ORF QG23890

From Metagenes

Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120595547
Annotathon code: ORF_QG23890
Sample :
  • GPS :24°29'18n; 83°4'12w
  • Caribbean Sea: Off Key West, FL - USA
  • Coastal (-1.7m, 25°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2008
Username : FLOUKAM
Annotated on : 2008-05-22 08:10:28
  • AUGE Camille
  • CHEILAN Florie

Contents

Synopsis

  • Gene symbol: clp
  • Taxonomy: Cyanobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1117
    Kingdom: Bacteria - Phylum: Cyanobacteria - Class: - Order:
    Bacteria; Cyanobacteria;

Genomic Sequence

>JCVI_READ_1091120595547 ORF_QG23890 genomic DNA
ATTGCATATTTACTTTGAATGATTAGAAATTAGCACCAGCTAGCTCTTGAGAAGATTCTTCAGAAGAAATATTTATTGTAACTTTTTTATCATCATCTAT
ATCAACTAAAGCATTATCTCCATCTTTTATTCTGCCAGAAAGAACTTCTTCAGCCAAACTATCTTCTAGTAAACGCATAACTGCCCTTCTTAAAGGTCTC
GCTCCGTATGAAGGATTGTAACCTTCTTCAACAAGTCTTTCTTTGAAAGCATCGGTGACATTTAATTTAATACCTTTATCTTGAAGTCGGATAAAGACCT
CTTGCAACATTATTTCAGCAATTTGTTTAACTTCATTTTTCGTTAATTGCCTGAATACAATTATTTCATCAAGTCTATTTAAAAATTCAGGCCTAAAGTA
TTGCTTAAGTTCTTCATTAACTAGTGATTTAATTCTATTATATTGGCTATCTTCAACTGAATCACCTGAGAATTCGAATCCCAGTCCGCCACCACCTTTT
TCGATTACTTTTGAACCGATATTAGAGGTCATTATTAACAATGTATTTTTAAAATCTACAGTTCTACCTTTGGAGTCAGTTAATCTTCCGTCTTCAAGTA
GTTGCAATAATAAGTTGAAAACATCTGGATGCGCCTTTTCAACTTCATCAAATAAAACGACTGTATAAGGACGTCTTCTAACAGCTTCAGTAAGCTGACC
ACCTTCATTAAAACCAACATAGCCAGGAGGCGAGCCTATAAGTTTACTAACTGTATGTCTTTCCATGAACTCTGACATATCTAATCTGATCATTGCTTCT
TCACTACCGAAGAAATATGAAGCCAATGATTTA

Translation

[2 - 808/833]   indirect strand
>ORF_QG23890 Translation [2-808   indirect strand]
KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVLFDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLI
MTSNIGSKVIEKGGGGLGFEFSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVFIRLQDKGIKLNVTDAFKERL
VEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDNALVDIDDDKKVTINISSEESSQELAGANF
[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

PROTOCOLE:
Arbre obtenu par: PHYLIP/Parcimonie à Infobiogen  
Traitement: Protpars/
Option sur la construction de l'arbre: Randomization de l'ordre des séquences/
Nature de l'arbre à construire: sans racine
Arbre obtenu avec les séquences de 10 bactéries, 8 eucaryotes, 4 archaes


                                      +-----------------------------Roseiflexus sp. RS-1 [GNS bacteria]
                                      !  
                                      !           +-----------------Treponema pallidum [spirochetes]
                                      !           !  
                                      !           !           +-----Phycomyces blakesleianus [fungi]
                                      !        +-17  +-------20  
                                      !        !  !  !        !  +--Leishmania donovani [euglenosa]
        +----------------------------21        !  !  !        +-19  
        !                             !        !  +-18           +--Dictyostelium discoïdum [Conosa]
        !                             !        !     !  
        !                             !  +----14     !        +-----Gemmata obscuriglobus UQM 2246 [Planctomycetes]
        !                             !  !     !     +-------16  
        !                             !  !     !              !  +--Methanococcoïdes burtonii DSM 6242 [euryarchaeotes]
        !                             !  !     !              +-15  
        !                             +-13     !                 +--Methanohalophilus portucalencis [euryarchaeotes]
        !                                !     !  
     +-11                                !     +--------------------Oceanobacter sp. RED65 [g proteobacterie]
     !  !                                !  
     !  !                                !                       +--Candidatus methanoregula boonei 6M8 [euryarchaeotes]
     !  !                                +----------------------12  
     !  !                                                        +--Methanospirillum hungatei FG-1 [euryarchaeotes]
     !  !  
     !  !                                +--------------------------Thermoga petrophila RKU-1 [thermogales]
     !  !                                !  
     !  !                                !  +-----------------------Thermoanaerobacter pseudethanolicus [firmicutes]
     !  +-------------------------------10  !  
     !                                   !  !                 +-----Frankia alni ACN14a [high GC Gram+]
     !                                   !  !  +--------------9  
     !                                   +--8  !              !  +--Theileria annulata strainankara [alveolata]
  +--2                                      !  !              +-22  
  !  !                                      !  !                 +--Phaeodactyllum tricornitum [stramenopiles]
  !  !                                      !  !  
  !  !                                      +--7                 +--Guillardia theta [cryptomonads]
  !  !                                         !           +-----5  
  !  !                                         !           !     +--Gracilaria tenuistipitata var. liui [red algae]
  !  !                                         !        +--4  
  1  !                                         !        !  !     +--Ostreococcus tauri [green algae]
  !  !                                         +--------3  +-----6  
  !  !                                                  !        +--ORF_QG2389
  !  !                                                  !  
  !  !                                                  +-----------Prochlorococcus marinus str. MIT 9301 [cyanobacterie]
  !  !  
  !  +--------------------------------------------------------------Gramella forsetii KT0803 [CFB group bacteria]
  !  
  +-----------------------------------------------------------------Chlorobium phaeobacteroïdes BS1 [green sulfur bacteria]





PROTOCOLE:
Arbre obtenu par: PHYLIP/Neighbor-joining à Infobiogen  
Nature des données:Séquences/ Nature des séquences:protéiques/ Traitement: Neighbor/
Option sur la construction de l'arbre: Randomization de l'ordre des séquences/
Nature de l'arbre à construire: sans racine
Arbre obtenu avec les séquences de 10 bactéries, 8 eucaryotes, 4 archaes





           +----------------Thermoga petrophila RKU-1 [thermogales]
           !  
           !     +----------------------------------Theileria annulata strainankara [alveolata]
           !     !  
           !     !  +------------------Roseiflexus sp. RS-1 [GNS bacteria]
           !  +-15  !  
           !  !  !  !                 +-------Methanococcoïdes burtonii DSM 6242 [euryarchaeotes]
           !  !  !  !        +--------3 
           !  !  !  !     +-16        +------Methanohalophilus portucalencis [euryarchaeotes]
  +-------13  !  +-17     !  !  
  !        !  !     !  +-18  +-----------Gemmata obscuriglobus UQM 2246 [Planctomycetes]
  !        !  !     !  !  !  
  !        !  !     !  !  +-----------------Treponema pallidum [spirochetes]
  !        !  !     !  !  
  !        !  !     +-20               +----Candidatus methanoregula boonei 6M8 [euryarchaeotes]
  !        !  !        !  +------------1 
  !        !  !        !  !            +----Methanospirillum hungatei FG-1 [euryarchaeotes]
  !        !  !        !  !  
  !        +-14        +-21         +--------------Dictyostelium discoïdum [Conosa]
  !           !           !       +-8 
  !           !           !  +----9 +----------------Leishmania donovani [euglenosa]
  !           !           !  !    ! 
  !           !           +-19    +------------------Phycomyces blakesleianus [fungi] 
  !           !              !  
  !           !              +-----------------Oceanobacter sp. RED65 [g proteobacterie]
  !           !  
  !           !     +-----------Thermoanaerobacter pseudethanolicus [firmicutes]
  !           !  +-11  
  !           !  !  +--------------Frankia alni ACN14a [high GC Gram+]  
  !           !  !  
  !           !  !           +----Gracilaria tenuistipitata var. liui [red algae]  
  !           !  !        +--5 
  !           +-12        !  +---Guillardia theta [cryptomonads] 
  !              !     +--6 
  !              !     !  !     +ORF_QG2389
  !              !  +--7  +-----2 
  !              !  !  !        +Prochlorococcus marinus str. MIT 9301 [cyanobacterie]
  !              +-10  ! 
  !                 !  +--------- Ostreococcus tauri [green algae]
  !                 !  
  !                 +------------------Phaeodactyllum tricornitum [stramenopiles] 
  ! 
  4-------------Gramella forsetii KT0803 [CFB group bacteria]
  ! 
  +------------Chlorobium phaeobacteroïdes BS1 [green sulfur bacteria]








____________________________________________________________________________________________________
PROTOCOLE:
Arbre obtenu par: PHYLIP/Parcimonie à Infobiogen  
Traitement: Protpars/
Option sur la construction de l'arbre: Randomization de l'ordre des séquences/
Nature de l'arbre à construire: avec racine/Numéro groupe extérieur:16

Groupe d'étude: 10 cyanobactéries + 5 eucaryotes photosynthétiques
Groupe extérieur : 5 Autres bactéries





  +-----------------------------------------------------------Mycobacterium leprae TN [actinobacteria]    
  !  
  !                                                        +--Tretragenococcus halophilus [firmicutes]    
  !                                                     +-20  
  !                                               +----19  +--Magnetospirullum gryphiswaldense MSR-1 [alpha proteobacterie]   
  !                                               !     !  
  !  +-------------------------------------------18     +-----Chlamydomonas reinhardtii [green algae]    
  !  !                                            !  
  !  !                                            !        +--Leptospira interrogans serovar [spirochetes]     
 15  !                                            +-------17  
  !  !                                                     +--Bacteroides vulgatus ATCC 8482 [CFB]   
  !  !  
  !  !                                   +--------------------Thermosynechococcus elongatus BP-1 [cyanobacterie]    
  !  !                                   !  
  !  !                             +----14  +-----------------Acaryochoris marina MBIC11017 [cyanobacterie]    
  !  !                             !     !  !  
  !  !                             !     !  !           +-----Microcystis aeruginosa NIES-843 [cyanobacterie]     
  !  !                             !     +-13  +-------11  
  !  !                             !        !  !        !  +--Cyanothece sp. CCY 0110 [cyanobacterie]    
  +-16                             !        !  !        +-10  
     !                             !        +--9           +--Crocosphaera watsonii WH8501 [cyanobacterie]    
     !                       +-----7           !  
     !                       !     !           !        +-----Gloeobacter violaceus PCC 7421 [cyanobacterie]     
     !                       !     !           +-------12  
     !                       !     !                    !  +--Nostoc sp. PCC 7120  [cyanobacterie]    
     !                       !     !                    +--8  
     !                       !     !                       +--Anabaena variabilis ATCC 29413 [cyanobacterie]    
     !              +--------4     !  
     !              !        !     !                       +--Synechococcus sp. WH 5701 [cyanobacterie]   
     !              !        !     +-----------------------6  
     !              !        !                             +--Prochlorococcus marinus str. MIT 9301 [cyanobacterie]   
     !              !        !  
     +--------------2        !                             +--Porphyra purpurea [red algae]    
                    !        +-----------------------------3  
                    !                                      +--Gracilaria tenuistipitata var. liui [red algae]     
                    !  
                    !                                      +--ORF_QG2389
                    !                                   +--5  
                    +-----------------------------------1  +--Ostreococcus tauri [green algae]    
                                                        !  
                                                        +-----Physcomitrella patens subsp. patens [mosses]    

  





  +-----------------------------------------------------------Mycobacterium leprae TN [actinobacteria]    
  !  
  !                                                     +-----Magnetospirullum gryphiswaldense MSR-1 [alpha proteobacterie]   
  !  +-------------------------------------------------19  
  !  !                                                  !  +--Tretragenococcus halophilus [firmicutes]    
 15  !                                                  +-20  
  !  !                                                     +--Chlamydomonas reinhardtii [green algae]    
  !  !  
  !  !                                                     +--Leptospira interrogans serovar [spirochetes]     
  !  !        +-------------------------------------------17  
  !  !        !                                            +--Bacteroides vulgatus ATCC 8482 [CFB]   
  +-18        !  
     !        !                          +--------------------Thermosynechococcus elongatus BP-1 [cyanobacterie]    
     !        !                          !  
     !        !                    +----14  +-----------------Acaryochoris marina MBIC11017 [cyanobacterie]    
     !        !                    !     !  !  
     !        !                    !     !  !        +--------Gloeobacter violaceus PCC 7421 [cyanobacterie]     
     !        !                    !     +-13  +----12  
     !        !                    !        !  !     !  +-----Microcystis aeruginosa NIES-843 [cyanobacterie]     
     !        !                    !        !  !     +-11  
     +-------16                    !        !  !        !  +--Cyanothece sp. CCY 0110 [cyanobacterie]    
              !              +-----7        +--9        +-10  
              !              !     !           !           +--Crocosphaera watsonii WH8501 [cyanobacterie]    
              !              !     !           !  
              !              !     !           !           +--Nostoc sp. PCC 7120  [cyanobacterie]    
              !              !     !           +-----------8  
              !              !     !                       +--Anabaena variabilis ATCC 29413 [cyanobacterie]     
              !     +--------4     !  
              !     !        !     !                       +--Synechococcus sp. WH 5701 [cyanobacterie]   
              !     !        !     +-----------------------6  
              !     !        !                             +--Prochlorococcus marinus str. MIT 9301 [cyanobacterie]   
              !     !        !  
              +-----2        !                             +--Porphyra purpurea [red algae]    
                    !        +-----------------------------3  
                    !                                      +--Gracilaria tenuistipitata var. liui [red algae]     
                    !  
                    !                                      +--ORF_QG2389
                    !                                   +--5  
                    +-----------------------------------1  +--Ostreococcus tauri [green algae]    
                                                        !  
                                                        +-----Physcomitrella patens subsp. patens [mosses]    

  



  +-----------------------------------------------------------Mycobacterium leprae TN [actinobacteria]   
  !  
  !                                                        +--Tretragenococcus halophilus [firmicutes]    
  !                                                     +-20  
  !                                               +----19  +--Magnetospirullum gryphiswaldense MSR-1 [alpha proteobacterie]   
  !                                               !     !  
  !  +-------------------------------------------18     +-----Chlamydomonas reinhardtii [green algae]   
  !  !                                            !  
  !  !                                            !        +--Leptospira interrogans serovar [spirochetes]     
 15  !                                            +-------17  
  !  !                                                     +--Bacteroides vulgatus ATCC 8482 [CFB]   
  !  !  
  !  !                                   +--------------------Thermosynechococcus elongatus BP-1 [cyanobacterie]    
  !  !                                   !  
  !  !                             +----14  +-----------------Acaryochoris marina MBIC11017 [cyanobacterie]    
  !  !                             !     !  !  
  !  !                             !     !  !        +--------Gloeobacter violaceus PCC 7421 [cyanobacterie]     
  !  !                             !     +-13  +----12  
  !  !                             !        !  !     !  +-----Microcystis aeruginosa NIES-843 [cyanobacterie]     
  +-16                             !        !  !     +-11  
     !                             !        !  !        !  +--Cyanothece sp. CCY 0110 [cyanobacterie]    
     !                       +-----7        +--9        +-10  
     !                       !     !           !           +--Crocosphaera watsonii WH8501 [cyanobacterie]    
     !                       !     !           !  
     !                       !     !           !           +--Nostoc sp. PCC 7120  [cyanobacterie]    
     !                       !     !           +-----------8  
     !                       !     !                       +--Anabaena variabilis ATCC 29413 [cyanobacterie]     
     !              +--------4     !  
     !              !        !     !                       +--Synechococcus sp. WH 5701 [cyanobacterie]   
     !              !        !     +-----------------------6  
     !              !        !                             +--Prochlorococcus marinus str. MIT 9301 [cyanobacterie]   
     !              !        !  
     +--------------2        !                             +--Porphyra purpurea [red algae]    
                    !        +-----------------------------3  
                    !                                      +--Gracilaria tenuistipitata var. liui [red algae]     
                    !  
                    !                                      +--ORF_QG2389
                    !                                   +--5  
                    +-----------------------------------1  +--Ostreococcus tauri [green algae]    
                                                        !  
                                                        +-----Physcomitrella patens subsp. patens [mosses]    



PROTOCOLE:
Arbre obtenu par: PHYLIP/Neighbor-joining à Infobiogen  
Nature des données:Séquences/ Nature des séquences:protéiques/ Traitement: Neighbor/
Option sur la construction de l'arbre: Randomization de l'ordre des séquences/
Nature de l'arbre à construire: avec racine/Numéro groupe extérieur:16

Groupe d'étude: 10 cyanobactéries + 5 eucaryotes photosynthétiques
Groupe extérieur : 5 Autres bactéries






                        +-----------------------------------Chlamydomonas reinhardtii [green algae]    
                      +-1 
       +--------------2 +----------------------------Magnetospirullum gryphiswaldense MSR-1 [alpha proteobacterie]   
       !              ! 
  +----4              +-------------------------------------Tretragenococcus halophilus [firmicutes]   
  !    ! 
  !    ! +---------------------------------------------Bacteroides vulgatus ATCC 8482 [CFB]   
  !    +-3 
  !      +-----------------------------------------Leptospira interrogans serovar [spirochetes]     
  ! 
  !                       +----Porphyra purpurea [red algae]    
  !               +-------7 
  !               !       +---Gracilaria tenuistipitata var. liui [red algae]     
  !               !  
  !               !        +----Acaryochoris marina MBIC11017 [cyanobacterie]    
  !               !     +-16  
  !               !     !  +---Thermosynechococcus elongatus BP-1 [cyanobacterie]    
  !               !     !  
  !            +-13     !           +Nostoc sp. PCC 7120  [cyanobacterie]   
  !            !  !  +-17     +-----9 
  !            !  !  !  !     !     +Anabaena variabilis ATCC 29413 [cyanobacterie]
  !            !  !  !  !  +-18  
  !            !  !  !  !  !  !      +Cyanothece sp. CCY 0110 [cyanobacterie]    
  !            !  !  !  !  !  !  +--10  
  !            !  !  !  +-19  +-14   +Crocosphaera watsonii WH8501 [cyanobacterie]   
  !            !  !  !     !     !  
  !            !  +-15     !     +---Microcystis aeruginosa NIES-843 [cyanobacterie]
  5-----------11     !     !  
  !            !     !     +----------Gloeobacter violaceus PCC 7421 [cyanobacterie]
  !            !     !  
  !            !     !              +Prochlorococcus marinus str. MIT 9301 [cyanobacterie]   
  !            !     !   +----------6 
  !            !     +--12          +--ORF_QG2389
  !            !         !  
  !            !         +-----Synechococcus sp. WH 5701 [cyanobacterie]
  !            !  
  !            !   +----------------Ostreococcus tauri [green algae]
  !            +---8 
  !                +--------Physcomitrella patens subsp. patens [mosses]   
  ! 
  +---------------------------------Mycobacterium leprae TN [actinobacteria]    

Annotator commentaries

L'objectif de ce TP est d'annoter une séquence provenant de la mer des Caraïbes. Pour atteindre cet objectif, nous avons dû nous poser deux questions: -Est-ce que le fragment d'ADN génomique contient des ORFs qui sont susceptibles de coder pour une ou des protéines? Si oui, quelles sont leurs fonctions? -Est-il possible de faire une prédiction sur le groupe taxonomique de l'organisme d'où provient la séquence?

I- Première étape: Recherche d'ORFs

La première opération sera d'identifier d'éventuels cadres ouverts de lecture (ORF). Les ORF qui correspondent vraissemblablement à des gènes codants seront repérables essentiellement à leurs tailles (au delà de 100 à 150 acides aminés) et aux similitudes de séquences avec d'autres gènes déjà connus et présents dans les banques annotées.

L' ORF à retenir pour l'analyse ultérieure vérifiera donc toutes les conditions suivantes: -ne contient pas de codons STOP -contient au moins 60 codons -peut être sur le brin direct ou indirect -peut être dans le cadre 1, 2 ou 3 -peut être complet ou non en 5' comme en 3'

Pour dresser la liste d'ORFs susceptibles d'exister dans notre ADN génomique, nous avons utilisé le logiciel SMS ORF Finder. Nous avons choisi le code génétique bactérien car, d'après les informations fournies, CRAIG VENTER utilisait pour récolter les échantillons, un filtre ne laissant probablement passer que des petits organismes, typiques des procaryotes.

