunit beta...   196    1e-48  
gi|20808007|ref|NP_623178.1|  tryptophan synthase subunit beta...   196    1e-48  
gi|78186419|ref|YP_374462.1|  tryptophan synthase subunit beta...   195    2e-48  
gi|118685420|gb|EAV91770.1|  tryptophan synthase, beta subunit [M   195    2e-48 
gi|111224357|ref|YP_715151.1|  tryptophan synthase, beta prote...   195    2e-48  
gi|67917878|ref|ZP_00511481.1|  Tryptophan synthase, beta chai...   195    2e-48 
gi|90416805|ref|ZP_01224735.1|  tryptophan synthase subunit be...   195    3e-48 
gi|84500232|ref|ZP_00998498.1|  tryptophan synthase subunit be...   195    3e-48 
gi|77465586|ref|YP_355089.1|  tryptophan synthase subunit beta...   194    3e-48  
gi|45358566|ref|NP_988123.1|  tryptophan synthase subunit beta...   194    3e-48  
gi|116053757|ref|YP_788192.1|  tryptophan synthase beta chain ...   194    3e-48  
gi|57157621|dbj|BAD83779.1|  tryptophan synthase beta subunit [Po   194    3e-48 
gi|15595234|ref|NP_248726.1|  tryptophan synthase subunit beta...   194    3e-48  
gi|110834322|ref|YP_693181.1|  tryptophan synthase, beta subun...   194    3e-48  
gi|78485148|ref|YP_391073.1|  tryptophan synthase, beta subuni...   194    3e-48  
gi|21243444|ref|NP_643026.1|  tryptophan synthase subunit beta...   194    4e-48  
gi|115384238|ref|XP_001208666.1|  tryptophan synthase [Aspergi...   194    4e-48  
gi|58651794|emb|CAI50973.1|  tryptophan synthase, beta subunit [u   194    4e-48 
gi|151616|gb|AAA88462.1|  tryptophan synthase beta subunit          194    4e-48 
gi|23097977|ref|NP_691443.1|  tryptophan synthase subunit beta...   194    4e-48  
gi|68234400|ref|ZP_00573482.1|  Tryptophan synthase, beta chai...   194    4e-48 
gi|15896406|ref|NP_349755.1|  tryptophan synthase subunit beta...   194    5e-48  
gi|53803318|ref|YP_114907.1|  tryptophan synthase subunit beta...   194    5e-48  
gi|89093243|ref|ZP_01166193.1|  tryptophan synthase, beta subu...   194    6e-48 
gi|71734425|ref|YP_272350.1|  tryptophan synthase, beta subuni...   194    6e-48  
gi|38258731|sp|Q849P2|TRPB_PSESH  Tryptophan synthase beta cha...   194    6e-48 
gi|94417314|ref|ZP_01297133.1|  hypothetical protein PaerP_010...   194    6e-48 
gi|46138457|ref|XP_390919.1|  TRP_NEUCR Tryptophan synthase [G...   193    7e-48  
gi|83769625|dbj|BAE59760.1|  unnamed protein product [Aspergillus   193    7e-48 
gi|19114689|ref|NP_593777.1|  hypothetical protein SPAC19A8.15...   193    7e-48  
gi|91770939|ref|ZP_01272759.1|  Tryptophan synthase, beta chai...   193    7e-48 
gi|88948581|ref|ZP_01151344.1|  Tryptophan synthase, beta chai...   193    7e-48 
gi|71480993|ref|ZP_00660702.1|  Tryptophan synthase, beta chai...   193    7e-48 
gi|90304420|gb|EAS34051.1|  hypothetical protein CIMG_05075 [Cocc   193    9e-48 
gi|83649564|ref|YP_437999.1|  tryptophan synthase, beta subuni...   193    9e-48  
gi|85374345|ref|YP_458407.1|  probable tryptophan synthase bet...   193    9e-48  
gi|94497970|ref|ZP_01304534.1|  probable tryptophan synthase b...   193    1e-47 
gi|58651781|emb|CAI50961.1|  tryptophan synthase, beta subunit [u   192    1e-47 
gi|114320392|ref|YP_742075.1|  tryptophan synthase, beta subun...   192    1e-47  
gi|86136037|ref|ZP_01054616.1|  tryptophan synthase, beta subu...   192    1e-47 
gi|34222824|sp|Q84GJ9|TRPB_NEIGO  Tryptophan synthase beta cha...   192    2e-47 
gi|39932276|sp|Q7NUD8|TRPB_CHRVO  Tryptophan synthase beta chain    192    2e-47 
gi|67154984|ref|ZP_00416729.1|  Tryptophan synthase, beta chai...   192    2e-47 
gi|50308853|ref|XP_454431.1|  unnamed protein product [Kluyver...   192    2e-47  
gi|58259127|ref|XP_566976.1|  tryptophan synthase [Cryptococcu...   191    2e-47  
gi|50260428|gb|EAL23085.1|  hypothetical protein CNBA6100 [Cry...   191    2e-47 
gi|136278|sp|P14638|TRPB_METVO  Tryptophan synthase beta chain...   191    2e-47 
gi|71001952|ref|XP_755657.1|  bifunctional tryptophan synthase...   191    2e-47  
gi|114562602|ref|YP_750115.1|  tryptophan synthase, beta subun...   191    3e-47  
gi|83748094|ref|ZP_00945123.1|  Tryptophan synthase beta chain...   191    3e-47 
gi|68336|pir||TSPSBA  tryptophan synthase (EC 4.2.1.20) beta c...   191    3e-47 
gi|78189262|ref|YP_379600.1|  tryptophan synthase subunit beta...   191    3e-47  
gi|108763319|ref|YP_634200.1|  tryptophan synthase, beta subun...   191    3e-47  
gi|82748721|ref|ZP_00911199.1|  Tryptophan synthase, beta chai...   191    3e-47 
gi|50420927|ref|XP_459006.1|  hypothetical protein DEHA0D13552...   191    3e-47  
gi|16803668|ref|NP_465153.1|  tryptophan synthase subunit beta...   191    4e-47  
gi|85708939|ref|ZP_01040005.1|  tryptophan synthase subunit be...   191    4e-47 
gi|83943882|ref|ZP_00956339.1|  tryptophan synthase, beta subu...   191    4e-47 
gi|17546702|ref|NP_520104.1|  tryptophan synthase subunit beta...   191    4e-47  
gi|77456331|ref|YP_345836.1|  tryptophan synthase subunit beta...   191    5e-47  
gi|15793870|ref|NP_283692.1|  tryptophan synthase subunit beta...   191    5e-47  
gi|46199038|ref|YP_004705.1|  tryptophan synthase subunit beta...   191    5e-47  
gi|136282|sp|P16609|TRPB_THET2  Tryptophan synthase beta chain...   191    5e-47 
gi|11499193|ref|NP_070429.1|  tryptophan synthase subunit beta...   190    5e-47  
gi|56695710|ref|YP_166061.1|  tryptophan synthase subunit beta...   190    5e-47  
gi|78367137|ref|ZP_00837410.1|  Tryptophan synthase, beta chai...   190    6e-47 
gi|78223685|ref|YP_385432.1|  Tryptophan synthase, beta chain ...   190    6e-47  
gi|118056677|ref|ZP_01525143.1|  tryptophan synthase, beta sub...   190    7e-47 
gi|103486553|ref|YP_616114.1|  tryptophan synthase, beta subun...   190    7e-47  
gi|68553224|ref|ZP_00592603.1|  Tryptophan synthase, beta chai...   190    8e-47 
gi|98662893|dbj|GAA00304.1|  unnamed protein product [Pelotomacul   190    8e-47 
gi|88940111|ref|ZP_01145553.1|  tryptophan synthase, beta subu...   190    8e-47 
gi|17227906|ref|NP_484454.1|  tryptophan synthase subunit beta...   189    9e-47  
gi|117923652|ref|YP_864269.1|  tryptophan synthase, beta subun...   189    9e-47  
gi|464937|sp|P34817|TRPB_PSESY  Tryptophan synthase beta chain...   189    1e-46 
gi|9651535|gb|AAF91181.1|AF207903_2  bifunctional tryptophan synt   189    1e-46 
gi|88944069|ref|ZP_01147402.1|  Tryptophan synthase, beta chai...   189    1e-46 
gi|84683361|ref|ZP_01011264.1|  tryptophan synthase subunit be...   189    1e-46 
gi|86605059|ref|YP_473822.1|  tryptophan synthase, beta subuni...   189    1e-46  
gi|15676597|ref|NP_273741.1|  tryptophan synthase subunit beta...   189    1e-46  
gi|54309654|ref|YP_130674.1|  tryptophan synthase subunit beta...   189    1e-46  
gi|108804909|ref|YP_644846.1|  tryptophan synthase, beta subun...   189    1e-46  
gi|84489868|ref|YP_448100.1|  TrpB [Methanosphaera stadtmanae ...   189    1e-46  
gi|83945689|ref|ZP_00958034.1|  tryptophan synthase subunit be...   189    1e-46 
gi|45199003|ref|NP_986032.1|  AFR485Cp [Eremothecium gossypii]...   189    1e-46  
gi|67540122|ref|XP_663835.1|  hypothetical protein AN6231.2 [A...   189    1e-46  
gi|16800737|ref|NP_471005.1|  tryptophan synthase subunit beta...   189    1e-46  
gi|46907858|ref|YP_014247.1|  tryptophan synthase subunit beta...   189    1e-46  
gi|115474697|ref|NP_001060945.1|  Os08g0135900 [Oryza sativa (...   189    1e-46  
gi|28198521|ref|NP_778835.1|  tryptophan synthase subunit beta...   189    1e-46  
gi|50556874|ref|XP_505845.1|  hypothetical protein [Yarrowia l...   189    1e-46  
gi|86608975|ref|YP_477737.1|  tryptophan synthase, beta subuni...   189    2e-46  
gi|83769234|dbj|BAE59371.1|  unnamed protein product [Aspergillus   189    2e-46 
gi|84515234|ref|ZP_01002596.1|  tryptophan synthase subunit be...   189    2e-46 
gi|3915165|sp|O50046|TRPB_CAMAC  Tryptophan synthase beta chai...   188    2e-46 
gi|118646858|gb|EAV53688.1|  tryptophan synthase, beta subunit...   188    2e-46 
gi|88705037|ref|ZP_01102749.1|  Tryptophan synthase beta chain...   188    2e-46 
gi|86741702|ref|YP_482102.1|  tryptophan synthase, beta subuni...   188    2e-46  
gi|83645233|ref|YP_433668.1|  tryptophan synthase, beta subuni...   188    3e-46  
gi|116873060|ref|YP_849841.1|  tryptophan synthase, beta subun...   188    3e-46  
gi|53722719|ref|YP_111704.1|  tryptophan synthase subunit beta...   188    3e-46  
gi|116628278|ref|YP_820897.1|  Tryptophan synthase beta chain ...   188    3e-46  
gi|118691907|gb|EAV98147.1|  tryptophan synthase, beta subunit...   188    3e-46 
gi|18481702|gb|AAL73524.1|AF466200_3  tryptophan synthase beta-su   188    3e-46 
gi|54294202|ref|YP_126617.1|  tryptophan synthase subunit beta...   188    3e-46  
gi|83717275|ref|YP_438878.1|  tryptophan synthase, beta subuni...   188    3e-46  
gi|52841535|ref|YP_095334.1|  tryptophan synthetase, beta subu...   188    3e-46  
gi|33860724|ref|NP_892285.1|  tryptophan synthase subunit beta...   188    3e-46  