Nous avons effectué les recherches d'ORFs avec "any codon" comme codon d'initiation, dans les 3 phases de lecture, avec au minimum 60 codons, dans le sens direct, puis indirect. Nous avons obtenu: -Sens direct/1 potentiel ORF/ Cadre 3 de lecture/ de la base 285 à 668 -Sens indirect/1 potentiel ORF/ Cadre 2 de lecture/ de la base 2 à 811


Le plus long ORF susceptible d'exister, s'étant de la 2 à 811 ième base, dans le sens indirect. Nous avons donc choisi d'étudier ce potentiel ORF pour la suite du TP. Position du premier nucléotide du codon d'initiation: 2 Position du dernier nucléotide: 811 L'apparent ORF est incomplet en 5', le premier codon ne correspond pas à une méthionine. Grâce à l'alignement multiple que nous décrirons ci-dessous, nous avons pu déterminer approximativement le nombre d'acides aminés manquant à notre ORF. Si on compare la longueur de notre ORF à la séquence de Prochlorococcus marinus str. MIT 9301 [cyanobacterie], on s'aperçoit que notre ORF est incomplet du côté 5' d'environ 572 acides aminés. Nous n'avons donc pas calculé de masse moléculaire.

Le potentiel ORF contient 269 acides aminés, nous pouvons émettre l'hypothèse qu'il correspond à un gène codant. Nous allons le vérifier en effectuant un BLASTP.


II- Deuxième étape: Recherche d'homologues par BLAST.

BLAST nous permet de rechercher s'il existe d'éventuels homologues de notre ORF dans les banques de séquences. Nous avons effectué un BLASTP (séquence protéique contre banque protéique) via NCBI. Nous avons choisi la banque protéique "NR" car c'est la banque la plus exhaustive disponible. (Autres paramètres:Expect threshold:10/worlds size:3/Matrix:Blosum62/Gaps coast: existance:11 extension 1) Pour déterminer le score seuil, nous avons d'abord blasté avec un nombre de séquences cibles _

100, puis 500, puis 1000, puis 5000, puis 10000. Avec le BLAST à 10000 séquences cibles, nous ne sommes pas arrivées à définir un score seuil, les derniers alignements deux à deux semblent être homologues. Pour définir le groupe d'étude et le groupe extérieur, nous nous sommes référés au Taxonomy Report. Nous n'avons pas pu déterminer un groupe d'étude et un groupe extérieur. Des séquences bactériennes avec un haut score apparaissent (exemples: 541, 285), mais également des séquences provenant d'eucaryotes (exemples: 434, 253) et aussi d'archaes (exemple : 264). Nous avons donc choisi des séquences dans tout le règne du vivant pour construire un arbre sans racine.

10 bactéries: Prochlorococcus marinus str. MIT 9301 [cyanobacterie] Thermoanaerobacter pseudethanolicus [firmicutes] Thermoga petrophila RKU-1 [thermogales] Frankia alni ACN14a [high GC Gram+] Roseiflexus sp. RS-1 [GNS bacteria] Oceanobacter sp. RED65 [g proteobacterie] Gemmata obscuriglobus UQM 2246 [Planctomycetes] Chlorobium phaeobacteroïdes BS1 [green sulfur bacteria] Treponema pallidum [spirochetes] Gramella forsetii KT0803 [CFB group bacteria]

8 eucaryotes: Gracilaria tenuistipitata var. liui [red algae] Guillardia theta [cryptomonads] Ostreococcus tauri [green algae] Phaeodactyllum tricornitum [stramenopiles] Theileria annulata strainankara [alveolata] Leishmania donovani [euglenosa] Dictyostelium discoïdum [Conosa] Phycomyces blakesleianus [fungi]

4 archaes Methanohalophilus portucalencis [euryarchaeotes] Methanococcoïdes burtonii DSM 6242 [euryarchaeotes] Methanospirillum hungatei FG-1 [euryarchaeotes] Candidatus methanoregula boonei 6M8 [euryarchaeotes]

Nous pouvons observer sur les arbres phylogénétiques que notre séquence sort avec une Cyanobactérie et des eucaryotes photosynthétiques. Le chloroplaste est un organite originaire des Cyanobactéries. Les résultats nous laissent donc penser que notre séquence provient peut être d'une Cyanobactérie.

Mais, pour vérifier notre hypothèse, nous avons sélectionné un nouveau groupe d'étude: cyanobactéries + eucaryotes photosynthétiques et comme groupe extérieur : les autres bactéries.

10 cyanobactéries Acaryochoris marina MBIC11017 [cyanobacterie] Thermosynechococcus elongatus BP-1 [cyanobacterie] Nostoc sp. PCC 7120 [cyanobacterie] Anabaena variabilis ATCC 29413 [cyanobacterie] Cyanothece sp. CCY 0110 [cyanobacterie] Crocosphaera watsonii WH8501 [cyanobacterie] Microcystis aeruginosa NIES-843 [cyanobacterie] Gloeobacter violaceus PCC 7421 [cyanobacterie] Prochlorococcus marinus str. MIT 9301 [cyanobacterie] Synechococcus sp. WH 5701 [cyanobacterie]

5 eucaryotes photosynthétiques Chlamydomonas reinhardtii [green algae] Ostreococcus tauri [green algae] Porphyra purpurea [red algae] Gracilaria tenuistipitata var. liui [red algae] Physcomitrella patens subsp. patens [mosses]


5 Autres bactéries Magnetospirullum gryphiswaldense MSR-1 [alpha proteobacterie] Tretragenococcus halophilus [firmicutes] Bacteroides vulgatus ATCC 8482 [CFB] Leptospira interrogans serovar [spirochetes] Mycobacterium leprae TN [actinobacteria]


Nous avons également effectué un BLASTP contre SWISSPROT. SWISSPROT est une petite banque de protéine où les fiches d'annotation sont très complètes. Elle est donc très utile pour l'analyse fonctionnelle. (PROTOCOLE Outil: BlastP/Database:Swissprot/Max target sequences:5000/Expect threshold:10/worlds size:3/Matrix:Blosum62/Gaps coast: existance:11 extension 1). Dans les fiches d'annotations disponibles à partir de ce BLAST, 2 fonctions principales sont ressorties: -ATP-dependent Clp protease ATP-binding subunit clpA homolog -Chaperone protein clpB (interprétation de ces résultats dans la partie: V- Fonction biologique et moléculaire)


III- Troisième étape: Alignement multiple de séquences protéiques/ Arbre phylogénétique

ALIGNEMENT MULTIPLE avec CLUSTAL W par INFOBIOGEN L'objectif de cet alignement multiple est de vérifier que notre ORF s'intègre correctement dans la famille de ses orthologues présumés: l'alignement multiple doit donc présenter des régions conservées convaincantes. Ceci est visible dans nos 2 alignements multiples, le premier nous a permis d'inférer des arbres sans racine, et l'autre, des arbres avec racine. Dans les 2 cas, on observe beaucoup d'"*"(mêmes résidus), de ":" (résidus différents mais similaires), de "." (résidus différents et un peu moins similaires). L'alignement multiple sert donc à inférer un arbre phylogénétique: l'alignement doit donc suggérer suffisamment de mutations pour pouvoir reconstruire l'histoire évolutive qui a séparé ces protéines. Nos alignements multiples comprennent des blancs, ce qui indique que les résidus sont différents et très différents, ce qui laisse sous entendre des mutations. Le groupe externe permet d'enraciner le futur arbre phylogénétique.


Nous pouvons constater que notre ORF est beaucoup plus court que les autres séquences dans la description de l'alignement multiple. Nous pouvons ainsi déterminer approximativement le nombre d'acides aminés manquant à notre ORF. La séquence ayant le plus haut score (541) et appartenant à Prochlorococcus marinus str. MIT 9301 [cyanobacterie], contient 841 acides aminés. Notre ORF en contient 269 (841 - 269 _

572), notre ORF est donc incomplet d'environ 572 acides aminés. 



ARBRE PHYLOGENETIQUE Nous avons utilisé l'alignement multiple pour inférer un arbre phylogénétique selon deux méthodes: -Parcimonie (basée sur l'étude des états de caractère) -Neighbor-Joining (NJ) (méthode dite "de distance")

1°) Premier cas : sans racine Par la méthode de parcimonie nous avons obtenu 1 arbre qui diffère de l'arbre obtenu par la méthode NJ. Le nombre de pas inférés est très dépendant des caractères choisis (pour méthode parcimonie). Or, la séquence d'ADN génomique qui nous a été fournie était incomplète, peut-être que si nous avions eu la totalité du gène codant pour la protéine, l'arbre inféré par la méthode de parcimonie ressemblerait plus à celui du Neighbor-Joining.

Description de l'arbre NJ (plus pertinent au niveau taxonomique); la longueur des branches est proportionnelle à la distance évolutive.

Nous pouvons observer sur l'arbre phylogénétique que notre séquence sort avec une cyanobactérie et des eucaryotes photosynthétiques. Le chloroplaste est un organite originaire des cyanobactéries. Il se pourrait donc que notre séquence provienne d'une cyanobactérie. Mais, pour vérifier notre hypothèse, nous avons sélectionné un nouveau groupe d'étude: cyanobactéries + eucaryotes photosynthétiques et comme groupe extérieur : les autres bactéries.


2°) Deuxième cas : avec racine Par la méthode de parcimonie nous avons obtenu trois arbres différents, qui diffèrent eux-mêmes de l'arbre obtenu par la méthode NJ.(voir paragraphe ci-dessus III- 1° "Premier cas: sans racine", pour comprendre les différences entre les arbres obtenus avec la méthode de Parcimonie et celle du NJ).

Description de l'arbre NJ: Avec l'arbre obtenu par la méthode NJ on observe que l'ORF étudié sort dans le groupe d'étude: cyanobactéries + eucaryotes photosynthétiques, mais, l'ancêtre commun le plus proche de notre ORF est celui des cyanobactéries. Nous pouvons donc supposer que notre séquence appartient à une cyanobactérie. La seule séquence appartenant au groupe d'étude qui sort dans le groupe extérieur est Chlamydomonas reinhardtii [green algae]. La phylogénie inférée montre donc des mélanges entre les groupes étudiés. Ceci peut indiquer l'existence de transferts horizontaux de gènes et/ou de duplications de gènes suivies de pertes de gènes.



IV- Recherche de domaines

Nous avons recherché si la traduction de notre ORF présente des domaines protéiques conservés en utilisant INTERPRO / INTERPRO SCAN

Nous avons obtenu 2 domaines: Chaperonin clpA/B et ATPase AAA-2. Cependant, en lisant le "table view", nous pouvons constater que le domaine Chaperonin clpA/B contient ATPase AAA-2. Nous avons donc retenu comme domaine fonctionnel : ATPase AAA-2 (e value : 2.3e-89, qui s'étend du 1er au 157ième acide aminé).

De plus, dans le taxonomy report, nous pouvons observer que les séquences homologues à notre query appartenant au groupe des cyanobactéries ont une fonction Clp ou ATPase. (interprétations dans la partie : V- Fonction biologique et moléculaire )

Dans la fiche descriptive du domaine ATPase AAA-2 obtenu avec Interpro, nous avons accès à des informations taxonomiques. Nous pouvons voir que ce domaine est présent dans tous les règnes du vivant, mais il est particulièrement présent chez les bactéries (3742 bactéries) avec 171 Cyanobactéries. De plus ce domaine est aussi beaucoup représenté chez les Viridiplantaes (156) Ceci est confirmé par les résultats du taxonomy report.

Notre ORF étant incomplet, nous avons pris la séquence complète la plus proche de la notre (Prochlorococcus marinus str. MIT 9301 [cyanobacterie]) et nous avons fait une recherche de domaines par Interpro. Nous nous sommes aperçu que cet homologue possédait plusieurs domaines et notamment des domaines Chaperonin clpA/B et ATPase AAA-2. Le domaine ATPase AAA-2 s'étend du 553ième au 729ième acide aminé, il contient donc 176 acides aminés. Il manque donc au domaine présent sur notre ORF 20 acides aminés


V- Fonction biologique et moléculaire

Nous avons utilisé pour les prédictions de fonctions les annotations disponibles pour les orthologues de notre ORF dont la fonction est connue dans les fiches SWISSPROT. Deux fonctions majeures ressortent : -ATP-dependent Clp protease ATP-binding subunit clpA homolog -Chaperone protein clpB

Dans le taxonomy report, nous avons aussi observé que les subjects avaient une fonction Clp, ce qui confirme les résultats trouvés dans la recherche de domaines.

La protéolyse est un élément essentiel du métabolisme cellulaire et de la réponse aux stimuli environnementaux. Elle module l‘activité de nombreux peptides régulateurs et assure l‘élimination des protéines anormales ou endommagées Chez les bactéries, il existe différents systèmes d‘adressage des substrats et plusieurs protéases ATP‐dépendantes. Chacune associe une activité ATPase « chaperonne » et une activité peptidase distinctes, et bien qu‘elles ne soient pas apparentées, ces protéases partagent un mode de fonctionnement séquentiel commun qui va de la reconnaissance des substrats par la partie ATPase jusqu‘à leur protéolyse.

Les principales protéases ATP‐dépendante bactériennes sont FtsH, Lon, HslUV et les Clp‐protéases. Ces dernières sont des complexes multimériques assemblés autour de la protéase ClpP et sont essentielles à la virulence de nombreuses bactéries et à l‘adaptation rapide aux conditions de stress, en assurant le fonctionnement d‘importantes voies métaboliques.

La fonction putative de notre protéine semble être une protéase ATP-dépendante qui intervient en réponse au stress cellulaire et impliquée dans la virulence bactérienne.

CONCLUSION Le fragment d'ADN génomique mis à notre disposition semble contenir un ORF de 269 acides aminés. Ce potentiel ORF semble coder pour une putative protéase ATP-dépendante. Cette protéine est impliquée dans la virulence de nombreuses bactéries et dans la réponse au stress. Cet ADN pourrait provenir d'une Cyanobactérie dont la protéine résultante serait très connue.




Multiple Alignement

PROTOCOLE:
Outils: Infobiogen/ClustalW/Premier jeu de données: Séquences au format FASTA/Séquences: Protéiques
Sortie alignements: Clustal
Séquences de 10 bactéries, 8 eucaryotes, 4 archaes



CLUSTAL W (1.82) multiple sequence alignment


Sulfur           ------------------------------------------------------------
Cfb              ------------------------------------------------------------
Cyano            ------------------------------------------------------------
ORF_QG23890      ------------------------------------------------------------
Red              ------------------------------------------------------------
Crypto           ------------------------------------------------------------
Green            ------------------------------------------------------------
Trameno          ------------------------------------------------------------
Firmicu          ------------------------------------------------------------
High             ------------------------------------------------------------
Thermoga         ------------------------------------------------------------
Mhunga           ------------------------------------------------------------
Mboonei          ------------------------------------------------------------
Gproteo          ------------------------------------------------------------
Mportu           ------------------------------------------------------------
Mburto           ------------------------------------------------------------
Plancto          ------------------------------------------------------------
Spiro            ------------------------------------------------------------
Conosa           ------------------------------------------------------------
Eugleno          ------------------------------------------------------------
Fungi            ------------------------------------------------------------
GNS              ------------------------------------------------------------
Alveolata        MNIRRIHIYLFVILQAYNSLIFKHFNCFKYEKIRNTFVINNFTSNKLISQIANVESLLPT
                                                                             

Sulfur           ---------MDGNFSNRVQDVIRHSREEALRLGHDYIGTEHLLLGLIKEGE--GIAARIL
Cfb              ---------MDDNFSPRVKDVIAYSKEEALRLGHDFIGTEHLMLGLLRDGD--GKAIEIL
Cyano            ---------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGT-------GV
ORF_QG23890      ------------------------------------------------------------
Red              ---------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGT-------GI
Crypto           ---------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGT-------GI
Green            ------------------------------------------------------------
Trameno          ---------MFEKFTEGAIKVIMLSQEEARRMGHNFVGTEQLLLGVIGQRH-------GI
Firmicu          -------MAMFGRFTERAQKALYLAQEEARSFYHNYVGTEHILLGLLKEDE-------GI
High             ---------MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGE-------GV
Thermoga         ---------MFDKFSEKTAQIFVTAQEEAKELGHSYVGTEHLLLAILKVDR-------SP
Mhunga           ------MIMNFNNFTLKSQEAIQKAMDIAAGKQNQAIEPAHILKGMLIVDE--NVIPYLL
Mboonei          --------MNFNNFTIKSQEAVSKAIELATAKKNPSVETSHLLKGMLLVDE--NVIPYLL
Gproteo          ----------MEKFTSSLQQALSDAQSLALGKDHNQIETAHLLLALLEQAP--GGIRPLL
Mportu           --------MDLNNFTQKAQEAIQNSRTIAARYYHQQIDSEHLFLSLLEQRE--GLVPSLL
Mburto           --------MDLNRFTQKAQEAIQKSFSIAARYYNQQTECEHLLLALVEQTG--GLVPTIL
Plancto          --------MDLNQFTEKAQQALAGAQKLAARLNHQQIDTEHALLSLLDQEK--GLAPAIL
Spiro            --------MNTDRYTVKASEALNDAISLAEAENHGQVEEEHLLHALLSQKD--GIISPLI
Conosa           ------MSFNPEEFTDKTNTILLRTQELAREKSNVQLAPIHLAVTLLNDED--NLAKSIF
Eugleno          ------MTTQQPEWTQAASDLMARTAALARKKANGYLDPVHLAYVMFEDEN--SLASRVV
Fungi            --------MSGMNFTEKVEKTLATAQAQAREFSHTLLHPAHIACAMFDDVDGQSLFKSIL
GNS              --------MRLERFTEKAQEAFQDAQEIMHDQHHTQLDVEHIFLAMLRQRD--GLTARAI
Alveolata        SHNIAPLYLNFDNFSDNAIKVLMLSLEEAKLSNQPSVESAHIFQGLVCLNQG------LA
                                                                             

Sulfur           KNLHIDLFKLKQKIEESTTQKVAASQMG----NVPLTKQAEKVLKITYLEAKICKSNIIG
Cfb              SALDIDLSHLRRKVEILSPANPNTVTINNEKKNLHLTRQAERALKTTFLEAKLFQSSSIN
Cyano            AAKVLKSLGVNLKDSRIEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG
ORF_QG23890      ------------------------------------------------------------
Red              AAQVLKSMNVNLKDARIEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG
Crypto           AAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG
Green            ---------------XXEVEKIIGRGSGFVAVEIPFTPRAKRVLELALEEARQLGHNYIG
Trameno          GAKALKKLKVTLKKARKEIELYIGRGTGFVASEIPFTPRAKRVLEMAVHEGKDLGQNFVG
Firmicu          AARVLKKLGVTYETTREKVLSLIGMG-NIPGDVVGYTPRAKRVLELSLSEARRFNTSYVG
High             AAKALESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
Thermoga         AVELLEEMGASYSKVRSEIISMVGMGMRGFVPSPQMTPRAKRVTELAYEEAKILGSDKIN
Mhunga           KKLNVNLDRLNQVLDRNIEALPKITG-----GEQYLSHDSSKALQKASGYAQELKDDFVS
Mboonei          KKLNVDLNGFTPALDRIIDAYPEVTG-----GDQHLSSDATKALQKATALSQESGDEFVS
Gproteo          QGLGVQAGSLRQKLEGVLGNLPVVSSPD---GNLSVSSELGRVLNLTDRLAQKRGDQYIS
Mportu           DKMNISSAMVKEQLEKHMSGLGQVSGPGS--ENVYFTQKAIRVLDNAASLASKMNDEYTS
Mburto           DRIGAENQSIIKELEDHLSELPQVSGSGS--GQTYVSQAYSRVLDTAENEASSMNDEYIS
Plancto          TKAGVSVDAVTVKLQRELDRLPKVTGTN---AEPRLTQRLVKLIDAAEAEAKKLKDEYVS
Spiro            EKIGAKPDFLYDELLQCLRRKPRVTGPA---AQTRCAPTLSKACARAERLALKNQDEYVS
Conosa           EKAGGDVPKIDAGFKRLLAKQPVQNPVP---PEISPNSLFLQVLRSAARHQKNNGDSHLA
Eugleno          RKLG--AASVKDGLEARVDAIPTQMPAP---TQPRPNSDMMRVMNTAEQERVALGDTLMA
Fungi            EKAGADPSLVERGYKKQMVHLPAQDPPP---PEISISPQTAKLLRNAEKHMKDQKDSYIS
GNS              ARLGVDADMVARRVEHELEKSPKVYGQYGYGNQVYITPRTQRLVKRAEEEANRLNDQYVG
Alveolata        FKILKEFGVTVNSARNAAKSSYPVDESKKVKNLPTFSNSAKNALDYSSTEAERLGNSTIE
                                                                             