gi|111063705|gb|EAT84825.1|  hypothetical protein SNOG_07359 [Pha   187    3e-46 
gi|92115695|ref|YP_575424.1|  tryptophan synthase, beta subuni...   187    3e-46  
gi|76819683|ref|YP_335928.1|  tryptophan synthase subunit beta...   187    4e-46  
gi|99080047|ref|YP_612201.1|  tryptophan synthase, beta subuni...   187    4e-46  
gi|53716176|ref|YP_106284.1|  tryptophan synthase subunit beta...   187    4e-46  
gi|114328679|ref|YP_745836.1|  tryptophan synthase beta chain ...   187    4e-46  
gi|77747544|ref|NP_298664.2|  tryptophan synthase subunit beta...   187    4e-46  
gi|11269281|pir||C82688  tryptophan synthase beta chain XF1375...   187    4e-46 
gi|83951663|ref|ZP_00960395.1|  tryptophan synthase subunit be...   187    4e-46 
gi|115358099|ref|YP_775237.1|  tryptophan synthase, beta subun...   187    4e-46  
gi|71274836|ref|ZP_00651124.1|  Tryptophan synthase, beta chai...   187    4e-46 
gi|38234893|ref|NP_940660.1|  tryptophan synthase subunit beta...   187    4e-46  
gi|69936556|ref|ZP_00631340.1|  Tryptophan synthase, beta chai...   187    4e-46 
gi|71021001|ref|XP_760731.1|  hypothetical protein UM04584.1 [...   187    4e-46  
gi|50301226|gb|AAT73768.1|  tryptophan synthase, beta subunit ...   187    5e-46 
gi|78062972|ref|YP_372880.1|  tryptophan synthase subunit beta...   187    5e-46  
gi|114848718|ref|ZP_01459013.1|  tryptophan synthase, beta sub...   187    6e-46 
gi|67547362|ref|ZP_00425266.1|  Tryptophan synthase, beta chai...   187    6e-46 
gi|118063642|ref|ZP_01531979.1|  tryptophan synthase, beta sub...   187    6e-46 
gi|15903674|ref|NP_359224.1|  tryptophan synthase subunit beta...   187    6e-46  
gi|83749740|ref|ZP_00946717.1|  Tryptophan synthase beta chain...   187    6e-46 
gi|85705356|ref|ZP_01036455.1|  tryptophan synthase subunit be...   187    7e-46 
gi|84702211|ref|ZP_01016786.1|  tryptophan synthase, beta subu...   187    7e-46 
gi|118594741|ref|ZP_01552088.1|  tryptophan synthase subunit b...   186    8e-46 
gi|114765757|ref|ZP_01444852.1|  tryptophan synthase subunit b...   186    8e-46 
gi|74317932|ref|YP_315672.1|  tryptophan synthase, beta chain ...   186    8e-46  
gi|78778552|ref|YP_396664.1|  tryptophan synthase, beta subuni...   186    8e-46  
gi|118673970|gb|EAV80536.1|  tryptophan synthase, beta subunit...   186    8e-46 
gi|17231286|ref|NP_487834.1|  tryptophan synthase subunit beta...   186    8e-46  
gi|110681043|ref|YP_684050.1|  tryptophan synthase, beta subun...   186    9e-46  
gi|57339554|gb|AAW49764.1|  hypothetical protein FTT1773 [synthet   186    1e-45 
gi|1174780|sp|P43284|TRPB2_MAIZE  Tryptophan synthase beta cha...   186    1e-45  
gi|113941414|ref|ZP_01427213.1|  tryptophan synthase, beta sub...   186    1e-45 
gi|118036533|ref|ZP_01507940.1|  tryptophan synthase, beta sub...   186    1e-45 
gi|56963664|ref|YP_175395.1|  tryptophan synthase subunit beta...   186    1e-45  
gi|15901641|ref|NP_346245.1|  tryptophan synthase subunit beta...   186    1e-45  
gi|91776051|ref|YP_545807.1|  tryptophan synthase, beta subuni...   186    1e-45  
gi|91793806|ref|YP_563457.1|  tryptophan synthase, beta subuni...   186    1e-45  
gi|68054384|ref|ZP_00538541.1|  Tryptophan synthase, beta chai...   186    2e-45 
gi|56551481|ref|YP_162320.1|  tryptophan synthase subunit beta...   186    2e-45  
gi|83367971|ref|ZP_00912837.1|  Tryptophan synthase, beta chai...   185    2e-45 
gi|82703033|ref|YP_412599.1|  tryptophan synthase, beta subuni...   185    2e-45  
gi|68547953|ref|ZP_00587476.1|  Tryptophan synthase, beta chai...   185    2e-45 
gi|2970343|gb|AAC25986.1|  tryptophan synthase beta [Chlamydomona   185    2e-45  
gi|15236977|ref|NP_194437.1|  TSB2 (TRYPTOPHAN SYNTHASE BETA-S...   185    2e-45  
gi|75908132|ref|YP_322428.1|  tryptophan synthase subunit beta...   185    2e-45  
gi|116749206|ref|YP_845893.1|  tryptophan synthase, beta subun...   185    2e-45  
gi|56708767|ref|YP_170663.1|  tryptophan synthase subunit beta...   185    2e-45  
gi|89360657|ref|ZP_01198475.1|  Tryptophan synthase, beta chai...   185    2e-45 
gi|118498295|ref|YP_899345.1|  tryptophan synthase beta chain ...   185    3e-45  
gi|112489712|pdb|1X1Q|A  Chain A, Crystal Structure Of Tryptop...   185    3e-45  
gi|91772184|ref|YP_564876.1|  tryptophan synthase, beta subuni...   185    3e-45  
gi|89056080|ref|YP_511531.1|  tryptophan synthase, beta subuni...   184    3e-45  
gi|46578502|ref|YP_009310.1|  tryptophan synthase subunit beta...   184    3e-45  
gi|89342513|ref|ZP_01194749.1|  Tryptophan synthase, beta chai...   184    3e-45 
gi|84354030|ref|ZP_00978946.1|  COG0133: Tryptophan synthase b...   184    3e-45 
gi|15679654|ref|NP_276771.1|  tryptophan synthase subunit beta...   184    3e-45  
gi|83594756|ref|YP_428508.1|  Tryptophan synthase, beta chain ...   184    4e-45  
gi|1174778|sp|P43283|TRPB1_MAIZE  Tryptophan synthase beta cha...   184    4e-45  
gi|95930489|ref|ZP_01313225.1|  tryptophan synthase, beta subu...   184    4e-45 
gi|15669226|ref|NP_248031.1|  tryptophan synthase subunit beta...   184    4e-45  
gi|19703662|ref|NP_603224.1|  tryptophan synthase subunit beta...   184    4e-45  
gi|91777256|ref|YP_552464.1|  Tryptophan synthase, beta chain ...   184    5e-45  
gi|19554225|ref|NP_602227.1|  tryptophan synthase subunit beta...   184    5e-45  
gi|110620886|emb|CAJ36164.1|  tryptophan synthase, beta chain ...   184    5e-45 
gi|118663257|gb|EAV69915.1|  tryptophan synthase, beta subunit...   184    5e-45 
gi|25029428|ref|NP_739482.1|  tryptophan synthase subunit beta...   184    5e-45  
gi|77952235|ref|ZP_00816651.1|  Tryptophan synthase, beta chai...   184    5e-45 
gi|106891048|ref|ZP_01358238.1|  tryptophan synthase, beta sub...   184    5e-45 
gi|90581214|ref|ZP_01237012.1|  tryptophan synthase subunit be...   184    5e-45 
gi|73671052|ref|YP_307067.1|  tryptophan synthase subunit beta...   184    5e-45  
gi|6321412|ref|NP_011489.1|  Tryptophan synthase involved in t...   184    6e-45  
gi|90204082|ref|ZP_01206726.1|  Tryptophan synthase, beta chai...   184    6e-45 
gi|85859665|ref|YP_461867.1|  trytophan synthase beta chain [S...   184    6e-45  
gi|23130014|ref|ZP_00111835.1|  COG0133: Tryptophan synthase b...   183    6e-45 
gi|116670249|ref|YP_831182.1|  tryptophan synthase, beta subun...   183    6e-45  
gi|118027607|ref|ZP_01499071.1|  tryptophan synthase, beta sub...   183    7e-45 
gi|89069010|ref|ZP_01156391.1|  tryptophan synthase, beta subu...   183    7e-45 
gi|118052416|ref|ZP_01520963.1|  tryptophan synthase, beta sub...   183    7e-45 
gi|90412183|ref|ZP_01220189.1|  tryptophan synthase subunit be...   183    7e-45 
gi|89255537|ref|YP_512898.1|  tryptophan synthase beta chain [...   183    7e-45  
gi|118567931|gb|ABL02736.1|  tryptophan synthase, beta subunit...   183    8e-45 
gi|55821564|ref|YP_140006.1|  tryptophan synthase subunit beta...   183    8e-45  
gi|94311403|ref|YP_584613.1|  tryptophan synthase, beta subuni...   183    8e-45  
gi|5764614|gb|AAD51338.1|AF173835_2  tryptophan synthetase bet...   183    9e-45 
gi|50284803|ref|XP_444829.1|  hypothetical protein CAGL0A01430...   183    9e-45  
gi|75674254|ref|YP_316675.1|  tryptophan synthase subunit beta...   183    9e-45  
gi|39597|emb|CAA28627.1|  unnamed protein product [Corynebacteriu   182    1e-44 
gi|55823492|ref|YP_141933.1|  tryptophan synthase subunit beta...   182    1e-44  
gi|84360294|ref|ZP_00985001.1|  COG0133: Tryptophan synthase b...   182    1e-44 
gi|81661|pir||JQ1073  tryptophan synthase (EC 4.2.1.20) beta-2...   182    1e-44 
gi|22300017|ref|NP_683264.1|  tryptophan synthase subunit beta...   182    1e-44  
gi|118679528|gb|EAV86054.1|  tryptophan synthase, beta subunit [E   182    1e-44 
gi|118670437|gb|EAV77030.1|  tryptophan synthase, beta subunit [D   182    1e-44 
gi|110633023|ref|YP_673231.1|  tryptophan synthase, beta subun...   182    1e-44  
gi|118072452|ref|ZP_01540641.1|  tryptophan synthase, beta sub...   182    1e-44 
gi|94986855|ref|YP_594788.1|  Tryptophan synthase beta chain [...   182    2e-44  
gi|83766104|dbj|BAE56247.1|  unnamed protein product [Aspergillus   182    2e-44 
gi|118593683|ref|ZP_01551058.1|  tryptophan synthase subunit b...   182    2e-44 
gi|94491892|ref|ZP_01299101.1|  hypothetical protein CburD_010...   182    2e-44 
gi|28971664|dbj|BAC65264.1|  tryptophan synthase beta chain [Burk   182    2e-44 
gi|67916150|ref|ZP_00509870.1|  Tryptophan synthase, beta chai...   182    2e-44 
gi|34557707|ref|NP_907522.1|  tryptophan synthase subunit beta...   182    2e-44  
gi|114047029|ref|YP_737579.1|  tryptophan synthase, beta subun...   182    2e-44  
gi|89074048|ref|ZP_01160549.1|  tryptophan synthase subunit be...   182    2e-44 
gi|118661301|gb|EAV68042.1|  tryptophan synthase, beta subunit...   182    2e-44 
gi|89097934|ref|ZP_01170821.1|  tryptophan synthase subunit be...   182    2e-44 
gi|67923479|ref|ZP_00516955.1|  Tryptophan synthase, beta chai...   182    2e-44 
gi|24374548|ref|NP_718591.1|  tryptophan synthase subunit beta...   182    2e-44  
gi|113969800|ref|YP_733593.1|  tryptophan synthase, beta subun...   182    2e-44  
gi|51246801|ref|YP_066685.1|  tryptophan synthase subunit beta...   182    2e-44  
gi|110594130|ref|ZP_01382478.1|  tryptophan synthase, beta sub...   182    2e-44 
gi|88856216|ref|ZP_01130876.1|  tryptophan synthase subunit be...   182    2e-44 
gi|90290693|ref|ZP_01210341.1|  hypothetical protein Bpse17_02...   181    3e-44 
gi|67640711|ref|ZP_00439508.1|  COG0133: Tryptophan synthase b...   181    3e-44 
gi|77815314|ref|ZP_00814550.1|  Tryptophan synthase, beta chai...   181    3e-44 
gi|116512261|ref|YP_809477.1|  Tryptophan synthase beta chain ...   181    3e-44  
gi|83590184|ref|YP_430193.1|  tryptophan synthase, beta subuni...   181    3e-44  
gi|29654460|ref|NP_820152.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|15239755|ref|NP_200292.1|  TSB1 (TRYPTOPHAN SYNTHASE BETA-S...   181    4e-44  
gi|20805954|gb|AAM19168.1|  tryptophan synthase beta chain [Chlam   181    4e-44 
gi|49483565|ref|YP_040789.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|15604889|ref|NP_219673.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|15924362|ref|NP_371896.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|21282988|ref|NP_646076.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|50121228|ref|YP_050395.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|82741494|ref|ZP_00904214.1|  Tryptophan synthase, beta chai...   181    4e-44 
gi|95926268|ref|ZP_01309072.1|  hypothetical protein CburR_010019   181    4e-44 
gi|89895946|ref|YP_519433.1|  hypothetical protein DSY3200 [De...   181    4e-44  
gi|90662404|ref|ZP_01250238.1|  hypothetical protein Bpse110_0...   181    4e-44 
gi|82750963|ref|YP_416704.1|  tryptophan synthase beta chain [...   181    4e-44  
gi|57233820|ref|YP_182187.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|28378349|ref|NP_785241.1|  tryptophan synthase subunit beta...   181    4e-44  
gi|20805978|gb|AAM19186.1|  tryptophan synthase beta chain [Ch...   181    4e-44 
gi|115376256|ref|ZP_01463497.1|  tryptophan synthase, beta sub...   181    5e-44 
gi|88932985|ref|ZP_01138667.1|  Tryptophan synthase, beta chai...   181    5e-44 
gi|113950755|ref|ZP_01436370.1|  tryptophan synthase, beta sub...   181    5e-44 
gi|68542960|ref|ZP_00582679.1|  Tryptophan synthase, beta chai...   181    5e-44 
gi|37953750|gb|AAP50104.1|  tryptophan synthase subunit B [Escher   180    6e-44 
gi|73541992|ref|YP_296512.1|  tryptophan synthase subunit beta...   180    6e-44  
gi|22023385|gb|AAM89059.1|  tryptophan synthase beta subunit [Shi   180    6e-44 
gi|33597847|ref|NP_885490.1|  tryptophan synthase subunit beta...   180    6e-44  
gi|33383963|gb|AAN06483.1|  tryptophan synthase subunit B [Escher   180    7e-44 
gi|83815946|ref|YP_445788.1|  tryptophan synthase, beta subuni...   180    7e-44  
gi|118443484|ref|YP_877425.1|  tryptophan synthase, beta subun...   180    7e-44  
gi|109649199|ref|ZP_01373091.1|  tryptophan synthase, beta sub...   180    8e-44 
gi|77686944|ref|ZP_00802253.1|  Tryptophan synthase, beta chai...   180    8e-44 
gi|113868575|ref|YP_727064.1|  tryptophan synthase beta chain ...   180    8e-44  
gi|37953742|gb|AAP50100.1|  tryptophan synthase subunit B [Escher   180    8e-44 
gi|116058834|emb|CAL54541.1|  Tryptophan synthase beta chain (ISS   180    8e-44 
gi|39932429|sp|Q8PT95|TRPB1_METMA  Tryptophan synthase beta chain   180    9e-44 
gi|13474230|ref|NP_105798.1|  tryptophan synthase subunit beta...   180    9e-44  
gi|82499483|ref|ZP_00884927.1|  Tryptophan synthase, beta chai...   179    9e-44 
gi|70726538|ref|YP_253452.1|  tryptophan synthase subunit beta...   179    1e-43  
gi|775139|gb|AAA65145.1|  tryptophan synthase beta subunit          179    1e-43 
gi|115401506|ref|XP_001216341.1|  tryptophan synthase [Aspergi...   179    1e-43  
gi|41814685|gb|AAS10465.1|  TrpB [Rhodothermus marinus]             179    1e-43 
gi|23128275|ref|ZP_00110126.1|  COG0133: Tryptophan synthase b...   179    1e-43 
gi|37953674|gb|AAP50066.1|  tryptophan synthase subunit B [Escher   179    1e-43 
gi|118473874|ref|YP_887534.1|  tryptophan synthase, beta subun...   179    1e-43  
gi|37526359|ref|NP_929703.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|58039654|ref|YP_191618.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|34498217|ref|NP_902432.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|54023829|ref|YP_118071.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|3212366|pdb|1A5A|B  Chain B, Cryo-Crystallography Of A True...   179    2e-43  
gi|115422187|emb|CAJ48711.1|  tryptophan synthase beta chain [Bor   179    2e-43 
gi|20805950|gb|AAM19165.1|  tryptophan synthase beta chain [Ch...   179    2e-43 
gi|1421253|pdb|1TTP|B  Chain B, Tryptophan Synthase (E.C.4.2.1...   179    2e-43  
gi|4699588|pdb|1A50|B  Chain B, Crystal Structure Of Wild-Type...   179    2e-43  
gi|62180292|ref|YP_216709.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|75212700|ref|ZP_00712698.1|  COG0133: Tryptophan synthase b...   179    2e-43 
gi|118579719|ref|YP_900969.1|  tryptophan synthase, beta subun...   179    2e-43 
gi|33594458|ref|NP_882102.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|22023343|gb|AAM89038.1|  tryptophan synthase beta subunit [Shi   179    2e-43 
gi|49486215|ref|YP_043436.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|23502958|ref|NP_699085.1|  tryptophan synthase subunit beta...   179    2e-43  
gi|88859923|ref|ZP_01134562.1|  tryptophan synthase, beta prot...   179    2e-43 
gi|37953656|gb|AAP50057.1|  tryptophan synthase subunit B [Escher   178    2e-43 
gi|91210553|ref|YP_540539.1|  tryptophan synthase beta chain [...   178    2e-43  
gi|924812|gb|AAA73832.1|  tryptophan synthase beta subunit          178    2e-43 
gi|15963781|ref|NP_384134.1|  tryptophan synthase subunit beta...   178    2e-43  
gi|22023297|gb|AAM89015.1|  tryptophan synthase beta subunit [Shi   178    2e-43 
gi|15801917|ref|NP_287938.1|  tryptophan synthase subunit beta...   178    2e-43  
gi|16129222|ref|NP_415777.1|  tryptophan synthase subunit beta...   178    2e-43  
gi|68164978|gb|AAM19201.2|  tryptophan synthase beta chain [Chlam   178    2e-43 
gi|26247591|ref|NP_753631.1|  tryptophan synthase subunit beta...   178    2e-43  
gi|37953652|gb|AAP50055.1|  tryptophan synthase subunit B [Escher   178    2e-43 
gi|82544285|ref|YP_408232.1|  tryptophan synthase, beta protei...   178    2e-43  
gi|924791|gb|AAA73814.1|  tryptophan synthase beta subunit          178    2e-43 
gi|924784|gb|AAA73808.1|  tryptophan synthase beta subunit          178    3e-43 
gi|22023307|gb|AAM89020.1|  tryptophan synthase beta subunit [Shi   178    3e-43 
gi|2081609|dbj|BAA19928.1|  tryptophan synthase B [Oryza sativa]    178    3e-43  
gi|7674380|sp|P56929|TRPB_RHIET  Tryptophan synthase beta chai...   178    3e-43 
gi|88794642|ref|ZP_01110348.1|  tryptophan synthase, beta prot...   178    3e-43 
gi|37953758|gb|AAP50108.1|  tryptophan synthase subunit B [Escher   178    3e-43 
gi|116249787|ref|YP_765625.1|  putative tryptophan synthase be...   178    3e-43  
gi|22023327|gb|AAM89030.1|  tryptophan synthase beta subunit [...   178    3e-43 
gi|22023379|gb|AAM89056.1|  tryptophan synthase beta subunit [...   178    3e-43 
gi|11513798|pdb|1QOP|B  Chain B, Crystal Structure Of Wild-Typ...   178    3e-43  
gi|16760155|ref|NP_455772.1|  tryptophan synthase subunit beta...   178    3e-43  
gi|22023347|gb|AAM89040.1|  tryptophan synthase beta subunit [...   178    3e-43 
gi|116734165|gb|ABK20144.1|  anthranilate isomerase [Shigella boy   177    3e-43 
gi|22023321|gb|AAM89027.1|  tryptophan synthase beta subunit [...   177    3e-43 
gi|52425208|ref|YP_088345.1|  tryptophan synthase subunit beta...   177    3e-43  
gi|11269302|pir||T47190  tryptophan synthase (EC 4.2.1.20) bet...   177    3e-43 
gi|113873844|ref|ZP_01413973.1|  Tryptophan synthase [Sinorhiz...   177    3e-43 
gi|22023273|gb|AAM89003.1|  tryptophan synthase beta subunit [...   177    4e-43 
gi|22023325|gb|AAM89029.1|  tryptophan synthase beta subunit [...   177    4e-43 
gi|33383965|gb|AAN06484.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|37953732|gb|AAP50095.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|33383969|gb|AAN06486.1|  tryptophan synthase subunit B [Esc...   177    4e-43 
gi|71277952|ref|YP_270200.1|  tryptophan synthase, beta subuni...   177    4e-43  
gi|37953654|gb|AAP50056.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|46578886|ref|YP_009694.1|  tryptophan synthase subunit beta...   177    4e-43  