Sulfur           TEHLLLSILKGEDNVAAQILEQFGITYDAVRDELMTISSG-KGDSGEPPIEGSFSSGPEK
Cfb              TAHLLLCILRNENDPTTKLLNKLKIDYDGVKDQFKYMIASDEGDFTDSPSAESFSDDDGD
Cyano            TEHLLLGLIREGEGVAARVLENLNIDLTKVRTQVIRMLGETAEVGTGGSSN---------
ORF_QG23890      ------------------------------------------------------------
Red              TEHLLMGLVREGEGVAARVLENLAVNVASIRTEVIQMLGDTTEANTNGNNN---------
Crypto           TEHLLLGLIREGEGVAARVLENLALDLTKVRTQVIRLLGDTAEVSATNG-----------
Green            TEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVGETQEAVGAGAGCGQ-------
Trameno          TEHILLALIAESDGVAMRTLDKLNVDIHKLRNLILTYIEETQEEILRPLTQAEKFL----
Firmicu          TEHILLGLLREGEGVAVRILMEQGIDFNRVREEIVKMLNEEPAGGPAKAAK---------
High             TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKGETATSG---------
Thermoga         PEHLLLGILREGEGIAIHILRKLGVDIATLRREIIDIYSYSSNKSLEYEEE---------
Mhunga           IEHLLLGILSVNE-PTSRLLKEFGVTEKDLKEAIRILRKGSTVSSQTAEETYN-------
Mboonei          LEQILLGILSVDN-STSRLLKENGVKEKDLKTAIGQLRKGETVNNQNAEETYN-------
Gproteo          SDLVLLAALEEKG-DTGKALNDLGLNKEKVERAIDTVRQGESVDDPNAEDNRQ-------
Mportu           VEHILVALAREKGSYSKELLEEFGADEERLNQAIKEIRGNRRVTSENPEDTYE-------
Mburto           VEHVLIALLKEKESTSYRILEEAGITIDATLEAIKKLRGNRRITSENPEDTME-------
Plancto          VEHLLLAATDDTG-TAGKTLREFGLTRDRLLSALKEVRGSQRVTSQNPEETYQ-------
Spiro            CEHLLLAISETDS-NTARLLHSQGITSKTISAALKDIRGSKRVTSQDPESTFQ-------
Conosa           VDHLILGLLDDRD--ILSVLGDAGATKEQVIQAVKEIRGNKKITSKTAESTYE-------
Eugleno          ADHFLLALHESKE--VGRILDAAGAGKKAIRATLLEMRKGKKINSDFQDDNYE-------
Fungi            IDHLILALADETT--TFQPMKDAGVTKKALESAVQQVRGNKRVDSKNAEEVYE-------
GNS              IEHLLIAISGEREGASSRILNSFGIDQERIYQALMDIRGHQRADNPSAEARYE-------
Alveolata        TEHLLLGVLNDTTKEMSTFYKNLDLDVTLAIDTTVRTIEKIKEIKESNSLSEN-------
                                                                             

Sulfur           FSKKAEQKKG--------ERTKTPVLDNFGRDITRLAMDDKLDPIIGREKEIERVAQVLS
Cfb              ETTRENPFSGGGTTGKPSKKSKTPVLDNFGRDLTALAEADKLDPVVGREKEIERVSQILS
Cyano            -----------------KGNLKTATLDEFGTNLTKLASESKLDPVVGRHSEIDRVVQILG
ORF_QG23890      ------------------------------------------------------------
Red              ----------------TQTRSKTPTLEEFGSNLTELAIEGILDPVVGRQKEIERVIQILG
Crypto           -----------------QTKGKTPTLEEFGSNLTQKAAEGKLDPVIGRQKEIERVIQILG
Green            ---------------GAQAGSKTPTLEEFGSDLTKKAEEGKLDPCIGRVNEIIRVTQILG
Trameno          -------------LEREKKGSPTPTLDEYAENITKEAIDGNLDPVIGREKEIDDVIAVLA
Firmicu          -------------VKNTNTP----TLNQFGRDLTELARDGKLDPVIGREKEIERVIQILS
High             -------------APAEGTPSTSLVLDQFGRNLTAAARESKLDPVIGREKEIERVMQVLS
Thermoga         ---------------EDYTYRSVKQLEGFGVNLTELAAKKELDPVIGREEEIERVMQVLV
Mhunga           ------------------------ALNQFARNLNELAFSGKLDPVIGRDDEIRRVLQILS
Mboonei          ------------------------ALEKYARNLNDLARKGKLDPVIGRDEEIRRVLQILS
Gproteo          ------------------------ALDKFTVDLTARAEEGKLDPVIGRDDEIRRTIQVLQ
Mportu           ------------------------PLEKYGIDFTELANQGKLDPVIGRDHEIRHTIEILS
Mburto           ------------------------PLKKYGIDFTELAAQGKLDPVIGRDQEIRHTIEILS
Plancto          ------------------------SLEKYGRDLTQYARNGKLDPVIGRDEEIRRVMQVLS
Spiro            ------------------------CLEKYCRDLTTLAREEKIDPVIGRDEEIRRVMQVLS
Conosa           ------------------------ALSKYGYDLVSQAQEGKLDPVIGRDEEIRRVIRVLS
Eugleno          ------------------------SLNKYAVDLCKQAEDGKLDPVIGRADEILRTIRVLS
Fungi            ------------------------SLSKYAIDLTEMAQTGKLDPVIGRDDEIRRVIRVLC
GNS              ------------------------ALSKYSIDLTDLAAQGKLDPVIGRDAEITRVIRILC
Alveolata        -IQESSPNFVYLSPTMNRDELAQSCISLFTVDLTEKARNGQLPKVIHRDNEIERAIITLS
                                                                             

Sulfur           RRKKNNPVLIGEPGVGKTAIAEGLALKIVQRKVSRILYDKKVVALDLAALVAGTKYRGQF
Cfb              RRKKNNPLLIGEPGVGKSAIAEGLALRIVKRKVSRILFDKRVVTLDLASLVAGTKYRGQF
Cyano            RRTKNNPVLIGEPGVGKTAIAEGLAQRIQTGDIPDILEDKRVLTLDIGLLVAGTKYRGEF
ORF_QG23890      ------------------------------------------------------------
Red              RRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPSILEDKLVVTLDVGLLVAGTKYRGEF
Crypto           RRTKNNPILIGEPGVGKTAIAEGLAQRINNRDVPDILEDKRVVTLDIGLLVAGTKYRGEF
Green            RRTKNNPCLIGEPGVGKSAIAEGLAQKIATNDVPDTLDSKRMMTLDMGLLVAGTKYRGEF
Trameno          RRTKNNPVLIGEPGVGKTAVAEGLAQLILTEKVPDFLDGSLIMALDLGSILAGTKYRGEF
Firmicu          RRTKNNPVLIGEPGVGKTAIVEGLAQKIVEGEIPEILKDKRVVTLDMASMVAGTKYRGEF
High             RRTKNNPVLIGEPGVGKTAVVEGLAQAIVKGEVPETLKDKQLYTLDLGALVAGSRYRGDF
Thermoga         RRKKNNPVLIGDPGVGKTAIVEGLAQRIVAGDVPEILKNKVIFSLDVAALVAGTKYRGEF
Mhunga           RRTKNNPILIGEPGVGKTAIAEGLAHRIIDGDVPDNLKTKQIFSLDMGALIAGAKYKGEF
Mboonei          RRTKNNPILIGEPGVGKTAIAEGIAHRIIDEDVPDNLKTKQIFSLDMGALIAGAKFKGEF
Gproteo          RRTKNNPVLIGAPGVGKTAIIEGLAQRIVDGEVPEGLRNKRILSLDMGSLLAGAKFRGDF
Mportu           RRRKNNPVLIGEAGVGKTAIVEGLAQRIAKKDVPDAMKNKRIVALDMGSLVAGAKFRGEF
Mburto           RRRKNNPVLIGEAGVGKTAIVEGLALRIAKHDIPEDMKNKKIIALDMGALIAGAKFRGEF
Plancto          RRTKNNPVLIGEPGVGKTAVVEGLAQRIVRGDVPEGLKDKLIVALDMGALIAGAKYRGEF
Spiro            RRTKNNPVLIGEPGVGKTAIVEGLARRIVSGDVPESLKGKRLLSLDLGALVAGAKFRGEF
Conosa           RRTKNNPVLIGEPGVGKTAVVEGLAQRIVRGDIPDNLN-ARVIALDMGALIAGAKYRGDF
Eugleno          RRTKNNPVLIGEPGVGKTAIVEGIAQQVVRGDVPDTLSGIRIFSLDMGALIAGAKYRGEF
Fungi            RRTKNNPVLIGEPGVGKTAIAEGLARRIVERDVPESLQ-CKLFSLDMGALIAGAKYRGEF
GNS              RRTKNNPVLVGETGVGKTAIAEGLAQRIASGDVPLPLKNRRLLALDLAGMVAGSKFRGEF
Alveolata        RMTKSNPLLVGEPGVGKTAIVEGIANKISQGISQPQISKKRILQLQFGLLIAGTKFRGQF
                                                                             

Sulfur           EERMKALMNELE-RSRDVILFIDELHTIV-----------GAGGASGSLDASNIFKPALA
Cfb              EERIKAVMNELE-KNDDIILFIDEIHTIV-----------GAGGATGSLDASNMFKPALA
Cyano            EERLKKIMEEIK-SAGNVILVIDEVHTLI-----------GAGAAEGAIDAANILKPALA
ORF_QG23890      ------------------------------------------------------------
Red              EERLKRIMDEIK-SANNIVLVIDEVHTLI-----------GAGAAEGAIDAANLLKPALA
Crypto           EERLKKIIDEIR-VANNVILVIDEVHTLI-----------GAGAAEGAIDAANILKPALA
Green            EERLKKLMDEVK-NDENIILFIDEVHTLI-----------GAGAAEGAIDAANILKPALA
Trameno          EERLKRIVEEAQ-NDSAVIIVIDEIHTLV-----------GAGAAEGAVDAANILKPALA
Firmicu          EDRLKTVLNEVI-KAGNVILFIDEMHTLI-----------GAGAAEGAIDASNILKPALA
High             EERLKKVLKEIR-TRGDIILFIDELHTLV-----------GAGAAEGAIDAASILKPMLA
Thermoga         EKRMKKLLQIVT-KDKNIILFIDEIHTIV-----------GAGSAEGAIDAANILKPALA
Mhunga           EERLKSVVKEVVSSDGEIILFIDEIHTLV-----------GAGAGEGAMDAANILKPALS
Mboonei          EERLKSVVKEVTSSDGEIILFIDEIHTLV-----------GAGGGEGAMDAANILKPALS
Gproteo          EERLKNVLKEVSKQEGNIVLFIDEIHTMV-----------GAGKTDGALDAGNMLKPALS
Mportu           EERLKAVLKEVAESEGQIILFIDELHTIV-----------GAGATEGAMDAGNLLKPMLA
Mburto           EERLKAVLKEVADSEGQIILFIDELHTIV-----------GAGATEGAMDAGNLLKPMLA
Plancto          EERLKAVLKEVTSSDGRIILFIDEMHTIV-----------GAGKAEGAMDAGNLLKPLLA
Spiro            EERLKAVIEAVQKSDGGVILFIDELHTLV-----------GAGASEGSMDASNLLKPALA
Conosa           EERLKAVLKEVKDSNGGIILFIDEIHLVL-----------GAGKTDGAMDAANLLKPMLA
Eugleno          EERLKAVLNEVKESDNKIILFIDEIHLVL-----------GAGKSDGAMDAANLLKPLLA
Fungi            EERLKAVLKEVKESEEGIILFIDEIHTVL-----------GAGKGEGSMDAANLLKPMLA
GNS              EERLKAVMDEVRSSEGQIILFIDELHTVV-----------GAGAAVGSIDASNMLKPALS
Alveolata        EERLTKLIDEIK-SSGDIILVIDEAHMLIGMKFIYNNNKLGAGAGDGSIDAANLLKPPLS
                                                                             

Sulfur           RGELQCIGATTLDEYRQYIEKDGALDRRFQKIMVEPTNVDETIQILNNIKSKYEAHHHVY
Cfb              RGEIQCIGATTLDEYRQYIEKDGALERRFQKVIVEPTTVEETIEILNNIKDKYEEHHNVS
Cyano            RGELQCIGATTLDEYRKHIERDAALERRFQPVMVGEPSIEDTIEILKGLRERYEQHHRLK
ORF_QG23890      ------------------------------------------------------------
Red              RGELQCIGATTLEEYRKHIEKDAALERRFQPVLVGEPSVEETIEILFGLRDRYEKHHQLK
Crypto           RGEMQCIGATTLEEYRKHIEKDSALERRFQPVMVGEPSVEETIEILYGLRDRYEKHHKLV
Green            RGELQCIGATTIDEYRKHIEKDPALERRFQPVQVPEPTVDETIQILRGLRERYELHHKLK
Trameno          RGKFRCIGATTNDEYRKYIERDPALERRFQPVHVEEPSVGTTIEILRGLRSKFEQHHTLS
Firmicu          RGEIQVVGATTLDEYRKYVERDPALERRFQPIIVDEPTVEETIEILKGLRDKYEAHHRVK
High             RGELQTIGATTLDEYRKHLEKDAALERRFQPIQVAEPSVAHTIEILKGLRDRYEAHHRVS
Thermoga         RGEISCIGATTPDEYRKYIEKDAALERRFQKIYVKEPTEEETLEILKGLKRKYESHHKVI
Mhunga           RGELHVIGATTLKEYQKYFEKDKALERRFQPVMVNEPDTLDAISILRGIKEKYETHHHVR
Mboonei          RGELHVIGATTLKEYQKYFEKDKALERRFQPVMVNEPDMQDAISILRGIKEKYETHHHVR
Gproteo          RGELHCVGATTLDEYREYIEKDAALERRFQKVLVDEPSEEDTVAILRGLKERYEVHHGVQ
Mportu           RGELHCLGATTLDEYRKYIEKDAALERRFMPVMVNAPDVENTISILRGLKEKYEVHHGVR
Mburto           RGELHCIGATTLDEYRKYIEKDAALERRFLPVLVDQPDVENTISILRGLKEKYEVHHGVR
Plancto          RGELHCIGATTLDEYRQHVEKDAALERRFQPVQVGEPSVEDTISILRGLKERYEVHHGVR
Spiro            RGELRSIGATTLNEYRKYIEKDAALERRFQQVYCVQPTVEDTIAILRGLQEKYEVHHGVR
Conosa           RGELRCIGATTLDEYRQYVEKDPAFERRFQQVFVNEPTVNDTISILRGLKERYETHHGVR
Eugleno          RGELRTIGATTLEEYRQYVEKDAAFERRFMPVQVNEPSVEECTSILRGLKDRYEQHHGVQ
Fungi            RGELRCIGATTLTEY-KVIEKDPAFERRFQKVDVGEPSVAATISILRGLKERYESYHGVK
GNS              RGEVQVIGATTIDEYRKHVEKDAALERRFSPVFVEEPDVETTVEMLRGLRKRYEEHHQLT
Alveolata        RGEIQCIAITTPKEYKKYFEKDMALSRRFHPIYVDEPSEEDTLKILNGISSSYGEFHGVE
                                                                             

Sulfur           YDSDAIDKAVRLSERYITDRFLPDKAIDVMDEAGARVHLSNIHVPKNILDLEQSVEEIKT
Cfb              YTDEAIQACVKLTNRYMTDRFLPDKAIDALDEAGSRVHIINIDVPKQILELERKLEEVRD
Cyano            ITDDALEAAAHLGDRYISDRFLPDKAIDLIDEAGSRVRLINSKLPPEAKQIDRELRQIQK
ORF_QG23890      ------------------------------------------------------------
Red              MSDEALAAAAKYANQYISDRFLPDKAIDLIDEAGSRVRLLNSQLPPAARELDKELRSVLK
Crypto           ISDEALSAAAKFADQYIADRFLPDKAIDLIDEAGSRVRLMNSQLPPAARELDKELREILK
Green            YSDDALIAAAKFSSQYISDRFLPDKAIDLIDEAGSRVRLANAALPEEAKELDKELKALMK
Trameno          YHDKALEQAAILSDKYVADRYLPDKAIDVLDEAGARVRLENRRLPLGLRSLMHELQETIK
Firmicu          ITDEALEAAARLSHRYIADRFLPDKAIDLIDEAASRVRLKTVTAPPEIKELEDKINDLIK
High             ITDAALVAAASLADRYISDRFLPDKAIDLIDEAGSRMRIRRMTAPPDLREFDERIAGVRR
Thermoga         YTDKALEAAVYLSKRYITDHYLPDKAIDVIDEAGARARLKVFVLPPELKSMKLELERIRS
Mhunga           IKDEAIIAAVELSQRYISDRFLPDKAIDLIDEAASKLRLEINSVPEELEIIERKIRQLEI
Mboonei          IKDEAIIAAVELSQRYISDRFLPDKAIDLIDEAASKLRLEINSKPEELEKIERKIHQLEI
Gproteo          ITDGAIIAAAKLSTRYITDRQLPDKAIDLIDEAASIIRMEIDSKPQEMDRLERRLIQLKI
Mportu           LKDSALVAAAVLSDRYISDRFLPDKAIDLLDEAASKVKTAIDSKPASLDEADRKLMQLEI
Mburto           IKDTALVAAAVLSNRYISDRFLPDKAIDLVDEAAAKVRTAIDSKPSELDEADRKILQLEI
Plancto          IKDGALVSAAVLSSRYIADRFLPDKAIDLVDEAAAKLRTEIDSMPTELDEISRRVMQLEI
Spiro            IKDEALVAATVLSDRYITNRFLPDKAIDLVDEAASRLKMEIESQPVELDQVERKILQLNI
Conosa           ITDNALVVAAQLSHRYITNRFLPDKAIDLVDEACANTRVQLNSQPEAIDNLERRRLQLEV
Eugleno          ITDKAVVVAAQLAGRYITNRFLPDKAIDLIDEACANVRVTLSSRPAEIDALERKKRQLEI
Fungi            ITDSALVVAAQLSDRYITTRFLPDKAIDLIDEAGANTRVQLDSKPEEIDVLERKHFQLEI
GNS              ISDEALQAAARLSSRYITDRFLPDKAIDLIDEASAKLRIDIYSMPKALREQEAELNRLRR
Alveolata        YTQESIKLALKYSKQYINDRFLPDKAIDIMDESGSFAKIQYQNELKREKNELTSATETEG
                                                                             