gi|37953724|gb|AAP50091.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|37953744|gb|AAP50101.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|37953722|gb|AAP50090.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|37953740|gb|AAP50099.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|37953754|gb|AAP50106.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|33383949|gb|AAN06476.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|22023317|gb|AAM89025.1|  tryptophan synthase beta subunit [Shi   177    4e-43 
gi|37953756|gb|AAP50107.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|37953748|gb|AAP50103.1|  tryptophan synthase subunit B [Esc...   177    4e-43 
gi|37953688|gb|AAP50073.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|33383953|gb|AAN06478.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|17933943|ref|NP_530733.1|  tryptophan synthase subunit beta...   177    4e-43  
gi|22023299|gb|AAM89016.1|  tryptophan synthase beta subunit [Shi   177    4e-43 
gi|84711209|ref|ZP_01019511.1|  Tryptophan synthase, beta chai...   177    4e-43 
gi|21730425|pdb|1K7X|B  Chain B, Crystal Structure Of The Beta...   177    4e-43  
gi|22023281|gb|AAM89007.1|  tryptophan synthase beta subunit [Shi   177    4e-43 
gi|37953708|gb|AAP50083.1|  tryptophan synthase subunit B [Escher   177    4e-43 
gi|775173|gb|AAA65169.1|  tryptophan synthase beta subunit          177    4e-43 
gi|15887377|ref|NP_353058.1|  tryptophan synthase subunit beta...   177    4e-43  
gi|28373464|pdb|1KFE|B  Chain B, Crystal Structure Of Alphat18...   177    4e-43  
gi|17988301|ref|NP_540935.1|  tryptophan synthase subunit beta...   177    4e-43  
gi|90420591|ref|ZP_01228498.1|  tryptophan synthase beta chain...   177    5e-43 
gi|114704417|ref|ZP_01437325.1|  tryptophan synthase subunit b...   177    5e-43 
gi|22023351|gb|AAM89042.1|  tryptophan synthase beta subunit [Shi   177    5e-43 
gi|59711635|ref|YP_204411.1|  tryptophan synthase subunit beta...   177    5e-43  
gi|56751957|ref|YP_172658.1|  tryptophan synthase subunit beta...   177    5e-43  
gi|71366612|ref|ZP_00657152.1|  Tryptophan synthase, beta chai...   177    5e-43 
gi|92916535|ref|ZP_01285154.1|  Tryptophan synthase, beta chai...   177    5e-43 
gi|116269225|ref|ZP_01493470.1|  tryptophan synthase, beta sub...   177    6e-43 
gi|114778322|ref|ZP_01453181.1|  tryptophan synthase subunit b...   177    6e-43 
gi|113474438|ref|YP_720499.1|  tryptophan synthase, beta subun...   177    6e-43  
gi|37953694|gb|AAP50076.1|  tryptophan synthase subunit B [Escher   177    6e-43 
gi|37953648|gb|AAP50053.1|  tryptophan synthase subunit B [Escher   177    6e-43 
gi|22023295|gb|AAM89014.1|  tryptophan synthase beta subunit [Shi   177    6e-43 
gi|33383975|gb|AAN06489.1|  tryptophan synthase subunit B [Escher   177    6e-43 
gi|37953670|gb|AAP50064.1|  tryptophan synthase subunit B [Escher   177    6e-43 
gi|37953706|gb|AAP50082.1|  tryptophan synthase subunit B [Escher   177    6e-43 
gi|85712432|ref|ZP_01043481.1|  tryptophan synthase subunit be...   177    7e-43 
gi|1431672|pdb|1UBS|B  Chain B, Tryptophan Synthase (E.C.4.2.1...   177    7e-43  
gi|118070103|ref|ZP_01538339.1|  tryptophan synthase, beta sub...   177    7e-43 
gi|2098382|pdb|2TYS|B  Chain B, Crystal Structures Of Mutant (...   177    7e-43  
gi|22023337|gb|AAM89035.1|  tryptophan synthase beta subunit [Shi   177    7e-43 
gi|38258945|sp|Q8YE60|TRPB_BRUME  Tryptophan synthase beta chain    177    7e-43 
gi|86355689|ref|YP_467581.1|  tryptophan synthase beta chain p...   177    7e-43  
gi|37953736|gb|AAP50097.1|  tryptophan synthase subunit B [Escher   177    7e-43 
gi|91789467|ref|YP_550419.1|  tryptophan synthase, beta subuni...   177    7e-43  
gi|22023301|gb|AAM89017.1|  tryptophan synthase beta subunit [Shi   177    8e-43 
gi|47575238|ref|ZP_00245273.1|  COG0133: Tryptophan synthase b...   176    8e-43 
gi|114331150|ref|YP_747372.1|  tryptophan synthase, beta subun...   176    8e-43  
gi|76261171|ref|ZP_00768790.1|  Tryptophan synthase, beta chai...   176    8e-43 
gi|91228660|ref|ZP_01262575.1|  tryptophan synthase subunit be...   176    9e-43 
gi|52144093|ref|YP_082735.1|  tryptophan synthase subunit beta...   176    9e-43  
gi|106882988|ref|ZP_01350388.1|  tryptophan synthase, beta sub...   176    9e-43 
gi|116183756|ref|ZP_01473726.1|  hypothetical protein VEx2w_02003   176    9e-43 
gi|85714143|ref|ZP_01045132.1|  tryptophan synthase subunit be...   176    9e-43 
gi|68535873|ref|YP_250578.1|  hypothetical protein jk0798 [Cor...   176    9e-43  
gi|62290952|ref|YP_222745.1|  tryptophan synthase subunit beta...   176    1e-42  
gi|22023319|gb|AAM89026.1|  tryptophan synthase beta subunit [Shi   176    1e-42 
gi|111619768|ref|ZP_01406773.1|  tryptophan synthase, beta sub...   176    1e-42 
gi|29832719|ref|NP_827353.1|  tryptophan synthase subunit beta...   176    1e-42  
gi|89210010|ref|ZP_01188403.1|  Tryptophan synthase, beta chai...   176    1e-42 
gi|30261348|ref|NP_843725.1|  tryptophan synthase subunit beta...   176    1e-42  
gi|37953696|gb|AAP50077.1|  tryptophan synthase subunit B [Escher   176    1e-42 
gi|30248702|ref|NP_840772.1|  tryptophan synthase subunit beta...   176    1e-42  
gi|92908021|ref|ZP_01276800.1|  Tryptophan synthase, beta chai...   176    1e-42 
gi|117617538|ref|YP_857431.1|  tryptophan synthase, beta subun...   176    1e-42  
gi|22023339|gb|AAM89036.1|  tryptophan synthase beta subunit [Shi   176    1e-42 
gi|22023333|gb|AAM89033.1|  tryptophan synthase beta subunit [Shi   176    1e-42 
gi|23016132|ref|ZP_00055891.1|  COG0133: Tryptophan synthase b...   176    1e-42 
gi|37953676|gb|AAP50067.1|  tryptophan synthase subunit B [Escher   176    2e-42 
gi|89204537|ref|ZP_01183114.1|  Tryptophan synthase, beta chai...   176    2e-42 
gi|33239640|ref|NP_874582.1|  tryptophan synthase subunit beta...   176    2e-42  
gi|118476813|ref|YP_893964.1|  tryptophan synthase, beta subun...   175    2e-42  
gi|24379019|ref|NP_720974.1|  tryptophan synthase subunit beta...   175    2e-42  
gi|48490|emb|CAA35035.1|  tryptophan synthase; beta subunit [Vibr   175    2e-42 
gi|73662683|ref|YP_301464.1|  tryptophan synthase beta chain [...   175    2e-42  
gi|37953672|gb|AAP50065.1|  tryptophan synthase subunit B [Escher   175    2e-42 
gi|22023303|gb|AAM89018.1|  tryptophan synthase beta subunit [Shi   175    2e-42 
gi|22023305|gb|AAM89019.1|  tryptophan synthase beta subunit [Shi   175    2e-42 
gi|20091809|ref|NP_617884.1|  tryptophan synthase subunit beta...   175    2e-42  
gi|30019390|ref|NP_831021.1|  tryptophan synthase subunit beta...   175    3e-42  
gi|7381256|gb|AAF61457.1|AF139661_2  tryptophan synthase beta sub   175    3e-42 
gi|11513800|pdb|1QOQ|B  Chain B, Crystal Structure Of Wild-Typ...   174    3e-42  
gi|116493647|ref|YP_805381.1|  Tryptophan synthase beta chain ...   174    3e-42  
gi|86147043|ref|ZP_01065360.1|  tryptophan synthase subunit be...   174    3e-42 
gi|77360232|ref|YP_339807.1|  tryptophan synthase, beta protei...   174    3e-42  
gi|84394237|ref|ZP_00992965.1|  tryptophan synthase subunit be...   174    3e-42 
gi|89891708|ref|ZP_01203211.1|  tryptophan synthase, beta chai...   174    4e-42 
gi|13096581|pdb|1FUY|B  Chain B, Crystal Structure Of Betaa169...   174    4e-42  
gi|136276|sp|P17167|TRPB_LACCA  Tryptophan synthase beta chain...   174    4e-42 
gi|47569175|ref|ZP_00239862.1|  tryptophan synthase, beta subu...   174    4e-42 
gi|37953692|gb|AAP50075.1|  tryptophan synthase subunit B [Escher   174    4e-42 
gi|77961362|ref|ZP_00825201.1|  COG0133: Tryptophan synthase b...   174    4e-42 
gi|22125939|ref|NP_669362.1|  tryptophan synthase subunit beta...   174    5e-42  
gi|78213926|ref|YP_382705.1|  tryptophan synthase subunit beta...   174    5e-42  
gi|32423710|gb|AAP81252.1|  tryptophan synthase beta subunit [...   174    5e-42 
gi|72161569|ref|YP_289226.1|  tryptophan synthase, beta chain ...   174    5e-42  
gi|110639668|ref|YP_679878.1|  tryptophan synthase, beta subun...   174    5e-42  
gi|37953646|gb|AAP50052.1|  tryptophan synthase subunit B [Escher   174    5e-42 
gi|42780435|ref|NP_977682.1|  tryptophan synthase subunit beta...   174    5e-42  
gi|72383367|ref|YP_292722.1|  tryptophan synthase subunit beta...   174    5e-42  
gi|21672547|ref|NP_660614.1|  tryptophan synthase subunit beta...   174    5e-42  
gi|116073970|ref|ZP_01471232.1|  tryptophan synthase subunit b...   174    6e-42 
gi|68250040|ref|YP_249152.1|  tryptophan synthase subunit beta...   174    6e-42  
gi|50954795|ref|YP_062083.1|  tryptophan synthase subunit beta...   174    6e-42  
gi|37953684|gb|AAP50071.1|  tryptophan synthase subunit B [Escher   174    6e-42 
gi|15673445|ref|NP_267619.1|  tryptophan synthase subunit beta...   174    6e-42  
gi|21220518|ref|NP_626297.1|  tryptophan synthase subunit beta...   173    7e-42  
gi|56460856|ref|YP_156137.1|  tryptophan synthase subunit beta...   173    7e-42  