Sulfur           EKNRVVKMQNF----EEAAMLRDKEKTLLESLEQAKQEWEARAADTVYDVT---------
Cfb              SKNSVVKKQKY----EEAAKLRDDEKNLEKELSIAQEKWEEETKKHKETVS---------
Cyano            QKEESVRDQNF----DQAGQLREKEMELSAKIKEVLDNKKESTAVDQTDPDNS-------
ORF_QG23890      ------------------------------------------------------------
Red              TKDEAIRAQKY----EKAEQYRTREMEIKAQIAAIAQSKKNE------------------
Crypto           QKDEAVRSQDF----ETAGQLRDREMEIKAQIAAIAHSKKGD------------------
Green            EKDNAIRSQDF----EAAGGLRDREVELRAQIKQITERKQEESR----------------
Trameno          DKEDCIKEHDF----EAAKQLLDHEMEVRTHIRIMKQSALTSEARG--------------
Firmicu          EKEEAIRTQEY----EKAAKIRDEEQKLREELEKLKAKWQQNSLSN--------------
High             DKESAIDAQDF----EKAASLRDKEKTLLSEKAKREKEWKAGDMDV--------------
Thermoga         DKELAVLNQDY----EKAAQLKEEEMELEAEYRKRYAEWRRHAETA--------------
Mhunga           EREAIKREKDQ----VKLDALNEEIGNLTEERNRLKAKWQSEKDIVEQIQLLKNQIEDLK
Mboonei          EREAIKREKDQ----QKLKALNEEIGNLTEERNRLNAKWRSEKELVEQIQSRKTEIEDLK
Gproteo          EREALNKESDE-GSKKRLNEINGEINKLGREYVELEDVWKQEKLSLEGSKQAKEALEEAK
Mportu           EKEALKKEKDA-ASKERLQSLEKEISEIRAESDAMRTRWENEKATIAKLNSIKEQIDDTK
Mburto           EREALKKEKDA-VSKERVADLEKELADIRAESDAMRAKWQSEKDTIANLGSLKQQIEDIK
Plancto          EREALKKESDR-ASKDRLEKLEHELGNLKADADALKARWQAEKQAVQQVQAVREQIEQVK
Spiro            EKASLLKESDP-ASKERLEKLEKELAGFLERRAAMQVQWQNEKGRIEESRRYKEELERLR
Conosa           ESAALEKEEDD-ASKQRLKAVQEELNQIKDELQPLEAKYQKERSRVDKIRELRKKLEDIK
Eugleno          EEKALQRDKDA-SAKERLKAVKAEIQKVEEKLGPLLAKYEQERGRIDELQATQAKLDEKK
Fungi            EAMALGKEKNNKDSQERLKVVKEEMAKIQEELKPLKLRYDMDKGRLDEIRDLKQKLDELK
GNS              EEEEAGARREY----ERAAMLRARYLQLETEFEHARSEWLKSSNLDEVVD----------
Alveolata        NGETESNPENE-----VEQVVEKKEQNVLGQVKP--------------------------
                                                                             

Sulfur           ------------------------------------------------------------
Cfb              ------------------------------------------------------------
Cyano            ---------------------------------------------------AKSDSKLLQ
ORF_QG23890      ------------------------------------------------------------
Red              ------------------------------------------------------PNVQIE
Crypto           ------------------------------------------------------EENTKE
Green            ---------------------------------------------------AKSESGDET
Trameno          -------------------------------------------------------FSRRD
Firmicu          ------------------------------------------------------------
High             ------------------------------------------------------------
Thermoga         ------------------------------------------------------------
Mhunga           FEAESANRAGDLGKVAEIRYGRIPEKEKIIEGLKQQLTDLQK-DSAMVNEEVD-------
Mboonei          FEAERAERNGDLGKVAEIRYGRIPDNEKSMVALKEKLTVLQK-DSALVNEEVD-------
Gproteo          VEMEQARRAGDLQRMSELQYGKIPELEKQIEAAEKAEKGSN--EFKLLRNRVT-------
Mportu           TQLELAETEGDFEKASRLKYGTLVPLQHEYEEEENRLKEKQ--TNMLLKEEVD-------
Mburto           IQLELAENSGDFELASKLKYGSLTPLEHQYKEEETKLQEQQ--DDMLLKEEVW-------
Plancto          AEIEKAERAYDLNKAAELKYGKLPALEKQLAAAEAAFARDR--DNKLIKEEVG-------
Spiro            IEETMFSREGDLNKAAELRYGKIPELEKKIMLLTAEVEKKSGLEGQLLREEVC-------
Conosa           VKLSDAERRYDTSAAADYRYFVIPDLEKQIEVCDKERKENKKDAMVSEVV----------
Eugleno          VKLERAERMRDMETAADLKYNVIPILQDRIRSLKEEIEK-QKATMLHGTV----------
Fungi            RKAVEARNRYDLDSAADIEYYAIPDVEQRINALSAEKQRKMAEQMANDTAGQASTTGQLV
GNS              ------------------------------------------------------------
Alveolata        ------------------------------------------------------------
                                                                             

Sulfur           -----EADISSVVAMMTGIPVIKVAQSESKKLLNMSQELKKEVIGQDEAIDKITRAIQRT
Cfb              -----EESVADVVSMMTGIPVNRIAQTESNKLVKLPTKIKGKVIGQDEAVGKVVKAIQRN
Cyano            SPLVSEEDVAHIVASWTGVPVQKLTETESVKLLNMEETLHQRLIGQDEAVKAVSRAIRRA
ORF_QG23890      ------------------------------------------------------------
Red              DPVVTEDDIAEIVAFWTGIPVTKLTKSESEKLMHMEETLHNRIIGQDEAVVAVSRAIRRA
Crypto           VSVVTEEDIAQIVAAWTGIPVNKMTRSESEKLLQMEETLHGRIIGQDEAVVAVSKAIRRA
Green            GPQVVEQDIADVVAAWTGIPVDKVSSDEGTRLMAMEETLHKRLVGQEEAVVACARAIRRA
Trameno          VDMVTETDVSDVVSNWTGIPVTKITGSESARLLKMEDTIHERIIGQKHAVVAVSRAIRRA
Firmicu          EKSVGPEEIAQVVSLWTGIPVKKLAEEESERLLHLEEVLHERVIGQDEAVEAVARAIRRA
High             VAEVGDEEIAEVLAIWTGIPVFKLTEEETARLLRMEDELHKRVIGQQQAIKAVSQAIRRT
Thermoga         VVRVDVDDVAEVVSSWTGVPLKKIEETEVEKLLNLEEALHQRIVAQDEAIKAVARAIRRA
Mhunga           -----AEEIAEVVSRWTGIPVSRMLQSEKQKLLTLEAELHKRVVGQDEAIRAVSDAIRRS
Mboonei          -----AEEIAEVVSRWTGIPVSRMLQSEREKLLSLEAELHKRVVGQDEAIAAVSNAIRRS
Gproteo          -----DEEIAEVVSKWTGVPVAKMLEGEREKLLRMEQELHKHVVGQDDAITAVSNAVRRS
Mportu           -----EEDIAHVVSEWTRIPVTKLMEGERGKLVHLEDRLHERVIGQNEAVKAVSDAVIRA
Mburto           -----EEDIAQVVSQWTNIPVTRLMEGEREKLTHLEEKLHERIVGQNETVKAVSDAIIRA
Plancto          -----EEEVAAVVSRWTGVPVSKLLEGEKEKLLHLEAELHKRVIGQDEAVTAVGEAVVRA
Spiro            -----EEDIAKIISMWTGIPVSKMMASEQQKYLQLESVLMQRVVGQDEAVRVISDAIRRN
Conosa           ----TPEQIADVVSRWTGIPVSKLSQTEKQRLLSLADHLHNRVVGQDEAVDAVADAVLRS
Eugleno          ----TETDIATVVSRWTNIPVTKLSQTERERLLHLADQLHLRVKGQDEAVSRVAEAILRS
Fungi            SEIVRPEQIMEVISRWTGIPVQNLAKSEREKLLHMEAEIGKKVVGQKRAIESVCDAIRLS
GNS              -----EEDVAAIVSTWTGIPVNRMLETEREKLIDMEARLHERVIGQHEAIVALSDAIRRA
Alveolata        ------EHVAEVMSIWTGIPLKKLTRGEMEIIRNMEEDLHKMVIGQEEAVKNVCKAIRRA
                                                                             

Sulfur           RAGLKDPARPIGSFIFLGPTGVGKTELAKSLTRYLFDSEDALIRADMSEYMEKFSVSRLV
Cfb              RAGLKDPNKPIGSFIFLGQTGVGKTQLAKVLARELFDNDDALIRIDMSEYMEKFAISRLI
Cyano            RVGLKNPNRPIASFIFSGPTGVGKTELTKSLASYFFGSEEAMIRLDMSEFMERHTVSKLI
ORF_QG23890      ----------------------------KSLASYFFGSEEAMIRLDMSEFMERHTVSKLI
Red              RVGLKNPNRPIASFIFSGPTGVGKTELTKALASYFFGSQEAMVRLDMSEYMERHTVSKLI
Crypto           RVGLKNPNRPIASFIFSGPTGVGKTELTKALASYFFGSEEAMVRLDMSEYMERHTVSKLI
Green            RTGLKNPNRPVASFIFSGPTGVGKSELAKSLSSFYFGSEDAMVRLDMSEFMERHTVSKLI
Trameno          RVGLRNPNRPIASFIFAGPTGVGKTELTKALSDYMFGSEESMIRLDMSEYMEKHTVAKLI
Firmicu          RVGLKDPKRPIGSFIFLGPTGVGKTELTKALAEALFGDENAMIRLDMSEYMERHTVSKLI
High             RAGLKDPKRPGGSFIFAGPSGVGKTELSKTLAEFLFGDEDALIQLDMSEYMEKHTVSRLV
Thermoga         RSGLKDPRRPIGVFLFLGPTGVGKTELAKALAEYLFGDERALIRFDMSEYMERFSVSRLI
Mhunga           RAGLSDSKRPIGSFIFLGTTGVGKTELAKALAEFLFNNENSMVRIDMSEYQERHTVSRLV
Mboonei          RAGLQDTKRPIGSFIFLGTTGVGKTELAKALAEFLFNNENSMVRIDMSEYQERHTVSRLI
Gproteo          RAGLSDPRKPNGSFLFLGPTGVGKTELCKALATFMFDSQDAMVRIDMSEFMEKHSVARLI
Mportu           QAGIKDPRRPIGSFIFLGPTGVGKTELAKALATELFDSEDHMIRVDMSEYMEKHTVARLI
Mburto           YAGIKDPKRPIGSFIFLGPTGVGKTELAKALAAEMFNDENNMIRIDMSEYMEKHTVSRLI
Plancto          RSGLKDPNRPIGSFIFLGPTGVGKTELARALAEFLFDDEKAMIRIDMSEYQEKHTVSRLV
Spiro            KAGLSDTRRPLGSFLCVGPTGVGKTELARTLADFLFNDERALTRIDMSEYMEKHAISRLI
Conosa           KSGLARENQPLGSFLFLGPTGVGKTELAKALALELFDDESHMVRIDMSEYMEQHSVSRLI
Eugleno          RAGLARSDRPTGSFLFLGPTGVGKTELSKAVASKLFDDAKYMVRLDMSEYMEQHSVARLI
Fungi            KAGLQNPTKPLASFMFLGPTGVGKTLLCKTLAEFLFNDERAMIRIDMSELMEQHSVAKLI
GNS              RSGLKDPRRPIGSFIFVGPTGVGKTELAKALAEFLFDSEDAMTRVDMSEFQERHTVSRLI
Alveolata        KTNIKNPNRPIGSFLFCGPPGVGKSEVARALTKYLFAKEN-LIRIDMSEYTEPHSISRIL
                                             : ::   * .   : : ****  * .::::::

Sulfur           GAPPGYVGYEEGGQLTEKVRRKPYSVVLIDEIEKAHPDVFNILLQVLDEGVLTDGLGRKV
Cfb              GAPPGYVGYEEGGQLTEKVRRKPYAVVLLDEVEKAHPDVFNMLLQVLDDGYLTDSLGRKI
Cyano            GSPPGYVGFNEGGQLTEAVRRRPYTVVLFDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTV
ORF_QG23890      GSPPGYVGFNEGGQLTEAVRRRPYTVVLFDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTV
Red              GSPPGYVGYSEGGYLTEAVRKRPYTVILFDEIEKAHPDIFNLLLQILEDGRLTDAKGRTI
Crypto           GSPPGYVGYNEGGQLTESVRRRPYTVVLFDEIEKGHPDVFNLLLQILEDGRLTDSKGRTV
Green            GSPPGYVGYSEGGQLTEAVRRRPYTLVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRVV
Trameno          GSPPGYVGYNEGGQLTEAVRSKPYSVVLLDEVEKGHPDVFNLLLQILDDGRLTDSKGRVI
Firmicu          GSPPGYVGFEEGGQLTEKVRRKPYSVILLDEIEKAHPDVFNILLQILEDGRLTDSKGRTV
High             GSPPGYVGYEEGGQLTERVRRKPFSVVLFDEVEKAHPDVFNTLLQILEDGRLTDSQGRLV
Thermoga         GAPPGYVGYEEGGTLTEKVRRRPFSVILFDEIEKAHPDVFNILLQIMDDGRLTDSQGREV
Mhunga           GAPPGYVGYEESGQLTEAVRRKPYSVVLLDEIEKAHPDVFNILLQVLDDGRLTDNKGRTV
Mboonei          GAPPGYVGYEESGQLTEAVRRKPYSVVLLDEIEKAHPDVFNILLQVLDDGRLTDNKGRTV
Gproteo          GAPPGYVGYEEGGYLTEHVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGQLTDGQGRTV
Mportu           GAPLGYIGHDEGGQLTEAVRRNPYSVVLFDEIEKAHHDVFNIMLQLLDDGRLTDSKGRTV
Mburto           GAPPGYIGHDEGGQLTEAVRRRPYAVVLFDEIEKAHHDVFNVMLQILDDGRLTDSHGRTV
Plancto          GAPPGYVGYDEGGQLTEAVRRRPYSVVLFDEIEKAHPDVFNTLLQVLDDGRLTDGQGRTV
Spiro            GAPPGYVGYDEGGQLTEAVRRRPYSVLLFDEVEKAHQDVFNIFLQILDDGRLTDGQGRVV
Conosa           GAPPGYVGYDQGGQLTEAVRRRPYSVVLFDEVEKAHQQVWNVLLQVLDEGRLTDGQGRTV
Eugleno          GAPPGYVGHEEGGQLTEPVRRRPYTVVLLDEVEKAHPNVFNVLLQVLDDGRLTDSHGRTV
Fungi            GAPPGYVGHEDGG-LFEAVRRKPYAVVLLDELEKAHKDVANVLLQVLDEGFIHDSKGRKI
GNS              GAPPGYVGYEEAGQLTESIRRRPYQVVLFDEIEKAHPDVFNTLLQLLDDGRLTDAQGHTV
Alveolata        GSPPGYKGHDTGGQLTEKVKSNPYSVVMFDEIEKAHHDVLNILLQILEDGKLTDSKNQTI
                 *:* ** *.. .* * * :: .*: ::::**:**.* :: * :**::::* : *  .: :

Sulfur           DFRNTIIIMTSNIGAKDIKSIGSGMGFAPGD---------------------SVESSYKS
Cfb              DFRNTIIIMTSNIGARKLKDFGQGVGFGTAS---------------------QKSQVDNN
Cyano            DFKNTLLIMTSNIGSKVIEKGGGGLGFEFSG-------------------DSVEDSQYNR
ORF_QG23890      DFKNTLLIMTSNIGSKVIEKGGGGLGFEFSG-------------------DSVEDSQYNR
Red              DFKNTLLIMTSNIGSKVIEKGGGSLGFELG--------------------ESQTESQYNR
Crypto           DFKNTLLILTSNVGSKVIEKGGGGLGFDLS--------------------EDQTESQYGR
Green            DFKNTLIIMTSNVGASAIEKGGGGLGFQLD--------------------DNAEDQSYNR
Trameno          DFTNTLIIMTTNLGSKIIERESGIKSKTEQGEGGFKITPDAVIGWEPAPEPIKDPEVFER
Firmicu          DFKNTVIIMTSNVGAELLKKQSTLGFMPQEK---------------------EDKASYDK
High             DFKNTVLIMTSNLGTRDISKGPGIGFATG-----------------------QGAVDYER
Thermoga         DFRNTIIIMTSNIGSSYINKSKRTLGFVGDN---------------------NEEKEFEK
Mhunga           DFKNTIIIMTSNIGSHIIQEN-LEHVTDKNR-----------------------EEIYDQ
Mboonei          DFKNTIIIMTSNIGSHLIQEN-MEKATEKDR-----------------------DELFER
Gproteo          DFKNTVLVMTSNLGSDVIQTMSHHNQGEEQT-----------------------DTEYEE
Mportu           DFKNTIVIMTSNICVDYAISKLE------------------------------EGVAYSK
Mburto           DFKNTLIIMTSNICVDRTLSKLE------------------------------EGEDYAK
Plancto          DFKNTIVIMTSNVGSQRILQYKGT----------------------------HIGEVYDR
Spiro            DFRNTIIIMTSNIGSEHILSARESRTHTSDLPV-----------------PETQSTEEQT
Conosa           DFSNVVIIMTSNLGSQYILGEQANKEGG-------------------------NNSLSQA
Eugleno          NFCYTIIIMTSNLGAQYLQNMDTSP------------------------------KAYEV
Fungi            DFRNTIIVMTSNLGAHLLAEQSAAG----------------------------GDPDLII
GNS              DFRNTVIIMTSNVGTEHVRQQSLGLVRTHDR------------------------NAEEA
Alveolata        SFKNTIIIMTSNTGSNVIQRSSKGVHTFGFTVD------------------SDESSDYLK
                 .*  .::::*:*                                                

Sulfur           MKSTVQDALKRVFNPEFLNRIDDTVVFHQLEKKHIFEIIDIIAGKLFKRLHEMGIEVSID
Cfb              ARSVIENALKKAFAPEFLNRIDDVVIFNSLEREDIHKIIDIELEKLFDRIHGLGYDLTLS
Cyano            IKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKEIAEIMLQEVFIRLQDKGIKLNVT
ORF_QG23890      IKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVFIRLQDKGIKLNVT
Red              IRSLVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVREIAEIMLQEVFNRIKQQEIELEVT
Crypto           IKALVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVGEIAEIMLKEVFTRISEKGIQLEVT
Green            IKSLVMEDLKNYFRPEFLNRLDEIIVFRQLNKQEVREIAYIMLENVFKRLKEKEITLECT
Trameno          VTKLVNDELKNFFRPEFLNRIDEIIVFNHLTRIDIWEICELMIKSVQNRLKDKGINLIVE
Firmicu          IKETLMAELRKTFRPEFLNRVDEIIVFHQLSKEDIEKIADIMIKELNDRLKENDIKLDFT
High             MKAKVQDELKQHFRPEFLNRIDDIIVFHQLSENEIIQIVDLMLARVDIQLKNKDMALELT
Thermoga         IKDLVLEEVKRTFRPEFLNRIDETIIFHPLNKEHIEQIIDILLRDLRKRLSEKNMKLVLT
Mhunga           TKDLVFDLLKKTIRPEFLNRIDEVIMFRPLTMDEIRTVVKLQLDIVRKMLEKNDVRFTVT
Mboonei          TREQVFDLLKKTIRPEFLNRIDEIIMFKPLTEDEIRTVVEIQLEGVQKMLEKSDVRLTAT
Gproteo          MKSAVMEIVGGHFRPEFINRIDEVVVFHPLQKSQIQGIAQIQLQELEKRLKERELSLQLS
Mportu           MQETAMNELTKHFRPEFLNRIDEIAIFRALTKDQLTYIVDIKIEDLVQRLKERRIDLEIT
Mburto           MQEMAQNELAKHFRPEFINRIDELAIFRPLTKEQLVTIVDIKATDLIQRLKEKRMVLEIS
Plancto          MRAAVMEELRKGFRPEFLNRIDEIIVFHALTEADLTKIIEVQLGNLRKRLAERKIGLALT
Spiro            LPEQIRGLLHTYFRPEFLNRIDEVLIFKRLTRKHIRLITDIQLQMVVERLESRHIKLRVR
Conosa           CKDKVIDEVRKHFRPEFLNRLDDIIVFTPLSKENLHSIITLQLRSVEKRLEDQNMSLKIS
Eugleno          AQTQVMGEVRKFFRPEFINRLDDIILFRSLGLKEMTGIIDLITEELYGRLKDQSIRVSLT
Fungi            LKESILQIVRQHFSPEFTNRIDEIVIFNRLTETNITNIVDVRLEEVQERLADRKITLDVS
GNS              ARERVFEALRQAFRPEFLNRIDEIIVFHALTEQELMQIVDLLVREVDERLREQGLTLELT
Alveolata        IKALVMEELKSHFLPELINRIDDVILFKPLSESELKEIAKLMLNDLTARANSAGILIEIS
                         :   : **: **:*:  :*  *   .:  :  :    :          .   

Sulfur           ARAKEYLVEKGYDQKFGARPLKRALQRNVEDSLAEEMLKGKFTEGSTIRISYDAKNDKLK
Cfb              DKAKDFIAEKGFDKQYGARPLNRAIQKYIEDALAEEIITSKLKEGDKIQMDLDEEKNELT
Cyano            DAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDNALVDIDDNKKVTI
ORF_QG23890      DAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDNALVDIDDDKKVTI
Red              ERFKNRLVDEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGKIKAGDSAVVDVTDEGKVTV
Crypto           ARFKTHLINEGYNPIYGARPLRRAVMRLLEDTLSEEFLAEKIKEGDTAVVDVDDDGKVKV
Green            ERFKDRLVDEGFSPAYGARPLRRAIMRLLEDNLSEKMLTGEISEGSSCIMDVNAEGEITV
Trameno          LSVQAFLTDEGYDPIYGARPLRRAIMKYLEDTLAEQCLSKTLYPNTKIHVRRKKVEGTLM
Firmicu          PEAKEEIIKQGYDPNYGARPLRRVIQRIVENQLSELMLQGEVKPGDELIVTAKD--GKIE
High             SAAKALLAKKGYDPVLGARPLRRTIQREIEDVLSEKILYGTLKPGEIVVGDVEGEGDDAK
Thermoga         KSAKEFLVEKGFDPVYGARPLKRAIQRYVEDPLSEEILRGKFNEGDTIVCRARKDALRFT
Mhunga           EKAIGHIANLGFDPLFGARPIKRVIQRNLLNELSKMILAGEVTKEKEIIVDEKDGSLVFR
Mboonei          KKAIRFIAALGFDPQFGARPIKRVIQKNLLNELSKMILEGKVQKDKEIVVDEKGGKLVFG
Gproteo          DEAINRLVEVGYDPVYGARPLKRSIQRWIENPLAQDILSGKFVPGDRIVAEVSGDQLSFT
Mportu           DRAKKYLGDAGYSETYGARPLKRVIQNELETEVGKRIVSGEVMESDTVVVDADERGLNFE
Mburto           KKAKHYLAEAGYSETYGARPLKRVIQNEVETAVAKLIVGGQALEGSTIEVDADDRGIVVN
Plancto          EGAKAHMVRVGYDPAYGARPLKRTIQKEVETPLARLLLKGEVADGGSVAVDYDAAHDALS
Spiro            DAAKAYLAERGYDDTFGARPLKRAIQTELENALAREILSGRFRGGSTIVVDMCKDALCFT
Conosa           NDALDSIINAAYDPIFGGRPLKRYIEKNIVTELSKLILGGKLKENQGVVVNEKDHHLNFD
Eugleno          EEAKNYVLESAFDADMGARPLRRWVEKNITTELSRMIISQELSPNSTVKVTLSSNHKKLS
Fungi            KPAKELLGKEGYEPVFGARPLNRLIQQKVLNPLARLIIDGGVRPGEVAHVGLNESGKLEV
GNS              PTAKKLLVREGYNPAYGARPLRRTVQRLVETPLSRNLLRGLFKPGDTILVDVDPQTDALT
Alveolata        EKFADYILKLPRDDKSGARPLRRLITSVLEDKLADLVISDDFDSNNTYTVTVDEADSVVI
                       :     .   *.**:.* :   :   :.   :                      

Sulfur           FTKASDSSKKKKKLTEPIDEEPSNGKDQ--------------------------------
Cfb              IDIQKSVKETES------------------------------------------------
Cyano            NISSEESSQELAGANF--------------------------------------------
ORF_QG23890      NISSEESSQELAGANF--------------------------------------------
Red              LLGEQLEAIKQL------------------------------------------------
Crypto           LLGEKLELVAN-------------------------------------------------
Green            LTGDGRELKAGSAIGGPAGIA---------------------------------------
Trameno          TYTNELEVEVDFSDVDPSLLDEEANETAMSSLDKSNNEKEKVGSIVSKDNSSGINEDEPS
Firmicu          FVKKDAIKKA--------------------------------------------------
High             FVFRGETKPNQVPDAPPVDLAKSSE-----------------------------------
Thermoga         RKGEKKEKVVQ-------------------------------------------------
Mhunga           NT----------------------------------------------------------
Mboonei          NA----------------------------------------------------------
Gproteo          VAQTVH------------------------------------------------------
Mportu           VRKGEEHT----------------------------------------------------
Mburto           VRTEPAKQ----------------------------------------------------
Plancto          FTATPGEPVA--------------------------------------------------
Spiro            EQTS--------------------------------------------------------
Conosa           IIDLKQQQQRPASPTKKQKTIK--------------------------------------
Eugleno          FSVKRTAAQT--------------------------------------------------
Fungi            LRNHEIQSDYEVEEPMEENNDSDEDMD---------------------------------
GNS              FTRRETLDLEVKKPVEPVSG----------------------------------------
Alveolata        NPKVENETVVEEVVLNNKMESEKSREE---------------------------------
                                                                             

Sulfur           ------------------------
Cfb              ------------------------
Cyano            ------------------------
ORF_QG23890      ------------------------
Red              ------------------------
Crypto           ------------------------
Green            ------------------------
Trameno          FGLGSNDSKPTIAGRAAKFFKKKN
Firmicu          ------------------------
High             ------------------------
Thermoga         ------------------------
Mhunga           ------------------------
Mboonei          ------------------------
Gproteo          ------------------------
Mportu           ------------------------
Mburto           ------------------------
Plancto          ------------------------
Spiro            ------------------------
Conosa           ------------------------
Eugleno          ------------------------
Fungi            ------------------------
GNS              ------------------------
Alveolata        ------------------------



___________________________________________________________________________________________________

PROTOCOLE:
Outils: Infobiogen/ClustalW/Premier jeu de données: Séquences au format FASTA/Séquences: Protéiques
Sortie alignements: Clustal

nouveau groupe d'étude: 10 cyanobactéries + 5 eucaryotes photosynthétiques
nouveau groupe extérieur : 5 Autres bactéries


Physco           ------------------------------------------------------------
Ostreo           ------------------------------------------------------------
Graci            ------------------------------------------------------------
Porphy           ------------------------------------------------------------
Prochlo          ------------------------------------------------------------
ORF_QG23890      ------------------------------------------------------------
Synecho          ------------------------------------------------------------
Anaba            ------------------------------------------------------------
Nostoc           ------------------------------------------------------------
Crocos           ------------------------------------------------------------
Cyanot           ------------------------------------------------------------
Micro            ------------------------------------------------------------
Gloeo            ------------------------------------------------------------
Acaryo           ------------------------------------------------------------
Thermo           ------------------------------------------------------------
Mycoba           ------------------------------------------------------------
Bactero          ------------------------------------------------------------
Lepto            ------------------------------------------------------------
Chlamy           MLQTLQNSLTTFEPLIASQALPAAAELLRQIMLQQGPMRLAKNTPAATNVPRVLSGMHAG
Magneto          ------------------------------------------------------------
Tretra           ------------------------------------------------------------
                                                                             

Physco           ------------------------------------------------------------
Ostreo           ------------------------------------------------------------
Graci            ------------------------------------------------------------
Porphy           ------------------------------------------------------------
Prochlo          ------------------------------------------------------------
ORF_QG23890      ------------------------------------------------------------
Synecho          ------------------------------------------------------------
Anaba            ------------------------------------------------------------
Nostoc           ------------------------------------------------------MLKSAY
Crocos           ------------------------------------------------------------
Cyanot           ------------------------------------------------------------
Micro            ------------------------------------------------------------
Gloeo            ------------------------------------------------------------
Acaryo           ------------------------------------------------------------
Thermo           ------------------------------------------------------------
Mycoba           ------------------------------------------------------------
Bactero          ------------------------------------------------------------
Lepto            ------------------------------------------------------------
Chlamy           PRTTAVRFSSGHVEAAAPLLPFSARQLAQPSPLSGLSLAPGLTVRPGRRTLATRAAQSGS
Magneto          ------------------------------------------------------------
Tretra           ------------------------------------------------------------
                                                                             

Physco           ----------MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLK
Ostreo           ------------------------------------------------------------
Graci            ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAQVLK
Porphy           ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLVGEGTGIAAQVLK
Prochlo          ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
ORF_QG23890      ------------------------------------------------------------
Synecho          ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Anaba            ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Nostoc           RHDAGDGKNAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Crocos           ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Cyanot           ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Micro            ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Gloeo            ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Acaryo           ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLK
Thermo           ----------MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLR
Mycoba           ----------MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLD
Bactero          ----------MNNQFTQRVSDIIMYSKEEANRLRNSYIGPEHLLLGLIREGEGKAIEILF
Lepto            ----------MLEFTKRAKRVINEIAQDEAKRLGSDYIGPEHILLGLLKEEDSVAIKILN
Chlamy           GGGSGGGKRITQNQFTDKAWQAVVAAPEIAKEYGQQVVETEHLLKALLEQPNGLARRILS
Magneto          ---------MDFEKYSERCKGFVQAAQTLALRHGHQRLMPEHLLKVLLDDKDGLAAKLIK
Tretra           ---------MNIEKMTTTLQSAIAEAQQVAVTRKQQEIDIAHLWKIFLQ-PKQFARNFYK
                                                                             

Physco           SMGVNLKEARVEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Ostreo           ---------XXEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELALEEARQLGHNY
Graci            SMNVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Porphy           SMNVNLKDARVEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Prochlo          SLGVNLKDSRIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
ORF_QG23890      ------------------------------------------------------------
Synecho          SMGVNLKDARVEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Anaba            SMGVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Nostoc           SMGVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Crocos           SMGVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Cyanot           SMGVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Micro            SMGVNLRDARVEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Gloeo            SMGVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Acaryo           SMGVNLKDARVEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Thermo           SMGVNLKDARIEVEK-----IIGRGSG---FVAVEIPFTPRAKRVLELSLEEARQLGHNY
Mycoba           SLGISLEAVRSQVED-----IIGQGQQ---APSGHIPFTPRAKKVLELSLREALQLGHNY
Bactero          NLQINLQDIKNQLEA-----IVKNNAENDTTYDENISFNDKASKVLKLCILEAKLLRNIA
Lepto            NLNINLNELRKEVER-----RTREASG--ALLMDVAGGQDRYQKIIELSKEEAKRLKHNY
Chlamy           KAGSDATRLLDRVDAYIRRQPTVSGD-------SGQVLGRNLEALVNRSMELQAKWGDQF
Magneto          AAGGDHKKALAGVEAEIAKQPKVEGPGA-----SGLHLTGELARVFQLAEEAATKSGDEY
Tretra           DLGVDLNAFEHEIDQTIDSLPSVEGGNVQYGQNISQNISQNLYHLLNEADQLAKDFKDEF
                                                                             

Physco           IGTEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVG-------------------
Ostreo           IGTEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVG-------------------
Graci            IGTEHLLMGLVREGEGVAARVLENLAVNVASIRTEVIQMLG-------------------
Porphy           IGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLG-------------------
Prochlo          IGTEHLLLGLIREGEGVAARVLENLNIDLTKVRTQVIRMLG-------------------
ORF_QG23890      ------------------------------------------------------------
Synecho          IGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLG-------------------
Anaba            IGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLG-------------------
Nostoc           IGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLG-------------------
Crocos           IGTEHLLLGLIREGEGVAARVLENLGVNLSKVRTQVIRQLG-------------------
Cyanot           IGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRQLG-------------------
Micro            IGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLG-------------------
Gloeo            IGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLG-------------------
Acaryo           IGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLG-------------------
Thermo           IGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLG-------------------
Mycoba           IGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSG---------------YQG
Bactero          ADSEHILLAIMKVKDNAAFHVLESNGVTYEKIKLTLQPDTHAGLGFSEDEDEDEDIRQSP
Lepto            VGTEHILLALLRDNNNIAGGALYSFSVNYNVIKSEILRLLGA----------------PP
Chlamy           VSIEHLVAAMAE-DGRFGESLFKAEGLTKDKLDAAIKDVRG-------------------
Magneto          VTAERLLLALTMGAGTASARILSEAGINPQALNRAIDDMRK-------------------
Tretra           LSTEIVLLALMKLKNYRLTKFLKNQGVNEKQIKQSIENIRQ-------------------
                                                                             

Physco           -ENTEAVGVRSGSGS---SGNKMPTLEEYGTNLTKLAEEGKLDPVVGRISQIERVTQILG
Ostreo           -ETQEAVGAGAGCGQGAQAGSKTPTLEEFGSDLTKKAEEGKLDPCIGRVNEIIRVTQILG
Graci            -DTTEANTNGNNNTQ---TRSKTPTLEEFGSNLTELAIEGILDPVVGRQKEIERVIQILG
Porphy           -ENAEANVSGSNATQ---ARSKTPTLEEFGSNLTQMAIEGGLDPVVGRQKEIERVIQILG
Prochlo          -ETAEVGTGGSSNK----GNLKTATLDEFGTNLTKLASESKLDPVVGRHSEIDRVVQILG
ORF_QG23890      ------------------------------------------------------------
Synecho          -ETAEVTAGGGGSK----GSTKTPTLDEFGSNLTQLAAEGKLDPVVGRHNEIDRVVQILG
Anaba            -ETAEVSATGQS------GRTKTPTLDEFGSNLTQMATDNKLDPVVGRAKEIERVIQILG
Nostoc           -ETAEVSATGQS------GRTKTPTLDEFGSNLTQMATDNKLDPVVGRAKEIERVIQILG
Crocos           -ETAEVAAGGGTP-----GRTKTPTLDEFGSNLTQLAGEGQLDPVVGRQKEIERVIQILG
Cyanot           -ETAEVAAGGGTP-----GRTKTPTLDEFGSNLTQLAADGQLDPVVGRQKEIERVIQILG
Micro            -ETAEVAAGSSSQ-----GRTKTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILG
Gloeo            -ETAEVSAGGNT------GRTKTPTLDEFGSNLTQMAAEGKLDPVVGREKEIERVIQILG
Acaryo           -ETAEVSAGGGQ------GRTKTPTLDEFGANLTNLASEGKLDPVVGRQKEIERVIQILG
Thermo           -ETAEVTAGASQ------GRTKTPTLDEFGVNLTQLAIEGKLDPVVGRQKEIERVIQILG
Mycoba           KEAAEAGTGGRGGESG--SPSTSLVLDQFGRNLTAAAMESKLDPVIGREKEIERVMQVLS
Bactero          SGNKSNAAQQQARPAQKKPANDTPVLDNFGTDMTKAAEEGKLDPVVGRVKEIERLAQILS
Lepto            TSSVGVSSTTQSGPQPRQEKTKTPILDEFARDLTQLARDKKLDPVVGRATEIQRVIQILS
Chlamy           ----------TNKVVDQDPEGKYEALNKYARDLTAAARDGKLDPVIGRDDEIRRTIQILS
Magneto          ----------GRKANSASAEDGYDALKKYARDLTAAAREGKLDPVIGRDEEIRRTIQVLS
Tretra           ----------GDRVTSQNQEEQYEALEKYGTDLVQEVKNGEMGPIIGRDEEIRDVIRILS
                                                                             

Physco           RRTKNNPCLIGEPGVGKTAVAEGLAQRIASGDVPETIEGKNVVTLDMGLLVAGTKYRGEF
Ostreo           RRTKNNPCLIGEPGVGKSAIAEGLAQKIATNDVPDTLDSKRMMTLDMGLLVAGTKYRGEF
Graci            RRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPSILEDKLVVTLDVGLLVAGTKYRGEF
Porphy           RRTKNNPVLIGEPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEF
Prochlo          RRTKNNPVLIGEPGVGKTAIAEGLAQRIQTGDIPDILEDKRVLTLDIGLLVAGTKYRGEF
ORF_QG23890      ------------------------------------------------------------
Synecho          RRTKNNPVLIGEPGVGKTAIAEGLAQRIIIGEVPDILEDKRVLTLDIGLLVAGTKYRGEF
Anaba            RRTKNNPVLIGEPGVGKTAIAEGLASRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEF
Nostoc           RRTKNNPVLIGEPGVGKTAIAEGLASRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEF
Crocos           RRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEF
Cyanot           RRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEF
Micro            RRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEF
Gloeo            RRTKNNPVLIGEPGVGKTAIAEGLAQRISNNDIPDILADKRVVTLDIGLLVAGTKYRGEF
Acaryo           RRTKNNPVLIGEPGVGKTAIAEGLAQRIANGDIPDILEEKRVVTLDIGLLVAGTKYRGEF
Thermo           RRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEF
Mycoba           RRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPETLKDKQLYTLDLGSLVAGSRYRGDF
Bactero          RRKKNNPILIGEPGVGKSAIVEGLALRIVEKKVSRILFDKRVIALDMTAVVAGTKYRGQF
Lepto            RKTKNNPVLVGESGVGKTAIVEGLALAIVEKSVPDLLFEKRVLSLDLASLIAGTKYRGEF
Chlamy           RRTKNNPCLIGEPGVGKTAVVEGLAQRIVAGDVPQALQGRTLMALDMGSLIAGAKYRGEF
Magneto          RRTKNNPVLIGEPGVGKTAIIEGLAIRIVNGDVPENLKLKSLMSLDMGSLIAGAKFRGEF
Tretra           RKTKNNPVLIGEAGVGKTAIVEGLAQRIVKKDVPENLKDKTVFSLDMGALIAGAKYRGEF
                                                                             

Physco           EERLKKLMEEIKQAD-DIILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Ostreo           EERLKKLMDEVKNDE-NIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Graci            EERLKRIMDEIKSAN-NIVLVIDEVHTLIGAGAAEGAIDAANLLKPALARGELQCIGATT
Porphy           EERLKRIMDEIKSAD-NVILVIDEVHTLIGAGAAEGAIDAANLLKPALARGELQCIGATT
Prochlo          EERLKKIMEEIKSAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
ORF_QG23890      ------------------------------------------------------------
Synecho          EERLKKIMEEIRGAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Anaba            EERLKKIMDEIRQAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Nostoc           EERLKKIMDEIRQAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Crocos           EERLKKIMDEIRQAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Cyanot           EERLKKIMDEIRQAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Micro            EERLKKIMDEIRQAG-NVVLVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Gloeo            EERLKKIMDEIRAAG-NVVLVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Acaryo           EERLKKIMDEIRQAS-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Thermo           EERLKKIMDEIRQAG-NVILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATT
Mycoba           EERLKKVLKEINTRG-DIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATT
Bactero          EERIRSILNELKKNP-NIILFIDEIHTIVGAGSAAGSMDAANMLKPALARGEIQCIGATT
Lepto            EERLKKIMKEITSST-NIIIFIDELHTLIGAGAAEGAVDAANILKPALARGELQCIGATT
Chlamy           EDRLKAVIKEVTDSAGKIVLFIDEIHTIVGAGATGGAMDASNLLKPMLSRGELRCIGATT
Magneto          EERLKAVLSEIQAANGDVILFIDEMHTLVGAGAAEGAMDASNLLKPALARGELHCVGATT
Tretra           EERLKAVLKEVKKADGRIILFIDEIHNIVGAGKTEGSMDAGNLLKPMLARGELHTIGATT
                                                                             