>gi|71083194|ref|YP_265913.1|  Tryptophan synthase beta chain 1 [Candidatus Pelagibacter ubique 
HTCC1062]
 gi|91762376|ref|ZP_01264341.1|  Tryptophan synthase beta chain 1 [Candidatus Pelagibacter ubique 
HTCC1002]
 gi|71062307|gb|AAZ21310.1|  Tryptophan synthase beta chain 1 [Candidatus Pelagibacter ubique 
HTCC1062]
 gi|91718178|gb|EAS84828.1|  Tryptophan synthase beta chain 1 [Candidatus Pelagibacter ubique 
HTCC1002]
Length=410

 Score =  483 bits (1244),  Expect = 3e-135, Method: Composition-based stats.
 Identities = 229/285 (80%), Positives = 260/285 (91%), Gaps = 0/285 (0%)

Query  1    MKLRKKIPVIDQGNKLGFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYF  60
            MKL+KKIP+IDQ NK GFWGGKFGGNF+PETLKKPIEDL  LF KL+ DKKF+KERD YF
Sbjct  1    MKLKKKIPLIDQHNKNGFWGGKFGGNFIPETLKKPIEDLTELFEKLRYDKKFLKERDYYF  60

Query  61   KNWIGSPTRFVKLNNLTEHIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICG  120
            KN+IGSPT F+KL NL++H+ GAQI++K+VS+ANGGAHKIYNATVHCL+AK++GKK + G
Sbjct  61   KNYIGSPTSFIKLQNLSDHLSGAQIYAKMVSEANGGAHKIYNATVHCLIAKKAGKKYVVG  120

Query  121  DTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVD  180
            DTGAGYAGKMLSMAAKKFGLKCKIFMGAKDI+RQ+PNV AMKKNGAEVVPVYSGSQTLVD
Sbjct  121  DTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIKRQKPNVDAMKKNGAEVVPVYSGSQTLVD  180

Query  181  AVSECMRYWVANCDKTAMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVK  240
            AVSECMRYWV+NCD T MCVGSTVGP +FV+ICGWST+QISRELKVQ+  EF  +PKK+K
Sbjct  181  AVSECMRYWVSNCDNTHMCVGSTVGPNIFVKICGWSTAQISRELKVQIQSEFKKMPKKIK  240

Query  241  LYNCVGGGSSSFGFWNEFMDYDKKQIEFIGVEAGGPAKSKKHAAP  285
            L NCVGGGSS++GFW+EF+DYDKKQIE IGVEAGGP  SK HAAP
Sbjct  241  LINCVGGGSSAYGFWSEFIDYDKKQIELIGVEAGGPKNSKLHAAP  285


>gi|14520675|ref|NP_126150.1|  tryptophan synthase subunit beta [Pyrococcus abyssi GE5]
 gi|14423982|sp|Q9V1G8|TRPB1_PYRAB  Tryptophan synthase beta chain 1
 gi|5457891|emb|CAB49381.1|  trpB tryptophan synthase, subunit beta (EC 4.2.1.20) [Pyrococcus 
abyssi GE5]
Length=388

 Score =  213 bits (542),  Expect = 8e-54, Method: Composition-based stats.
 Identities = 115/267 (43%), Positives = 163/267 (61%), Gaps = 5/267 (1%)

Query  19   WGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTE  78
            W GKFGG +VPETL +P+ +LE  + +LKND++F ++ D Y + W G PT       LT+
Sbjct  2    WFGKFGGQYVPETLMEPLRELEKAYKRLKNDEEFNRQLDYYLRTWAGRPTPLYYAERLTK  61

Query  79   HIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKF  138
             +GGA+I+ K     +GGAHK  NA    LLAK  GK  +  +TGAG  G   +MA    
Sbjct  62   KVGGAKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGALL  121

Query  139  GLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAM  198
            G+K  I+MGA+D++RQ+ NV  MK  GA V+PV++GS+TL DA++E +R WVA  + +  
Sbjct  122  GMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVHTGSKTLKDAINEALRDWVATFEYSHY  181

Query  199  CVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEF  258
             +GS VGP  +  I     S I RE + Q+L+  G +P  +    CVGGGS++ G +  F
Sbjct  182  LIGSVVGPHPYPIIVRDFQSVIGREAREQILEAEGDLPDVI--VACVGGGSNAMGIFYPF  239

Query  259  MDYDKKQIEFIGVEAGGPA-KSKKHAA  284
            +    K +  IGVEAGG   +S KH+A
Sbjct  240  V--KDKSVRLIGVEAGGKGIESGKHSA  264


>gi|73535403|pdb|1WDW|B  Chain B, Structural Basis Of Mutual Activation Of The Tryptophan 
Synthase A2b2 Complex From A Hyperthermophile, Pyrococcus 
Furiosus
 gi|73535405|pdb|1WDW|D  Chain D, Structural Basis Of Mutual Activation Of The Tryptophan 
Synthase A2b2 Complex From A Hyperthermophile, Pyrococcus 
Furiosus
 gi|73535407|pdb|1WDW|F  Chain F, Structural Basis Of Mutual Activation Of The Tryptophan 
Synthase A2b2 Complex From A Hyperthermophile, Pyrococcus 
Furiosus
 gi|73535409|pdb|1WDW|H  Chain H, Structural Basis Of Mutual Activation Of The Tryptophan 
Synthase A2b2 Complex From A Hyperthermophile, Pyrococcus 
Furiosus
 gi|73535411|pdb|1WDW|J  Chain J, Structural Basis Of Mutual Activation Of The Tryptophan 
Synthase A2b2 Complex From A Hyperthermophile, Pyrococcus 
Furiosus
 gi|73535413|pdb|1WDW|L  Chain L, Structural Basis Of Mutual Activation Of The Tryptophan 
Synthase A2b2 Complex From A Hyperthermophile, Pyrococcus 
Furiosus
Length=385

 Score =  212 bits (540),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 116/267 (43%), Positives = 165/267 (61%), Gaps = 5/267 (1%)

Query  19   WGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTE  78
            W G+FGG +VPETL +P+++LE  + + K+D++F ++ + Y K W G PT       LTE
Sbjct  2    WFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLTE  61

Query  79   HIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKF  138
             IGGA+I+ K     +GGAHK  NA    LLAK  GK  +  +TGAG  G   +MA    
Sbjct  62   KIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGALL  121

Query  139  GLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAM  198
            G+K  I+MGA+D++RQ+ NV  MK  GA V+PV SGS+TL DA++E +R WVA  + T  
Sbjct  122  GMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTHY  181

Query  199  CVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEF  258
             +GS VGP  +  I     S I RE K Q+L+  G +P  +    CVGGGS++ G +  F
Sbjct  182  LIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVI--VACVGGGSNAMGIFYPF  239

Query  259  MDYDKKQIEFIGVEAGGPA-KSKKHAA  284
            +  + K+++ +GVEAGG   +S KH+A
Sbjct  240  V--NDKKVKLVGVEAGGKGLESGKHSA  264


>gi|21673356|ref|NP_661421.1|  tryptophan synthase subunit beta [Chlorobium tepidum TLS]
 gi|34222901|sp|Q8KF11|TRPB_CHLTE  Tryptophan synthase beta chain
 gi|21646451|gb|AAM71763.1|  tryptophan synthase, beta subunit [Chlorobium tepidum TLS]
Length=400

 Score =  212 bits (540),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 119/264 (45%), Positives = 156/264 (59%), Gaps = 3/264 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG F+PETL K   DLE  + K KND +F +  D   ++++G PT     + L+E  
Sbjct  17   GTFGGKFIPETLVKNAADLEEEYLKAKNDPEFHQTLDNLLRHYVGRPTPLYHASRLSEKQ  76

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGAQIW K     + GAHKI NA    LLAKR GKK I  +TGAG  G   +     FGL
Sbjct  77   GGAQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVATATVCALFGL  136

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
             C ++MG +DI+RQ PNV  MK  G EV PV +GS+TL DA SE +R W+ N ++T   V
Sbjct  137  DCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSRTLKDATSEAIRDWMNNPEETFYIV  196

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS +G   +  +     S I RE + Q+LD+ G +P  +    CVGGGS++ G + EF+ 
Sbjct  197  GSVIGMHPYPMMVRDFQSVIGRETRQQVLDQAGRLPDVI--VACVGGGSNAIGMFYEFLP  254

Query  261  YDKKQIEFIGVEAGGPAKSKKHAA  284
             D K++E IGVEA G     KHAA
Sbjct  255  -DAKEVELIGVEAAGEGLEGKHAA  277


>gi|18978078|ref|NP_579435.1|  tryptophan synthase subunit beta [Pyrococcus furiosus DSM 3638]
 gi|24212542|sp|Q8U093|TRPB1_PYRFU  Tryptophan synthase beta chain 1
 gi|61680106|pdb|1V8Z|A  Chain A, X-Ray Crystal Structure Of The Tryptophan Synthase B2 
Subunit From Hyperthermophile, Pyrococcus Furiosus
 gi|61680107|pdb|1V8Z|B  Chain B, X-Ray Crystal Structure Of The Tryptophan Synthase B2 
Subunit From Hyperthermophile, Pyrococcus Furiosus
 gi|61680108|pdb|1V8Z|C  Chain C, X-Ray Crystal Structure Of The Tryptophan Synthase B2 
Subunit From Hyperthermophile, Pyrococcus Furiosus
 gi|61680109|pdb|1V8Z|D  Chain D, X-Ray Crystal Structure Of The Tryptophan Synthase B2 
Subunit From Hyperthermophile, Pyrococcus Furiosus
 gi|18893869|gb|AAL81830.1|  tryptophan synthase, subunit beta; (trpB-2) [Pyrococcus furiosus 
DSM 3638]
 gi|22775324|dbj|BAC11855.1|  tryptophan synthase beta subunit [Pyrococcus furiosus]
Length=388