Physco           LDEYRKHIEKDPALERRFQPVLVPEPTVEETIEILRGLRERYEIHHKLRYTDEALIAAAQ
Ostreo           IDEYRKHIEKDPALERRFQPVQVPEPTVDETIQILRGLRERYELHHKLKYSDDALIAAAK
Graci            LEEYRKHIEKDAALERRFQPVLVGEPSVEETIEILFGLRDRYEKHHQLKMSDEALAAAAK
Porphy           LEEYRKHIEKDPALERRFHPVVVGEPSVEETIEILFGLRDRYEKHHQLTMSDGALAAAAK
Prochlo          LDEYRKHIERDAALERRFQPVMVGEPSIEDTIEILKGLRERYEQHHRLKITDDALEAAAH
ORF_QG23890      ------------------------------------------------------------
Synecho          LDEYRKHIERDAALERRFQPVMVGEPSVVDTIEILRGLRERYEQHHRLKISDEALVAAAT
Anaba            LDEYRKHIERDAALERRFQPVMVGEPSVDETIEILYGLRDRYEQHHKLKISDEALVAAAK
Nostoc           LDEYRKHIERDAALERRFQPVMVGEPSVDETIEILYGLRDRYEQHHKLKISDEALVAAAK
Crocos           LDEYRKHIERDAALERRFQPVMVGEPSVDETVEILFGLRERYEQHHKLKILDEALDAAAK
Cyanot           LDEYRKHIERDAALERRFQPVMVGEPSVDETIEILYGLRERYEQHHKLKILDEALEAAAK
Micro            LDEYRKHIERDAALERRFQPVMVGEPSVEETIEILYGLRERYEQHHKLKILDEALEAAAK
Gloeo            LDEYRKHIERDAALERRFQPVMVGEPTVDETIEILRGLRERYEQHHKLKITDEALIAAAQ
Acaryo           LDEYRKHIERDAALERRFQPVMVGEPSVEETIEILYGLRERYEQHHKLSILDESLEAAAK
Thermo           LDEYRKHIERDAALERRFQPVMVGEPSVEETIEILYGLRERYEKHHKLKISDEALEAAAK
Mycoba           LDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHRVSITDSAMVAAAT
Bactero          LDEYRQNIEKDGALERRFQKVIVEPTTAEETLQILKNIKDKYEDHHNVNYTDAALEACVK
Lepto            SAEYRKYIEKDSALERRFQVVKVAEPSVDDAIQILQGLKKAYETHHKVRYSDKALEQSVK
Chlamy           LDEYRKYIEKDPALERRFQQVYVDQPNVAQTVSILRGLRERYEVHHGVRISDSALVEAAV
Magneto          LNEYRKHVEKDAALARRFQPVFVSEPNVEDTISILRGIKEKYEMHHGVRISDSSLVAAAT
Tretra           LDEYRENIETDKALERRFQRVSVQEPSVEDTISILRGLKERFEIHHGVNIHDNALVAAAT
                                                                             

Physco           LSYQYISDRFLPDKAIDLIDEAGSKVRLKHAQLPEEAKELDKELRAVTKEKNEAVRGQD-
Ostreo           FSSQYISDRFLPDKAIDLIDEAGSRVRLANAALPEEAKELDKELKALMKEKDNAIRSQD-
Graci            YANQYISDRFLPDKAIDLIDEAGSRVRLLNSQLPPAARELDKELRSVLKTKDEAIRAQK-
Porphy           YANQYISDRFLPDKAIDLIDEAGSRVRLLNSQLPPAARELDKELRAVLKTKDEAIRAQK-
Prochlo          LGDRYISDRFLPDKAIDLIDEAGSRVRLINSKLPPEAKQIDRELRQIQKQKEESVRDQN-
ORF_QG23890      ------------------------------------------------------------
Synecho          LGDRYISDRFLPDKAIDLVDEAGSRVRLMNSKLPPAAKELDKQLRAIQKQKEDSVRQQD-
Anaba            LSDRYISDRYLPDKAIDLVDEAGSRVRLMNSQLPPAAKELDKELRQILKEKDDAVRSQD-
Nostoc           LSDRYISDRYLPDKAIDLVDEAGSRVRLMNSQLPPAAKELDKELRQILKEKDDAVRSQD-
Crocos           LSDRYISDRYLPDKAIDLIDEAGSRVRLINSQLPPAAKELDKELRTILKQKDDAVRSQD-
Cyanot           LSDRYISDRYLPDKAIDLIDEAGSRVRLINSQLPPAAKELDKELRTILKQKDDAVRSQD-
Micro            LSDRYISDRFLPDKAIDLIDEAGSRVRLINSQLPPAAKELDKELRQILKQKDDAVRGQD-
Gloeo            LSDRYISDRYLPDKAIDLVDEAGSRVRLLSSQLPPAAKELDKELRQILKEKDDAVRGQD-
Acaryo           LSDRYISDRYLPDKAIDLIDEAGSRVRLINSQLPPAAKELDKELRKVLKDKDDAVRSQD-
Thermo           LSDRYISDRYLPDKAIDLIDEAGSRVRLINSQLPPAAKELDRELRQVLKEKDDAVRAQN-
Mycoba           LADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPDLREFDEKIAEARREKESAIDAQD-
Bactero          LTDRYITDRNFPDKAIDALDEAGSRVHLTNITAPKEIEEQEKLIDEMKSLKNEAVRLQN-
Lepto            LSHRYINDRYLPDKAIDIIDEAGAKARLANCARPQTIKDLEEEIKSLASKKEELVRAQE-
Chlamy           LSDRYIADRFLPDKAIDLVDEAAAKLKMEITSKPLALDEIDRKVLQLEMEKLSLTKNSDR
Magneto          LSNRYITDRFLPDKAIDLVDEAASRLRMEVDSKPEELDEIDRRIVQLKIEREALKKETDP
Tretra           LSDRYITDRYLPDKAIDLVDEACANIRVEMNSMPTELDQVTRRLMQLEIEEAALKKEIDD
                                                                             

Physco           --FEKAGELRDREMELKAQISAFIEKDKEKVKAESETG----------------------
Ostreo           --FEAAGGLRDREVELRAQIKQITERKQEESRAKSESGD---------------------
Graci            --YEKAEQYRTREMEIKAQIAAIAQSKKNEPNVQ--------------------------
Porphy           --YETAEQYRAREMEIKAQIAAIAQSKKNEPDLN--------------------------
Prochlo          --FDQAGQLREKEMELSAKIKEVLDNKKESTAVDQTDPDNSAKSDSKLLQS---------
ORF_QG23890      ------------------------------------------------------------
Synecho          --FGKAGELRDKEVELRDQIRSILQARRDEEPVASTAVEGSAEATAEAKASTAADNAL--
Anaba            --FDRAGELRDREMEIKAEIRAIAQSKTNASGT---------------------------
Nostoc           --FDRAGELRDREMEIKAEIRAIAQSKTNASGT---------------------------
Crocos           --FDRAGELRDQEMDIKEQIRSISTAKKGEG-----------------------------
Cyanot           --FDRAGELRDQEMDIKEQIRSISSAKKGEG-----------------------------
Micro            --FEKAGELRDREMEIKTQIRNLASTKKGED-----------------------------
Gloeo            --YERAGELRDREMEIKSQIRSIAQARKSET-A---------------------------
Acaryo           --FDKAGELRDREMEIKSEIKAIAQNKKSSEEN---------------------------
Thermo           --FDKAGELRDREMELKAQIRAIAQQKKAEIANG--------------------------
Mycoba           --FEKAASLRDREKQLVAQRAEREKQWRSGD-----------------------------
Bactero          --FELAASYRDKEKEYTNQLDTLKEEWEKSLKEN--------------------------
Lepto            --YEKAAGVRDEVNRKKQAMEEKLRSWQEKMEDF--------------------------
Chlamy           AAAARLAALDAELDDLKEQQKVITGQWRKEKDDMGRVQDLKEEIERVNIEIAQAERTYDL
Magneto          ASRDRLLTLEDELIDLEADSDRITNEWRAEKDQLASATKLKEQLDAARIEADKAQREGQY
Tretra           ASMKRLASLQEELAELREEVNSMKLQWETEKEEVNAVSNKRAEIDKAKHELEDAENNYDL
                                                                             

Physco           -----------------------------------DVGPTVEEADIQQIVSAWTGIPVEK
Ostreo           -----------------------------------ETGPQVVEQDIADVVAAWTGIPVDK
Graci            -----------------------------------IEDPVVTEDDIAEIVAFWTGIPVTK
Porphy           -----------------------------------LEDPVVTEDDIAEIVAAWTGIPVTK
Prochlo          --------------------------------------PLVSEEDVAHIVASWTGVPVQK
ORF_QG23890      ------------------------------------------------------------
Synecho          ------------------------------ASSSGERHPVVTEEDIAQIVASWTGVPVQK
Anaba            ----------------------------------EGQEPVVTEEDIAHIVASWTGVPVNK
Nostoc           ----------------------------------EGQEPVVTEEDIAHIVASWTGVPVNK
Crocos           ----------------------------------DSAEPFVDAEEIAQIVASWTGVPVNK
Cyanot           ----------------------------------ENDEPFVDAEEIAHIVASWTGVPVNK
Micro            ----------------------------------GNDEPFVDAEEIAHIVASWTGVPVNK
Gloeo            ----------------------------------NEESPNVTEEDIAYIVSSWTGVPVSK
Acaryo           ----------------------------------KDDSPKVTEEDIAHIVASWTGVPVSK
Thermo           ----------------------------------EEETPVVTEEDIAHIVASWTGVPVSK
Mycoba           ----------------------------------LDVIAEVDDEQIAEVLGNWTGIPVFK
Bactero          -------------------------------------RETVDDEQIAEVVSMMSGVPVQR
Lepto            -------------------------------------AVNIEEDDILSVISLWTGIPLEK
Chlamy           NRAAELKYGTLHSLQQSLKAAEEALRQAEAHDGKKLLKEEVTESDIAEIISKWTGIPVSK
Magneto          QKAGELLYGLIPDLERKLATADAAEG--------RMLNEAVTEEHIAGVVSRWTGIPVDK
Tretra           ERAAVLRHGTVPQLEKELKELEDKDDQ----TVLKMVQESVTANEIAVVVGRLTGIPVTK
                                                                             

Physco           VSSDESDRLLKMEDTLHNRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVG
Ostreo           VSSDEGTRLMAMEETLHKRLVGQEEAVVACARAIRRARTGLKNPNRPVASFIFSGPTGVG
Graci            LTKSESEKLMHMEETLHNRIIGQDEAVVAVSRAIRRARVGLKNPNRPIASFIFSGPTGVG
Porphy           LTKSESEKLMQMEETLHGRIIGQDEAVIAVSRAIRRARVGLKNPNRPIASFIFSGPTGVG
Prochlo          LTETESVKLLNMEETLHQRLIGQDEAVKAVSRAIRRARVGLKNPNRPIASFIFSGPTGVG
ORF_QG23890      ------------------------------------------------------------
Synecho          LTESESVKLLNMEETLHQRLIGQDEAVKAVSKAIRRARVGLKNPNRPIASFIFSGPTGVG
Anaba            LTESESEKLLHMEDTLHQRLIGQEDAVKAVSRAIRRARVGLKNPNRPIASFVFSGPTGVG
Nostoc           LTESESEKLLHMEDTLHQRLIGQEDAVKAVSRAIRRARVGLKNPNRPIASFVFSGPTGVG
Crocos           LTETESEKLLHMEDTLHQRLIGQEDAVKAVSRAIRRARVGLKNPNRPIASFVFSGPTGVG
Cyanot           LTETESEKLLHMEDTLHQRLIGQEDAVKAVSRAIRRARVGLKNPNRPIASFVFSGPTGVG
Micro            LTETESEKLLHMEDTLHQRLIGQEDAVKAVSRAIRRARVGLKNPNRPIASFIFSGPTGVG
Gloeo            LTESETEKLLHMEDVLHQRLIGQEEAVKAISRAIRRARVGLKNPKRPIASFIFSGPTGVG
Acaryo           LTESESEKLLHMEDTLHQRLIGQDEAVRAISRAIRRARVGLKNPNRPIASFIFSGPTGVG
Thermo           LTESESEKLLHMEETLHQRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVG
Mycoba           LTEAETTRLLRMEEELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVG
Bactero          MAQAEGMKLLGMKDDLLSKVIGQDKAIATLVKAIQRSRVGLKDPNKPIGTFMFLGPTGVG
Lepto            MEESESDKLLRLEEELKKRVVGQAEAIEKIAKAVRRARTGFKSERRPTGSFIFLGPTGVG
Chlamy           LVESEREKLLHLADELHKRVIGQEAAVDAVADAIQRSRAGLADPNRPIASFMFLGPTGVG
Magneto          MLAGEREKLLDMENRLKKRVIGQDEALVAVSNAVRRARAGLQDPNRPIGSFLFLGPTGVG
Tretra           LVEGEREKLLNLNETLHKRVIGQDEAVNAVSDAVIRSRAGLQNPDRPLGSFLFLGPTGVG
                                                                             

Physco           KSELAKSLASYYFGSEEAMVRLDMSEFMERHTVSKLIGSPPGYVGYSEGGQLTEAVRRRP
Ostreo           KSELAKSLSSFYFGSEDAMVRLDMSEFMERHTVSKLIGSPPGYVGYSEGGQLTEAVRRRP
Graci            KTELTKALASYFFGSQEAMVRLDMSEYMERHTVSKLIGSPPGYVGYSEGGYLTEAVRKRP
Porphy           KTELTKALASYFFGSEASMIRLDMSEYMERHTVSKLIGSPPGYVGYSEGGYLTEAVRKKP
Prochlo          KTELTKSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRP
ORF_QG23890      -----KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRP
Synecho          KTELTKALAAYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRP
Anaba            KTELAKSLASYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Nostoc           KTELAKSLASYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Crocos           KTELTKSLAAYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Cyanot           KTELTKALATYFFGSEDAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Micro            KTELTKALAAYFFGSEDAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Gloeo            KTELAKSLATYFFGSEDAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Acaryo           KTELTKALATYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Thermo           KTELTKALAAYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRP
Mycoba           KTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKP
Bactero          KTHLAKELAKLMFGSADALIRIDMSEYMEKFTVSRLVGAPPGYVGYEEGGQLTEKVRRKP
Lepto            KTELAKALANFLFGNDDAMLRVDMSEYMEPHAVSRLIGAPPGYVGYDDGGQLTEFVRKRP
Chlamy           KTELAKALAQFLFNTEDAMVRIDMSEYMEKHSVSRLIGAPPGYVGYDEGGQLTEAVRRRP
Magneto          KTELTKALAEFLFDDETAMVRMDMSEYMEKHSVARLIGAPPGYVGYEEGGALTEAVRRRP
Tretra           KTELAKALAENLFDSEDHMVRIDMSEYMEKHTVSRLVGAPPGYVGYEEGGQLTEAVRRNP
                      * *:   *.    ::::**.*: : .:.::*.*:******:.:** *** **:.*

Physco           YTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGG
Ostreo           YTLVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRVVDFKNTLIIMTSNVGASAIEKGGG
Graci            YTVILFDEIEKAHPDIFNLLLQILEDGRLTDAKGRTIDFKNTLLIMTSNIGSKVIEKGGG
Porphy           YTVILFDEIEKAHPDIFNLLLQILEDGRLTDAKGRTIDFKNTLLIMTSNIGSKVIEKGGG
Prochlo          YTVVLFDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGG
ORF_QG23890      YTVVLFDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGG
Synecho          YTVVLFDEIEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLIIMTSNIGSKVIEKGGG
Anaba            YTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLILTSNIGSKVIEKGGG
Nostoc           YTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLILTSNIGSKVIEKGGG
Crocos           YTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLIMTSNIGSKVIEKGGG
Cyanot           YTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLIMTSNIGSKVIEKGGG
Micro            YTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLIMTSNIGSKVIEKGGG
Gloeo            YTVILFDEIEKAHPDVFNVLLQILEDGRLTDAKGRTVDFKNTLMIMTSNVGSKVIEKGGG
Acaryo           YTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLIMTSNIGSKVIEKGGG
Thermo           YTVVLFDEIEKAHPDVFNLLLQILEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGAA
Mycoba           FSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKPVG
Bactero          YSIVLLDEIEKAHPDVFNILLQVMDEGRLTDSYGRTVDFKNTIVIMTSNIGTRQLKEFGK
Lepto            YSIILLDEIEKAHHDIFNILLQIMEEGNLTDTKGRKVNFRDTIIIMTSNIGAKEIQAGGR
Chlamy           YAVILFDEVEKAHADVFNVLLQILDDGRVTDSQGRVVSFKNSIIILTSNLGSNSILELGT
Magneto          YQVILFDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIVLTSNLGSDILANQEE
Tretra           YTIILLDEIEKAHPDVFNILLQVLDDGRLTDSKGRVVNFKNTVLIMTSNIGSQILLEGVS
                 : ::*:**:**** :::* :**::::*.:**  ** :.*:::::::***:*:  :     

Physco           GIGFQL-DYGEKDSSYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKLEVKEIADIM
Ostreo           GLGFQL-DDNAEDQSYNRIKSLVMEDLKNYFRPEFLNRLDEIIVFRQLNKQEVREIAYIM
Graci            SLGFEL-GESQTESQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVREIAEIM
Porphy           SLGFEL-SEDQTESQYTRVRSLVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVREIAELM
Prochlo          GLGFEFSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKEIAEIM
ORF_QG23890      GLGFEFSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIM
Synecho          GLGFEFSGAAVEETQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLSRDEVKEIAEIM
Anaba            GIGFEF-SEDQTETQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLSKAEVTEIADIM
Nostoc           GIGFEF-SEDQTETQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLSKLEVTEIADIM
Crocos           GLGFEF-EDDQNEAQYNRIRNLVNEELKQYFRPEFLNRLDEIIVFRQLNKEEVKEISEIL
Cyanot           GLGFEF-EDDQNEAQYNRIRNLVNEELKQYFRPEFLNRLDEIIVFRQLNKEEVKEISEIL
Micro            GLGFEF-ADNQAEAQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLNKEEVKEIAEIL
Gloeo            GLGFNT-AGTEEEQRYNRISELVKEELKQYFRPEFLNRLDEIIVFHPLTREEVKQIAVIM
Acaryo           GLGFEF-AEDEADSQYNRIRSLVNEELKGYFRPEFLNRLDEIIVFRQLTKDEVKEISELL
Thermo           GLGFEFGTEDAAESQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVKQIADIL
Mycoba           LGFTQG----SGENDYERMKQKVNDELKKHFRPEFLNRIDDIIVFHQLSRDEIIRMVDLM
Bactero          GIGFAAQVRTDDKEYSRSV---ITKALNKSFAPEFINRLDEIITFDQLDLDALTRIIDIE
Lepto            LG--FEDRKDEALKYKSDQ---TRDQLKKYFNPEFLNRVDEVIYFGSLTKENIMSIIDIM
Chlamy           AAGDDAG----SPAARNAIKNIVMASVRSHFRPEFINRIDEFIIFDPLSQDQIAHIVRLQ
Magneto          GHDSGE------------VRDLVMEVVRASFRPEFLNRLDEILLFHRLGRAHMAGIVQIQ
Tretra           DQGEIS----------AETRSQVMNMLQAAFKPEFLNRIDDTIVFTPLNIEDMKGIVEKI
                                           :.  * ***:**:*: : *  *    :  :    

Physco           LKEVFERLKKKEIDLQVTERFRDRVVEEGYSPSYGARPLRRAIMRLLEDSMAERMLSGEI
Ostreo           LENVFKRLKEKEITLECTERFKDRLVDEGFSPAYGARPLRRAIMRLLEDNLSEKMLTGEI
Graci            LQEVFNRIKQQEIELEVTERFKNRLVDEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGKI
Porphy           LNEVFARIKQQDIQLNVTERFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGKI
Prochlo          LQEVFIRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRI
ORF_QG23890      LQEVFIRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRI
Synecho          LREVFGRMQEKGIGLSVTEAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEFLSGRL
Anaba            LKEVFGRLTEKGITLEVSDRFKGRLIEEGYSPSYGARPLRRAIMRLLEDSLAEEILSGRI
Nostoc           LKEVFGRLTEKGITLEVSDRFKGRLIEEGYSPSYGARPLRRAIMRLLEDSLAEEILSGRI
Crocos           LKEVFARLTEKEITLQVTDKFKERLVEEGYNPAYGARPLRRAIMRLLEDVLAEEILSGRV
Cyanot           LKEVFARLTEKEITLQVTDKFKERLVEEGYNPAYGARPLRRAIMRLLEDVLAEEILSGRV
Micro            LKDVFKRLTEQNITLSVTDKFKERLIEEGYNPAYGARPLRRAIMRLLEDVLAEEILSGRV
Gloeo            LREVFARLEEQNMKIEITDAFNRKLIEEGYSATYGARPLRRAIQRMLEDQLAEEILAARL
Acaryo           LKEVFSRLEEKSITLNITDRFKERLVEEGYNPSYGARPLRRAIMRLLEDTLAEEILSGRV
Thermo           LKEVFSRLTEKGITLEVTERFKERLIDEGYNPSYGARPLRRAIMRLLEDTLAEEMLSGRI
Mycoba           ISRVANQLKVKDMTLELTNKAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEV
Bactero          LKGLYSRVKNIGYKLVIDEDAKKFVATKGYDVQFGARPLKRAIQNNLEDGISELILGSEM
Lepto            VTDTNKRLHEKTIQISITQAAKNHIMDIGYDEKFGARPLRRVFQRELEDHMAVQTLKGAY
Chlamy           AKRVAERLADKKIGLDLTESAVRHLAAIGFDPVYGARPVKRAVQQELETSIAKAMLRGEF
Magneto          LARLRQLLVDRKIVLDLDDSANEWLAQKGYDPIYGARPLKRVIQRALQNPLAGLILEGRV
Tretra           IEELSQRLMQQEIFLEISDEAKAWIAQNAYEPAYGARPLRRYITREVETPLAKEIVSGRV
                        :      :   :     :   .:.   ****::* . . ::  ::   :    