 Score =  212 bits (540),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 116/267 (43%), Positives = 165/267 (61%), Gaps = 5/267 (1%)

Query  19   WGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTE  78
            W G+FGG +VPETL +P+++LE  + + K+D++F ++ + Y K W G PT       LTE
Sbjct  2    WFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLTE  61

Query  79   HIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKF  138
             IGGA+I+ K     +GGAHK  NA    LLAK  GK  +  +TGAG  G   +MA    
Sbjct  62   KIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGALL  121

Query  139  GLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAM  198
            G+K  I+MGA+D++RQ+ NV  MK  GA V+PV SGS+TL DA++E +R WVA  + T  
Sbjct  122  GMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTHY  181

Query  199  CVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEF  258
             +GS VGP  +  I     S I RE K Q+L+  G +P  +    CVGGGS++ G +  F
Sbjct  182  LIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVI--VACVGGGSNAMGIFYPF  239

Query  259  MDYDKKQIEFIGVEAGGPA-KSKKHAA  284
            +  + K+++ +GVEAGG   +S KH+A
Sbjct  240  V--NDKKVKLVGVEAGGKGLESGKHSA  264


>gi|15614226|ref|NP_242529.1|  tryptophan synthase subunit beta [Bacillus halodurans C-125]
 gi|20140839|sp|Q9KCB0|TRPB_BACHD  Tryptophan synthase beta chain
 gi|10174280|dbj|BAB05382.1|  tryptophan synthase beta chain [Bacillus halodurans C-125]
Length=399

 Score =  207 bits (528),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 112/265 (42%), Positives = 160/265 (60%), Gaps = 6/265 (2%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G FGG +VPETL   IE+LE+  N   ND+ FI +  ++ + + G PT      N++E +
Sbjct  13   GTFGGKYVPETLMSAIEELELALNDAMNDEAFIHDYKEHLREYAGRPTALTYAKNMSETL  72

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA+I+ K     + GAHK+ NA    LLAKR GKK I  +TGAG  G   +  A +FGL
Sbjct  73   GGAKIYLKREDLLHTGAHKLNNAMGQALLAKRMGKKKIVAETGAGQHGVATATIAARFGL  132

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +CK+FMG +D++RQ  NV  M+  GAEVVP  SGS+TL DA +E +RYWV + D T   +
Sbjct  133  ECKVFMGEEDMERQALNVFRMELLGAEVVPATSGSKTLKDATNEAIRYWVTHADDTFYLI  192

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS VGP  + ++       I  E + Q  +  G++P +V    CVGGGS++ G +  F++
Sbjct  193  GSVVGPHPYPQMVRDFQRIIGDEARAQFQEITGTLPTEV--IACVGGGSNAIGTFYPFLE  250

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAA  284
             D   ++ IGVEA G   ++ +HAA
Sbjct  251  DD---VKLIGVEAAGKGVETSQHAA  272


>gi|67940045|ref|ZP_00532518.1|  Tryptophan synthase, beta chain [Chlorobium phaeobacteroides 
BS1]
 gi|67913740|gb|EAM63115.1|  Tryptophan synthase, beta chain [Chlorobium phaeobacteroides 
BS1]
Length=400

 Score =  207 bits (526),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 113/264 (42%), Positives = 155/264 (58%), Gaps = 3/264 (1%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            GK+GG F+PETL K   DLE  + K K D+ F  E +K  ++++G PT      +L+ HI
Sbjct  16   GKYGGKFIPETLIKNASDLEDEYKKAKEDQAFWNEYEKLLRHYVGRPTPLYHAEHLSRHI  75

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGAQI+ K     + GAHKI NA    LLA+R GKK I  +TGAG  G   +     F L
Sbjct  76   GGAQIYLKREDLCHTGAHKINNALGQALLARRMGKKRIIAETGAGQHGVATATVCALFDL  135

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
             C ++MGA+DI+RQ PNV  MK  GAEV PV +G++TL DA SE +R W+ N ++T   +
Sbjct  136  DCIVYMGAEDIRRQAPNVARMKLLGAEVRPVENGTKTLKDATSEAIRDWINNPEETFYII  195

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS VG   +  +     + I RE + Q+L++ G +P  +    CVGGGS++ G +  F+D
Sbjct  196  GSVVGMHPYPMMVRDFQAVIGRETRQQILEQTGRLPDVITA--CVGGGSNAIGMFYAFLD  253

Query  261  YDKKQIEFIGVEAGGPAKSKKHAA  284
                 IE +GVEA G      HAA
Sbjct  254  -SAGDIEMVGVEAAGEGLEALHAA  276


>gi|118684657|gb|EAV91013.1|  tryptophan synthase, beta subunit [Marinomonas sp. MWYL1]
Length=418

 Score =  207 bits (526),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 162/259 (62%), Gaps = 5/259 (1%)

Query  17   GFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNL  76
            GF+G ++GG+++PE L    + +   F + KND +F+ E +K ++ + G PT      NL
Sbjct  6    GFYG-QYGGSYIPEILYSSQQQILHAFEEAKNDPEFLAELNKQWQQFSGRPTPLTFCANL  64

Query  77   TEHIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAK  136
            TEH GGAQI+ K     + GAHK+ N     LL KR GKK +  +TGAG  G   ++ A 
Sbjct  65   TEHFGGAQIYLKREDLNHSGAHKMNNVIGQGLLVKRMGKKRVIAETGAGQHGIATALVAA  124

Query  137  KFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKT  196
            + GL+C I+MGAKDI+RQ PNV  MK+ GA VVPV +G+QTL DA+ E +R W ++ +++
Sbjct  125  RLGLECTIYMGAKDIERQYPNVFWMKQLGATVVPVTTGAQTLRDALDEALRDWSSSHEES  184

Query  197  AMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWN  256
               +G++ G A F  +  +  S I  E++ Q + +FG  P   +LY CVGGGS++ G + 
Sbjct  185  HYLIGTSCGCAPFPEMVAFFQSVIGNEVREQSVAQFGQFPD--RLYACVGGGSNACGLFL  242

Query  257  EFMDYDKKQIEFIGVEAGG  275
             F+  D K++E +GVEAGG
Sbjct  243  PFL--DDKEVEMVGVEAGG  259


>gi|51245483|ref|YP_065367.1|  tryptophan synthase subunit beta [Desulfotalea psychrophila LSv54]
 gi|50876520|emb|CAG36360.1|  probable tryptophan synthase, beta subunit [Desulfotalea psychrophila 
LSv54]
Length=410

 Score =  206 bits (525),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 116/272 (42%), Positives = 161/272 (59%), Gaps = 6/272 (2%)

Query  14   NKLGFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKL  73
            NK GF+G  +GG ++PE L++  + LE  + + +ND  F +E  +    +   PT     
Sbjct  2    NKKGFFG-NWGGVYLPEILRETFDRLEEAYQQARNDPSFWQEYLQLMSTYSCRPTPLTYA  60

Query  74   NNLTEHIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSM  133
             NL++H GGAQI+ K     + GAHK  N     LL KR GKK +  +TGAG  G   + 
Sbjct  61   ENLSKHFGGAQIYIKREDLNHTGAHKANNVMGQGLLVKRMGKKRVIAETGAGQHGVATAT  120

Query  134  AAKKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANC  193
             A KFGL+C I+MG  D+QRQ+PNV  M+K GA VVPV  GS+TL DA++E  R WV+N 
Sbjct  121  MAAKFGLECTIYMGEVDVQRQRPNVFWMEKMGATVVPVKDGSRTLKDAINEAFRDWVSNI  180

Query  194  DKTAMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFG  253
            D T   +G+  GPA F  +  W  S I  E + Q+    G  PK+V  Y CVGGGS++ G
Sbjct  181  DDTHYVLGTACGPAPFPEMVSWFQSIIGTEAREQIERYHGRPPKRV--YACVGGGSNAMG  238

Query  254  FWNEFMDYDKKQIEFIGVEAGGPA-KSKKHAA  284
             +  F+  + K+IE +GVEAGG   ++ +HAA
Sbjct  239  IFQGFL--EDKKIELVGVEAGGDGLETGRHAA  268


>gi|85110137|ref|XP_963281.1|  TRYPTOPHAN SYNTHASE [Neurospora crassa OR74A]
 gi|136372|sp|P13228|TRP_NEUCR  Tryptophan synthase
 gi|168916|gb|AAA33616.1|  tryptophan synthetase
 gi|28924955|gb|EAA34045.1|  TRYPTOPHAN SYNTHASE [Neurospora crassa]
Length=708