Physco           KEGDSAIIDVDGDGNVTVLNGTTGTSSKTDIDVSPAGIA---------------------
Ostreo           SEGSSCIMDVNAEGEITVLTGDGRELKAGSAIGGPAGIA---------------------
Graci            KAGDSAVVDVTDEGKVTVLLGEQLEAIKQL------------------------------
Porphy           KAGDSPVVDVTNEGEVKVLLGEKLELLT--------------------------------
Prochlo          KDGDNALVDIDDNKKVTINISSEESSQELAGANF--------------------------
ORF_QG23890      KDGDNALVDIDDDKKVTINISSEESSQELAGANF--------------------------
Synecho          KDGDSALVDVNDEKQVVIRHQTVVAEPELAGASV--------------------------
Anaba            KDGDVALIDIDDNGNVQVTSQQRRELLPQGVES---------------------------
Nostoc           KDGDVALIDIDENGNVQVTSQQRRELLPQGVES---------------------------
Crocos           GEGDVAVVDIGEDGKVQVVSNEKQQPVLAKATDS--------------------------
Cyanot           GEGDIAVVDIGEDGKVKVVSG-DTQPVLAKATDS--------------------------
Micro            SDGDTAMVDIDEEGKVKVISGERRELIAPVIE----------------------------
Gloeo            KEGDTVLVDVDSDGKPTFIVKDRTLATAEG------------------------------
Acaryo           KEGDTAIVDVDEDQQVKIASAEKRELLPQAAE----------------------------
Thermo           REGDTALIDVDESGQVKIQAQPRRELLPQAVE----------------------------
Mycoba           GPGQVVTVDVDNWDGEGPGEDVKFTFTGIRKPSTEPDLAKAGVHSAGGPEPVEQ------
Bactero          AAGDTIKVSYDKEKDLIVMTVEK-------------------------------------
Lepto            KEPTKIEIDFKEGKLEFLETPWTDYKPVDPKTGGNDNSSGNPERSEEIALV---------
Chlamy           VEDDTIVVEAEPNGGGLVLRHGPKLSSSGNGSGGAGALAGSGGRSGSTGRSGGSGNWRQQ
Magneto          CDGAKVTVSAP---SGVLTINGQAVELT--------------------------------
Tretra           MPKTKVTIELLDN--HLVFQNEPMEEE---------------------------------
                        :.                                                   

Physco           -
Ostreo           -
Graci            -
Porphy           -
Prochlo          -
ORF_QG23890      -
Synecho          -
Anaba            -
Nostoc           -
Crocos           -
Cyanot           -
Micro            -
Gloeo            -
Acaryo           -
Thermo           -
Mycoba           -
Bactero          -
Lepto            -
Chlamy           A
Magneto          -
Tretra           -
                  








BLAST

PROTOCOLE
Outil: BlastP/Database:NR/Max target sequences:10000/Expect threshold:10/worlds size:3/Matrix:Blosum62
/Gaps coast: existance:11 extension 1