 Score =  205 bits (521),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 115/265 (43%), Positives = 158/265 (59%), Gaps = 6/265 (2%)

Query  21   GKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYFKNWIGSPTRFVKLNNLTEHI  80
            G+FGG +VPE L   + +LE  FNK+K+D  F +E   Y+  W+G P +  K   LTE+ 
Sbjct  315  GEFGGQYVPEALMDCLSELEEGFNKIKDDPAFWEEYRSYYP-WMGRPGQLHKAERLTEYA  373

Query  81   GGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICGDTGAGYAGKMLSMAAKKFGL  140
            GGA IW K     + G+HKI NA    LLA+R GKK I  +TGAG  G   +    KFG+
Sbjct  374  GGANIWLKREDLNHTGSHKINNALGQLLLARRLGKKKIIAETGAGQHGVATATVCAKFGM  433

Query  141  KCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVDAVSECMRYWVANCDKTAMCV  200
            +C +FMGA+D++RQ  NV  MK  GA+VV V +GS+TL DAV+E +RYWV N   T   +
Sbjct  434  ECTVFMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVNEALRYWVVNLADTHYII  493

Query  201  GSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVKLYNCVGGGSSSFGFWNEFMD  260
            GS +GP  F  I     S I  E K Q+L++ G +P  V    CVGGGS++ G +  F  
Sbjct  494  GSAIGPHPFPTIVRTFQSVIGNETKQQMLEKRGKLPDAV--VACVGGGSNAVGMFYPFS-  550

Query  261  YDKKQIEFIGVEAGGPA-KSKKHAA  284
             +   ++ +GVEAGG    + +H+A
Sbjct  551  -NDPSVKLLGVEAGGDGVDTPRHSA  574



ORF finding

---------------------------Any Codons------------------------------

Sens direct

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 344 to base 823.
ACCGGCACAACTTCAGCTCCATTTTTTTTCATCGCTCTTACATTTGGTTGTTGTCTTTGT
ATATCTTTTGCACCCATAAAAATCTTACATTTTAATCCAAATTTTTTTGCCGCCATACTT
AACATTTTGCCTGCATACCCAGCTCCTGTATCACCACAAATCATTTTTTTACCTGATCTT
TTTGCTAACAAACAATGCACTGTAGCATTGTATATTTTATGTGCTCCTCCATTGGCATCT
GAAACTACTTTAGACCAAATTTGTGCACCTCCAATATGTTCTGTTAGATTATTCAATTTT
ACAAATCTTGTTGGAGAACCTATCCAATTTTTAAAATATTTGTCCCTCTCTTTGATAAAT
TTTTTATCATTTTTCAATTTATTAAATAATATTTCCAAATCTTCAATTGGTTTCTTTAAT
GTTTCAGGAACAAAATTTCCACCAAATTTTCCACCCCAGAAACCAAGTTTGTTACCTTGA


>Translation of ORF number 1 in reading frame 2 on the direct strand.
TGTTSAPFFFIALTFGCCLCISFAPIKILHFNPNFFAAILNILPAYPAPVSPQIIFLPDL
FANKQCTVALYILCAPPLASETTLDQICAPPICSVRLFNFTNLVGEPIQFLKYLSLSLIN
FLSFFNLLNNISKSSIGFFNVSGTKFPPNFPPQKPSLLP*

>ORF number 1 in reading frame 3 on the direct strand extends from base 195 to base 422.
AAATTTGACTTGTACTCCATCCACATATTCGAACAAAAACTGCTGGACCAACTGTACTTC
CTACACACATTGCTGTTTTGTCACAGTTTGCTACCCAATACCTCATACATTCTGAAACAG
CATCTACAAGAGTTTGACTTCCTGAATAAACCGGCACAACTTCAGCTCCATTTTTTTTCA
TCGCTCTTACATTTGGTTGTTGTCTTTGTATATCTTTTGCACCCATAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
KFDLYSIHIFEQKLLDQLYFLHTLLFCHSLLPNTSYILKQHLQEFDFLNKPAQLQLHFFS
SLLHLVVVFVYLLHP*


Sens reverse
>ORF number 1 in reading frame 1 on the reverse strand extends from base 25 to base 882.
AATATGAAACTAAGAAAAAAAATTCCAGTAATCGATCAAGGTAACAAACTTGGTTTCTGG
GGTGGAAAATTTGGTGGAAATTTTGTTCCTGAAACATTAAAGAAACCAATTGAAGATTTG
GAAATATTATTTAATAAATTGAAAAATGATAAAAAATTTATCAAAGAGAGGGACAAATAT
TTTAAAAATTGGATAGGTTCTCCAACAAGATTTGTAAAATTGAATAATCTAACAGAACAT
ATTGGAGGTGCACAAATTTGGTCTAAAGTAGTTTCAGATGCCAATGGAGGAGCACATAAA
ATATACAATGCTACAGTGCATTGTTTGTTAGCAAAAAGATCAGGTAAAAAAATGATTTGT
GGTGATACAGGAGCTGGGTATGCAGGCAAAATGTTAAGTATGGCGGCAAAAAAATTTGGA
TTAAAATGTAAGATTTTTATGGGTGCAAAAGATATACAAAGACAACAACCAAATGTAAGA
GCGATGAAAAAAAATGGAGCTGAAGTTGTGCCGGTTTATTCAGGAAGTCAAACTCTTGTA
GATGCTGTTTCAGAATGTATGAGGTATTGGGTAGCAAACTGTGACAAAACAGCAATGTGT
GTAGGAAGTACAGTTGGTCCAGCAGTTTTTGTTCGAATATGTGGATGGAGTACAAGTCAA
ATTTCTAGAGAACTCAAAGTCCAGTTATTGGATGAATTTGGTTCTATTCCAAAAAAAGTA
AAGCTTTATAATTGTGTTGGAGGAGGTTCATCAAGTTTTGGATTTTGGAATGAATTTATG
GATTACGATAAAAAACAAATTGAATTTATAGGAGTCGAGGCTGGAGGACCTGCCAAAAGT
AAAAAACATGCAGCACCT

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
NMKLRKKIPVIDQGNKLGFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKY
FKNWIGSPTRFVKLNNLTEHIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMIC
GDTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLV
DAVSECMRYWVANCDKTAMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKV
KLYNCVGGGSSSFGFWNEFMDYDKKQIEFIGVEAGGPAKSKKHAAP

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

--------------------------ATG-----------------------------
Sens direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


Sens reverse

>ORF number 1 in reading frame 1 on the reverse strand extends from base 28 to base 882.
ATGAAACTAAGAAAAAAAATTCCAGTAATCGATCAAGGTAACAAACTTGGTTTCTGGGGT
GGAAAATTTGGTGGAAATTTTGTTCCTGAAACATTAAAGAAACCAATTGAAGATTTGGAA
ATATTATTTAATAAATTGAAAAATGATAAAAAATTTATCAAAGAGAGGGACAAATATTTT
AAAAATTGGATAGGTTCTCCAACAAGATTTGTAAAATTGAATAATCTAACAGAACATATT
GGAGGTGCACAAATTTGGTCTAAAGTAGTTTCAGATGCCAATGGAGGAGCACATAAAATA
TACAATGCTACAGTGCATTGTTTGTTAGCAAAAAGATCAGGTAAAAAAATGATTTGTGGT
GATACAGGAGCTGGGTATGCAGGCAAAATGTTAAGTATGGCGGCAAAAAAATTTGGATTA
AAATGTAAGATTTTTATGGGTGCAAAAGATATACAAAGACAACAACCAAATGTAAGAGCG
ATGAAAAAAAATGGAGCTGAAGTTGTGCCGGTTTATTCAGGAAGTCAAACTCTTGTAGAT
GCTGTTTCAGAATGTATGAGGTATTGGGTAGCAAACTGTGACAAAACAGCAATGTGTGTA
GGAAGTACAGTTGGTCCAGCAGTTTTTGTTCGAATATGTGGATGGAGTACAAGTCAAATT
TCTAGAGAACTCAAAGTCCAGTTATTGGATGAATTTGGTTCTATTCCAAAAAAAGTAAAG
CTTTATAATTGTGTTGGAGGAGGTTCATCAAGTTTTGGATTTTGGAATGAATTTATGGAT
TACGATAAAAAACAAATTGAATTTATAGGAGTCGAGGCTGGAGGACCTGCCAAAAGTAAA
AAACATGCAGCACCT

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MKLRKKIPVIDQGNKLGFWGGKFGGNFVPETLKKPIEDLEILFNKLKNDKKFIKERDKYF
KNWIGSPTRFVKLNNLTEHIGGAQIWSKVVSDANGGAHKIYNATVHCLLAKRSGKKMICG
DTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIQRQQPNVRAMKKNGAEVVPVYSGSQTLVD
AVSECMRYWVANCDKTAMCVGSTVGPAVFVRICGWSTSQISRELKVQLLDEFGSIPKKVK
LYNCVGGGSSSFGFWNEFMDYDKKQIEFIGVEAGGPAKSKKHAAP

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.