Sequences producing significant alignments:                       (Bits)  Value

ref|YP_001091419.1|  ClpC [Prochlorococcus marinus str. MIT 93...   541    2e-152 
ref|YP_001484425.1|  ClpC [Prochlorococcus marinus str. MIT 92...   537    3e-151 
ref|YP_001009585.1|  ClpC [Prochlorococcus marinus str. AS9601...   530    4e-149 
ref|YP_397594.1|  ATPase [Prochlorococcus marinus str. MIT 931...   530    6e-149 
ref|YP_001011493.1|  ClpC [Prochlorococcus marinus str. MIT 95...   522    1e-146 
ref|NP_893205.1|  ClpC [Prochlorococcus marinus subsp. pastori...   518    1e-145 
ref|NP_894892.1|  ClpC [Prochlorococcus marinus str. MIT 9313]...   486    5e-136 
ref|YP_001017005.1|  ClpC [Prochlorococcus marinus str. MIT 93...   481    2e-134 
ref|YP_001550983.1|  ClpC [Prochlorococcus marinus str. MIT 92...   481    2e-134 
ref|ZP_01086208.1|  endopeptidase Clp ATP-binding chain C [Syn...   478    2e-133
ref|ZP_01469736.1|  ATPase [Synechococcus sp. BL107] >gb|EAU70...   473    5e-132
ref|YP_377397.1|  ATPase [Synechococcus sp. CC9902] >gb|ABB263...   473    8e-132 
ref|YP_291854.1|  ATPase [Prochlorococcus marinus str. NATL2A]...   472    1e-131 
ref|YP_381931.1|  ATPase [Synechococcus sp. CC9605] >gb|ABB353...   472    1e-131 
ref|NP_875499.1|  ATPase with chaperone activity ATP-binding s...   471    3e-131 
ref|YP_001015314.1|  ClpC [Prochlorococcus marinus str. NATL1A...   471    3e-131 
ref|YP_730239.1|  putative Clp protease, ATP-binding subunit C...   468    2e-130 
ref|ZP_01080600.1|  endopeptidase Clp ATP-binding chain C [Syn...   463    4e-129
ref|YP_001225258.1|  ATP-dependent Clp protease ATP-binding su...   462    1e-128 
ref|ZP_01124422.1|  ATPase [Synechococcus sp. WH 7805] >gb|EAR...   459    7e-128
ref|NP_897031.1|  endopeptidase Clp ATP-binding chain C [Synec...   456    1e-126 
ref|YP_001516278.1|  ATP-dependent protease, ATP-binding subun...   451    2e-125 
ref|ZP_01620901.1|  ATP-dependent Clp protease regulatory subu...   447    2e-124
ref|YP_001227044.1|  ATP-dependent Clp protease ATP-binding su...   447    3e-124 
ref|ZP_01631992.1|  endopeptidase Clp ATP-binding chain [Nodul...   447    3e-124
ref|NP_681098.1|  ATP-dependent Clp protease regulatory subuni...   446    5e-124 
ref|YP_321429.1|  UvrB/UvrC protein [Anabaena variabilis ATCC ...   444    2e-123 
ref|ZP_00110397.1|  COG0542: ATPases with chaperone activity, ...   443    7e-123
ref|NP_487039.1|  endopeptidase Clp ATP-binding chain [Nostoc ...   442    1e-122 
ref|YP_722125.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   441    3e-122 
emb|CAO87778.1|  clpC [Microcystis aeruginosa PCC 7806]             440    5e-122
ref|YP_001660969.1|  ATP-dependent Clp protease ATPase subunit...   440    5e-122 
ref|ZP_01470307.1|  ATPase [Synechococcus sp. RS9916] >gb|EAU7...   439    1e-121
gb|AAB67745.1|  ClpC                                                438    2e-121
ref|YP_399279.1|  ATPase [Synechococcus elongatus PCC 7942] >g...   437    3e-121 
ref|YP_063564.1|  Clp protease ATP binding subunit [Gracilaria...   434    3e-120 
ref|NP_442112.1|  ATP-dependent Clp protease regulatory subuni...   434    4e-120 
ref|YP_537014.1|  Clp protease ATP binding subunit [Porphyra y...   429    9e-119 
ref|NP_045112.1|  Clp protease ATP binding subunit [Cyanidium ...   429    1e-118 
ref|NP_053942.1|  Clp protease ATP binding subunit [Porphyra p...   426    8e-118 
ref|XP_001766888.1|  predicted protein [Physcomitrella patens ...   424    2e-117 
ref|YP_722954.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   424    3e-117 
ref|XP_001756645.1|  predicted protein [Physcomitrella patens ...   424    4e-117 
ref|XP_001766010.1|  predicted protein [Physcomitrella patens ...   424    4e-117 
ref|ZP_00514408.1|  UvrB/UvrC protein:AAA ATPase, central regi...   422    9e-117
ref|XP_001779162.1|  predicted protein [Physcomitrella patens ...   421    3e-116 
ref|YP_476859.1|  Clp protease, ATP-binding subunit ClpC [Syne...   420    4e-116 
ref|YP_001805661.1|  ATP-dependent Clp protease, regulatory su...   420    4e-116 
ref|YP_474132.1|  Clp protease, ATP-binding subunit ClpC [Syne...   419    1e-115 
sp|P31541|CLPAA_LYCES  ATP-dependent Clp protease ATP-binding ...   418    2e-115
ref|ZP_01728203.1|  ATP-dependent Clp protease regulatory subu...   417    5e-115
gb|EAY82655.1|  hypothetical protein OsI_036614 [Oryza sativa ...   416    7e-115
ref|YP_171963.1|  ATP-dependent Clp protease regulatory subuni...   416    9e-115 
ref|NP_001066442.1|  Os12g0230100 [Oryza sativa (japonica cult...   414    2e-114 
ref|YP_001293474.1|  Clp protease ATP binding subunit [Rhodomo...   414    3e-114 
gb|EAZ30583.1|  hypothetical protein OsJ_014066 [Oryza sativa ...   414    3e-114
emb|CAE05148.2|  OSJNBa0039C07.4 [Oryza sativa (japonica culti...   414    4e-114
ref|NP_001052665.1|  Os04g0397100 [Oryza sativa (japonica cult...   414    5e-114 
sp|P35100|CLPC_PEA  ATP-dependent Clp protease ATP-binding sub...   413    7e-114
sp|P31542|CLPAB_LYCES  ATP-dependent Clp protease ATP-binding ...   412    1e-113
emb|CAN78847.1|  hypothetical protein [Vitis vinifera]              412    2e-113
ref|NP_568746.1|  CLPC (HEAT SHOCK PROTEIN 93-V); ATP binding ...   412    2e-113 
ref|NP_925010.1|  endopeptidase Clp ATP-binding chain [Gloeoba...   411    3e-113 
ref|ZP_01630543.1|  UvrB/UvrC protein [Nodularia spumigena CCY...   410    3e-113
ref|YP_277337.1|  Clp protease ATP binding subunit [Emiliania ...   410    4e-113 
ref|YP_001733411.1|  endopeptidase Clp, ATP-binding chain C, p...   410    6e-113 
ref|ZP_02942026.1|  ATPase AAA-2 domain protein [Cyanothece sp...   409    1e-112
ref|ZP_00108763.1|  COG0542: ATPases with chaperone activity, ...   408    2e-112
ref|NP_050661.1|  Clp protease ATP binding subunit [Guillardia...   407    6e-112 
gb|ABK95905.1|  unknown [Populus trichocarpa]                       405    2e-111
ref|NP_566912.1|  ATCLPC (CASEINOLYTIC PROTEASE C); ATP bindin...   405    2e-111 
ref|YP_324841.1|  UvrB/UvrC protein [Anabaena variabilis ATCC ...   405    2e-111 
gb|AAC04687.1|  ClpC [Arabidopsis thaliana]                         404    2e-111
dbj|BAA82062.1|  AtClpC [Arabidopsis thaliana]                      404    2e-111
ref|NP_486003.1|  endopeptidase Clp ATP-binding chain [Nostoc ...   404    4e-111 
sp|P46523|CLPA_BRANA  ATP-dependent Clp protease ATP-binding s...   399    1e-109
gb|EAZ20037.1|  hypothetical protein OsJ_034246 [Oryza sativa ...   397    4e-109
emb|CAL56865.1|  Chaperone HSP104 and related ATP-dependent Cl...   392    2e-107
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type [Ostr...   391    2e-107 
gb|AAD02267.1|  ClpC protease [Spinacia oleracea]                   391    3e-107
ref|ZP_02942253.1|  ATPase AAA-2 domain protein [Cyanothece sp...   389    1e-106
ref|ZP_01621575.1|  ATP-dependent Clp protease regulatory subu...   385    2e-105
emb|CAO89978.1|  unnamed protein product [Microcystis aerugino...   373    7e-102
ref|YP_001802418.1|  ATP-dependent Clp protease, regulatory su...   371    3e-101 
ref|NP_849021.1|  Clp protease ATP binding subunit [Cyanidiosc...   370    4e-101 
ref|ZP_00515365.1|  AAA ATPase, central region:Clp, N terminal...   369    1e-100
ref|YP_001657609.1|  ATP-dependent Clp protease ATPase subunit...   368    2e-100 
ref|ZP_01728226.1|  ATP-dependent Clp protease regulatory subu...   368    2e-100
emb|CAO68376.1|  unnamed protein product [Vitis vinifera]           361    3e-98 
ref|NP_001067671.1|  Os11g0267400 [Oryza sativa (japonica cult...   357    5e-97  
gb|EAY80574.1|  hypothetical protein OsI_034533 [Oryza sativa ...   356    7e-97 
gb|AAX96334.1|  Clp amino terminal domain, putative [Oryza sat...   356    7e-97 
ref|NP_924488.1|  endopeptidase Clp ATP-binding chain [Gloeoba...   348    3e-94  
ref|XP_001752142.1|  predicted protein [Physcomitrella patens ...   331    2e-89  
ref|NP_568750.1|  ERD1 (EARLY RESPONSIVE TO DEHYDRATION 1); AT...   320    6e-86  
gb|EAY80583.1|  hypothetical protein OsI_034542 [Oryza sativa ...   319    1e-85 
gb|AAX96447.1|  ATPase, AAA family, putative [Oryza sativa (ja...   318    2e-85 
gb|EAZ23275.1|  hypothetical protein OsJ_006758 [Oryza sativa ...   316    9e-85 
ref|NP_001046997.1|  Os02g0526400 [Oryza sativa (japonica cult...   316    1e-84  
gb|AAN78327.1|  ATP-dependent Clp protease ATP-binding subunit...   314    3e-84 
gb|EAY86098.1|  hypothetical protein OsI_007331 [Oryza sativa ...   314    3e-84 
ref|YP_001664347.1|  ATPase AAA-2 domain protein [Thermoanaero...   314    4e-84  
ref|YP_874483.1|  ATP-dependent clp protease ATP-binding subun...   314    5e-84  
ref|NP_043587.1|  Clp protease ATP binding subunit [Odontella ...   313    7e-84  
ref|NP_349786.1|  ATPase with chaperone activity clpC, two ATP...   312    2e-83  
ref|NP_623864.1|  ATPase with chaperone activity, ATP-binding ...   311    2e-83  
emb|CAH66527.1|  H0502B11.7 [Oryza sativa (indica cultivar-gro...   311    2e-83 
ref|XP_001757304.1|  predicted protein [Physcomitrella patens ...   309    1e-82  
ref|YP_076959.1|  class III stress response-related ATPase [Sy...   308    2e-82  
ref|YP_001210833.1|  ATPase with chaperone activity, ATP-bindi...   307    5e-82  
ref|YP_716806.1|  ATP-dependent protease, Hsp 100, part of mul...   307    6e-82  
ref|ZP_01173582.1|  class III stress response-related ATPase [...   307    6e-82 
gb|EAY93942.1|  hypothetical protein OsI_015175 [Oryza sativa ...   305    3e-81 
ref|ZP_01697194.1|  ATPase AAA-2 [Bacillus coagulans 36D1] >gb...   304    5e-81 
ref|YP_483458.1|  ATPase AAA-2 [Frankia sp. CcI3] >gb|ABD13729...   303    7e-81  
ref|YP_001244322.1|  ATPase AAA-2 domain protein [Thermotoga p...   303    7e-81  
ref|NP_228013.1|  ATP-dependent Clp protease, ATPase subunit [...   303    8e-81  
ref|YP_001738785.1|  ATPase AAA-2 domain protein [Thermotoga s...   303    1e-80  
ref|YP_429043.1|  ATPases with chaperone activity, ATP-binding...   303    1e-80  
ref|YP_001038203.1|  ATPase AAA-2 [Clostridium thermocellum AT...   303    1e-80  
ref|ZP_02915015.1|  ATPase AAA-2 domain protein [Geobacillus s...   302    1e-80 
ref|ZP_01861926.1|  ClpC [Bacillus sp. SG-1] >gb|EDL63014.1| C...   302    2e-80 
ref|YP_001738099.1|  ATPase AAA-2 domain protein [Thermotoga s...   302    2e-80  
ref|YP_144753.1|  ATP-dependent Clp protease, ATP-binding subu...   302    2e-80  
ref|YP_001243659.1|  ATPase AAA-2 domain protein [Thermotoga p...   302    2e-80  
ref|YP_005092.1|  endopeptidase clp ATP-binding chain B, clpB ...   301    2e-80  
ref|YP_001393599.1|  ClpC [Clostridium kluyveri DSM 555] >gb|E...   301    2e-80  
pdb|1QVR|A  Chain A, Crystal Structure Analysis Of Clpb >pdb|1...   301    2e-80  
ref|NP_783145.1|  negative regulator of genetic competence mec...   301    4e-80  
ref|YP_001504563.1|  ATPase AAA-2 domain protein [Frankia sp. ...   300    7e-80  
ref|ZP_01725571.1|  ATP-dependent Clp protease ATPase subunit ...   300    1e-79 
ref|ZP_01575093.1|  ATPase AAA-2 [Clostridium cellulolyticum H...   299    1e-79 
ref|NP_627581.1|  Clp-family ATP-binding protease [Streptomyce...   299    1e-79  
ref|YP_001679932.1|  clpc ATPase [Heliobacterium modesticaldum...   298    3e-79  
ref|YP_145931.1|  ATP-dependent Clp protease ATPase subunit [G...   298    3e-79  
ref|YP_001700223.1|  Negative regulator of genetic competence ...   298    4e-79  
ref|YP_001431315.1|  ATPase AAA-2 domain protein [Roseiflexus ...   297    6e-79  
gb|EAZ30636.1|  hypothetical protein OsJ_014119 [Oryza sativa ...   296    8e-79 
ref|YP_871980.1|  ATPase AAA-2 domain protein [Acidothermus ce...   296    8e-79  
ref|ZP_01667506.1|  ATPase AAA-2 domain protein [Thermosinus c...   296    1e-78 
ref|YP_644935.1|  ATPase AAA-2 [Rubrobacter xylanophilus DSM 9...   296    1e-78  
emb|CAN67541.1|  hypothetical protein [Vitis vinifera]              296    1e-78 
emb|CAO39512.1|  unnamed protein product [Vitis vinifera]           295    2e-78 
ref|NP_825874.1|  ATP-dependent Clp protease [Streptomyces ave...   295    2e-78  
ref|YP_001364062.1|  ATPase AAA-2 domain protein [Kineococcus ...   295    2e-78  
ref|YP_001360348.1|  ATPase AAA-2 domain protein [Kineococcus ...   295    2e-78  
ref|ZP_02079104.1|  hypothetical protein CLOLEP_00542 [Clostri...   295    2e-78 
ref|ZP_01190128.1|  UvrB/UvrC protein:ATPas [Halothermothrix o...   295    2e-78 
gb|EAY93993.1|  hypothetical protein OsI_015226 [Oryza sativa ...   295    3e-78 
ref|YP_877171.1|  Negative regulator of genetic competence clp...   295    3e-78  
ref|YP_001278364.1|  ATPase AAA-2 domain protein [Roseiflexus ...   294    4e-78  
ref|YP_001224471.1|  Chaperone ClpB [Synechococcus sp. WH 7803...   294    5e-78  
ref|YP_001322243.1|  ATPase AAA-2 domain protein [Alkaliphilus...   294    5e-78  
ref|YP_001161081.1|  ATPase AAA-2 domain protein [Salinispora ...   293    6e-78  
ref|YP_921695.1|  ATPase AAA-2 domain protein [Nocardioides sp...   293    6e-78  
ref|YP_001825630.1|  putative ATP-dependent Clp protease [Stre...   293    8e-78  
ref|YP_001470419.1|  ATPase AAA-2 domain protein [Thermotoga l...   293    8e-78  
ref|ZP_01516294.1|  ATPase AAA-2 [Chloroflexus aggregans DSM 9...   293    1e-77 
ref|YP_829669.1|  ATPase AAA-2 domain protein [Arthrobacter sp...   293    1e-77  
ref|YP_001305289.1|  ATPase AAA-2 domain protein [Thermosipho ...   293    1e-77  
gb|AAM94782.1|  CalR4 [Micromonospora echinospora]                  293    1e-77 
ref|YP_322848.1|  ATPase [Anabaena variabilis ATCC 29413] >gb|...   293    1e-77  
ref|YP_001539453.1|  ATPase AAA-2 domain protein [Salinispora ...   293    1e-77  
ref|YP_001227162.1|  Chaperone ClpB [Synechococcus sp. RCC307]...   292    1e-77  
ref|YP_001537044.1|  ATPase AAA-2 domain protein [Salinispora ...   292    1e-77  
ref|YP_755027.1|  ATPases with chaperone activity, ATP-binding...   292    2e-77  
gb|AAB09631.1|  ClpB                                                292    2e-77 
ref|XP_001418921.1|  chaperone, Hsp100 family, ClpC-type [Ostr...   292    2e-77  
ref|YP_171170.1|  ClpB protein [Synechococcus elongatus PCC 63...   292    2e-77  
ref|ZP_02203885.1|  ATPase AAA-2 domain protein [Dehalococcoid...   292    2e-77 
ref|YP_400106.1|  ATPase [Synechococcus elongatus PCC 7942] >g...   292    2e-77  
ref|YP_001516454.1|  chaperone ClpB [Acaryochloris marina MBIC...   291    2e-77  
ref|ZP_01575297.1|  ATPase AAA-2 [Clostridium cellulolyticum H...   291    2e-77 
sp|P53533.3|CLPB1_SYNP7  Chaperone protein clpB 1                   291    2e-77 
ref|YP_945989.1|  putative ATP-dependent Clp protease, ATP-bin...   291    2e-77  
ref|ZP_01305507.1|  ATPase with chaperone activity, ATP-bindin...   291    3e-77 
ref|YP_001255992.1|  negative regulator of genetic competence ...   291    3e-77  
ref|YP_516671.1|  hypothetical protein DSY0438 [Desulfitobacte...   291    3e-77  
ref|NP_240969.1|  class III stress response-related ATPase [Ba...   291    3e-77  
emb|CAJ71743.1|  strongly similar to ATP-dependent protease Cl...   291    3e-77 
ref|ZP_02613465.1|  negative regulator of genetic competence M...   291    3e-77 
ref|YP_001320631.1|  ATPase AAA-2 domain protein [Alkaliphilus...   291    3e-77  
ref|YP_001783151.1|  negative regulator of genetic competence ...   291    3e-77  
ref|ZP_02082908.1|  hypothetical protein CLOBOL_00423 [Clostri...   291    3e-77 
emb|CAH60133.1|  putative Clp-family ATP-binding protease [Str...   291    3e-77 
ref|ZP_02836657.1|  ATPase AAA-2 domain protein [Arthrobacter ...   291    4e-77 
ref|YP_180810.1|  ATP-dependent Clp protease, ATP-binding subu...   291    4e-77  
ref|YP_001392864.1|  negative regulator of genetic competence ...   291    4e-77  
ref|YP_001512014.1|  ATPase AAA-2 domain protein [Alkaliphilus...   291    5e-77  
ref|YP_001124210.1|  Negative regulator of genetic competence ...   290    5e-77  
ref|YP_290932.1|  ATPase [Thermobifida fusca YX] >gb|AAZ56909....   290    5e-77  
ref|YP_001432122.1|  ATPase AAA-2 domain protein [Roseiflexus ...   290    6e-77  
ref|YP_001181136.1|  ATPase AAA-2 domain protein [Caldicellulo...   290    6e-77  
ref|YP_001276071.1|  ATPase AAA-2 domain protein [Roseiflexus ...   290    6e-77  
ref|ZP_01125074.1|  ATP-dependent Clp protease, Hsp 100, ATP-b...   290    6e-77 
ref|YP_320409.1|  ATPase [Anabaena variabilis ATCC 29413] >gb|...   290    6e-77  
ref|ZP_00110302.1|  COG0542: ATPases with chaperone activity, ...   290    6e-77 
ref|YP_001716377.1|  ATPase AAA-2 domain protein [Candidatus D...   290    8e-77  
ref|YP_001511700.1|  ATPase AAA-2 domain protein [Alkaliphilus...   290    8e-77  
ref|YP_001788851.1|  negative regulator of genetic competence ...   290    9e-77  
ref|NP_823776.1|  ATP-dependent Clp protease [Streptomyces ave...   290    1e-76  
ref|YP_001111554.1|  ATPase AAA-2 domain protein [Desulfotomac...   289    1e-76  
ref|YP_077372.1|  class III stress response-related ATPase [Ba...   289    1e-76  
ref|ZP_01515558.1|  ATPase AAA-2 [Chloroflexus aggregans DSM 9...   289    1e-76 
ref|YP_821800.1|  ATPase AAA-2 domain protein [Solibacter usit...   289    2e-76  
ref|ZP_02523691.1|  ClpB protein [Bacillus cereus AH1134]           288    2e-76 
ref|ZP_01620684.1|  ATPase [Lyngbya sp. PCC 8106] >gb|EAW37383...   288    2e-76 
ref|YP_361153.1|  negative regulator of genetic competence clp...   288    2e-76  
ref|YP_307248.1|  ATP-dependent Clp protease, ATP-binding subu...   288    3e-76  
ref|YP_001213521.1|  ATPase AAA-2 domain protein [Dehalococcoi...   288    3e-76  
ref|NP_763842.1|  endopeptidase [Staphylococcus epidermidis AT...   288    3e-76  
ref|YP_035409.1|  ATP-dependent Clp protease, ATP-binding subu...   288    3e-76  
sp|Q8YM56.2|CLPB2_ANASP  Chaperone protein clpB 2                   288    3e-76 
ref|YP_001643954.1|  ATPase AAA-2 domain protein [Bacillus wei...   288    3e-76  
emb|CAE05369.1|  OJ000315_02.14 [Oryza sativa (japonica cultiv...   288    3e-76 
ref|ZP_02616497.1|  negative regulator of genetic competence M...   288    3e-76 
ref|YP_823607.1|  ATPase AAA-2 domain protein [Solibacter usit...   288    4e-76  
ref|NP_830954.1|  ClpB protein [Bacillus cereus ATCC 14579] >r...   288    4e-76  
ref|ZP_02622342.1|  negative regulator of genetic competence C...   287    4e-76 
ref|ZP_01129430.1|  ATP-dependent Clp protease, ATP-binding su...   287    4e-76 
ref|NP_489124.1|  endopeptidase Clp ATP-binding chain B [Nosto...   287    5e-76  
ref|YP_254399.1|  endopeptidas Clp ATP-binding chain C [Staphy...   287    5e-76  
gb|AAF78058.1|AF263561_3  ClpB protease [secondary endosymbion...   287    5e-76 
ref|ZP_01965947.1|  hypothetical protein RUMOBE_03696 [Ruminoc...   287    6e-76 
ref|YP_001636069.1|  ATPase AAA-2 domain protein [Chloroflexus...   287    6e-76  
ref|ZP_02588012.1|  ATP-dependent Clp protease, ATP-binding su...   287    6e-76 
ref|YP_001485331.1|  class III stress response-related ATPase ...   287    6e-76  
ref|YP_893902.1|  ATP-dependent Clp protease, ATP-binding subu...   287    6e-76  
ref|ZP_02584896.1|  ClpB protein [Bacillus cereus G9842]            287    6e-76 
ref|NP_387967.1|  class III stress response-related ATPase [Ba...   286    7e-76  
emb|CAL54481.1|  AAA ATPase, central region:Clp, N terminal:C ...   286    8e-76 
ref|ZP_02253019.1|  ATP-dependent Clp protease, ATP-binding su...   286    8e-76 
ref|ZP_00239072.1|  ATP-dependent Clp protease, ATP-binding su...   286    8e-76 
ref|YP_001419765.1|  ClpC [Bacillus amyloliquefaciens FZB42] >...   286    8e-76  
ref|ZP_02853989.1|  ATPase AAA-2 domain protein [Natranaerobiu...   286    9e-76 
ref|YP_001373446.1|  ATPase AAA-2 domain protein [Bacillus cer...   286    9e-76  
ref|YP_001086489.1|  ATP-dependent Clp protease [Clostridium d...   286    1e-75  
emb|CAO49088.1|  unnamed protein product [Vitis vinifera]           286    1e-75 
ref|YP_001342446.1|  ATPase AAA-2 domain protein [Marinomonas ...   286    1e-75  
ref|ZP_02598552.1|  ATP-dependent Clp protease, ATP-binding su...   286    1e-75 
ref|YP_302321.1|  putative stress response-related Clp ATPase ...   286    1e-75  
ref|ZP_02850353.1|  ATPase AAA-2 domain protein [Paenibacillus...   286    1e-75 
ref|ZP_00378894.1|  COG0542: ATPases with chaperone activity, ...   286    1e-75 
ref|ZP_02044158.1|  hypothetical protein ACTODO_01017 [Actinom...   286    1e-75 
ref|YP_001036743.1|  ATPase AAA-2 [Clostridium thermocellum AT...   286    1e-75  
ref|ZP_00517435.1|  AAA ATPase, central region:Clp, N terminal...   286    1e-75 
ref|ZP_00996068.1|  putative ATP-dependent Clp protease [Janib...   285    2e-75 
ref|NP_682179.1|  ClpB protein [Thermosynechococcus elongatus ...   285    2e-75  
ref|ZP_02394435.1|  ATP-dependent Clp protease, ATP-binding su...   285    2e-75 
ref|YP_001642973.1|  ATPase AAA-2 domain protein [Bacillus wei...   285    2e-75  
ref|ZP_02542979.1|  ATP-dependent Clp protease, ATP-binding su...   285    2e-75 
ref|ZP_02171825.1|  ribosomal protein S8 [Bacillus selenitired...   285    2e-75 
sp|Q9RVI3.2|CLPB_DEIRA  Chaperone protein clpB                      285    2e-75 
ref|NP_843655.1|  ATP-dependent Clp protease, ATP-binding subu...   285    2e-75  
ref|YP_473669.1|  ATP-dependent chaperone protein ClpB [Synech...   285    2e-75  
ref|NP_829983.1|  Negative regulator of genetic competence clp...   285    2e-75  
ref|YP_082667.1|  ATP-dependent Clp protease, ATP-binding subu...   285    3e-75  
ref|ZP_02761183.1|  AAA family ATP-binding protein [Staphyloco...   285    3e-75 
ref|ZP_02587806.1|  negative regulator of genetic competence c...   285    3e-75 
ref|NP_294770.1|  ATP-dependent Clp protease, ATP-binding subu...   285    3e-75  
ref|YP_415973.1|  endopeptidase [Staphylococcus aureus RF122] ...   285    3e-75  
ref|NP_842649.1|  negative regulator of genetic competence Clp...   285    3e-75  
ref|ZP_02733892.1|  ATPase AAA-2 domain protein [Gemmata obscu...   285    3e-75 
ref|NP_371049.1|  endopeptidase [Staphylococcus aureus subsp. ...   285    3e-75  
ref|ZP_01079874.1|  ATP-dependent Clp protease, Hsp 100, ATP-b...   285    3e-75 
ref|ZP_00740659.1|  Negative regulator of genetic competence c...   285    3e-75 
ref|ZP_00531871.1|  UvrB/UvrC protein:AAA ATPase, central regi...   285    3e-75 
ref|ZP_02025949.1|  hypothetical protein EUBVEN_01205 [Eubacte...   284    4e-75 
ref|ZP_02258254.1|  ATP-dependent Clp protease, ATP-binding su...   284    4e-75 
ref|YP_081693.1|  negative regulator of genetic competence clp...   284    4e-75  
ref|NP_977608.1|  ATP-dependent Clp protease, ATP-binding subu...   284    4e-75  
ref|ZP_02581871.1|  Negative regulator of genetic competence c...   284    4e-75 
ref|ZP_00105864.1|  COG0542: ATPases with chaperone activity, ...   284    4e-75 
ref|YP_001803357.1|  ATP-dependent Clp protease, ATP-binding s...   284    4e-75  
ref|YP_604676.1|  ATPase AAA-2 [Deinococcus geothermalis DSM 1...   284    5e-75  
ref|YP_317208.1|  AAA ATPase [Nitrobacter winogradskyi Nb-255]...   284    5e-75  
ref|YP_062934.1|  ATP-dependent Clp protease, ATP-binding subu...   283    6e-75  
ref|YP_576028.1|  ATPase AAA-2 [Nitrobacter hamburgensis X14] ...   283    7e-75  
gb|ACB43274.1|  ATPase [Paulinella chromatophora]                   283    8e-75 
ref|NP_951715.1|  ClpB protein [Geobacter sulfurreducens PCA] ...   283    9e-75  
ref|YP_478720.1|  ATP-dependent chaperone protein ClpB [Synech...   283    1e-74  
ref|ZP_02204216.1|  ATPase AAA-2 domain protein [Dehalococcoid...   283    1e-74 
ref|YP_381320.1|  ATPase [Synechococcus sp. CC9605] >gb|ABB347...   283    1e-74  
ref|YP_182121.1|  chaperone ClpB [Dehalococcoides ethenogenes ...   283    1e-74  
ref|ZP_01727975.1|  ClpB protein [Cyanothece sp. CCY0110] >gb|...   283    1e-74 
sp|Q7U637.2|CLPB1_SYNPX  Chaperone protein clpB 1                   283    1e-74 
sp|O87444.2|CLPB_PLEBO  Chaperone protein clpB                      282    1e-74 
ref|YP_001708900.1|  putative Clp-family ATP-binding protease ...   282    1e-74  
ref|ZP_01086068.1|  ATPase [Synechococcus sp. WH 5701] >gb|EAQ...   282    1e-74 
ref|YP_001543282.1|  ATPase AAA-2 domain protein [Herpetosipho...   282    2e-74  
gb|AAC62621.1|  heat shock protein [Plectonema boryanum]            282    2e-74 
ref|ZP_01468117.1|  ATPase [Synechococcus sp. BL107] >gb|EAU72...   282    2e-74 
ref|ZP_02174263.1|  ATP-dependent chaperone ClpB [Anaeromyxoba...   282    2e-74 
ref|ZP_01289463.1|  AAA ATPase, central region:Clp, N terminal...   282    2e-74 
ref|NP_897596.1|  endopeptidase Clp ATP-binding chain B [Synec...   282    2e-74  
ref|YP_463598.1|  AAA ATPase, ClpA/B [Anaeromyxobacter dehalog...   282    2e-74  
ref|ZP_01236186.1|  putative clpB, ATPase with chaperone activ...   282    2e-74 
ref|ZP_02037068.1|  hypothetical protein BACCAP_02681 [Bactero...   282    2e-74 
ref|ZP_02322675.1|  ATP-dependent chaperone ClpB [Anaeromyxoba...   282    2e-74 
sp|Q8PHQ4.2|CLPB_XANAC  Chaperone protein clpB                      281    3e-74 
ref|ZP_02943618.1|  ATPase AAA-2 domain protein [Micrococcus l...   281    3e-74 
ref|NP_643503.1|  ATP-dependent Clp protease subunit [Xanthomo...   281    3e-74  
ref|YP_001733697.1|  endopeptidase Clp ATP-binding chain B [Sy...   281    3e-74  
ref|YP_001812572.1|  ATPase AAA-2 domain protein [Exiguobacter...   281    4e-74  
ref|YP_643087.1|  ATPase AAA-2 [Rubrobacter xylanophilus DSM 9...   281    4e-74  
ref|ZP_02926068.1|  negative regulator of genetic competence C...   281    4e-74 
ref|YP_344369.1|  ATP-dependent Clp protease [Nitrosococcus oc...   281    4e-74  
ref|YP_314573.1|  ClpB protein [Thiobacillus denitrificans ATC...   281    4e-74  
ref|ZP_02031757.1|  hypothetical protein PARMER_01762 [Parabac...   281    4e-74 
ref|ZP_02938601.1|  ATPase AAA-2 domain protein [Sulfurihydrog...   281    4e-74 
ref|YP_146652.1|  ATP-dependent Clp protease ATP-binding subun...   281    5e-74  
ref|YP_001017839.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   280    5e-74  
ref|YP_308336.1|  ATP-dependent Clp protease, ATP-binding subu...   280    5e-74  
ref|ZP_02177451.1|  ATPase subunit of ATP-dependent protease [...   280    5e-74 
ref|NP_691014.1|  ATP-dependent Clp protease [Oceanobacillus i...   280    5e-74  
ref|YP_001739465.1|  ATPase AAA-2 domain protein [Thermotoga s...   280    5e-74  
ref|YP_001214677.1|  ATPase AAA-2 domain protein [Dehalococcoi...   280    5e-74  
ref|YP_001626326.1|  hemolysin [Renibacterium salmoninarum ATC...   280    6e-74  
ref|NP_784715.1|  ATP-dependent Clp protease, ATP-binding subu...   280    6e-74  
ref|ZP_01628353.1|  ATPase [Nodularia spumigena CCY9414] >gb|E...   280    6e-74 
ref|YP_001567428.1|  ATPase AAA-2 domain protein [Petrotoga mo...   280    7e-74  
ref|NP_645297.1|  endopeptidase [Staphylococcus aureus subsp. ...   280    7e-74  
ref|YP_001409886.1|  ATPase AAA-2 domain protein [Fervidobacte...   280    7e-74  
ref|YP_743388.1|  ATPase AAA-2 domain protein [Alkalilimnicola...   280    7e-74  
ref|YP_001589554.1|  hypothetical protein SPAB_03370 [Salmonel...   280    7e-74  
ref|YP_001177787.1|  protein disaggregation chaperone [Enterob...   280    8e-74  
ref|NP_457131.1|  protein disaggregation chaperone [Salmonella...   280    8e-74  
ref|YP_151702.1|  protein disaggregation chaperone [Salmonella...   280    8e-74  
ref|YP_045961.1|  ATP-dependent protease, Hsp 100, part of mul...   280    8e-74  
ref|YP_001568646.1|  ATPase AAA-2 domain protein [Petrotoga mo...   280    8e-74  
ref|YP_958163.1|  ATPase AAA-2 domain protein [Marinobacter aq...   280    9e-74  
ref|ZP_02342566.1|  protein disaggregation chaperone [Salmonel...   280    9e-74 
ref|ZP_02186039.1|  ATP-dependent Clp protease, ATP-binding su...   280    9e-74 
gb|AAW49584.1|  ClpC [Bifidobacterium breve]                        280    1e-73 
ref|NP_229192.1|  ATP-dependent Clp protease, ATPase subunit [...   280    1e-73  
ref|ZP_00109994.1|  COG0542: ATPases with chaperone activity, ...   280    1e-73 
ref|NP_926523.1|  endopeptidase Clp ATP-binding chain B [Gloeo...   280    1e-73  
ref|YP_365055.1|  ATP-dependent Clp protease subunit [Xanthomo...   280    1e-73  
ref|YP_001221597.1|  ATP-dependent protease, ATPase subunit [C...   280    1e-73  
ref|YP_001436781.1|  hypothetical protein ESA_00662 [Enterobac...   279    1e-73  
ref|NP_739139.1|  putative endopeptidase Clp ATP-binding chain...   279    1e-73  
ref|ZP_02642441.1|  clpB protein [Clostridium perfringens NCTC...   279    1e-73 
emb|CAO80239.1|  protein disaggregation chaperone [Candidatus ...   279    1e-73 
ref|YP_001431053.1|  ATPase AAA-2 domain protein [Roseiflexus ...   279    1e-73  
gb|AAL47016.1|AF449501_1  ClpB ATP protease [Paracoccidioides ...   279    1e-73 
ref|NP_661097.1|  ATP-dependent Clp protease, ATP-binding subu...   279    1e-73  
ref|ZP_02433789.1|  hypothetical protein CLOSCI_04074 [Clostri...   279    1e-73 
ref|YP_250069.1|  ATP-dependent Clp protease [Corynebacterium ...   279    1e-73  
ref|YP_783241.1|  ATPase AAA-2 domain protein [Rhodopseudomona...   279    1e-73  
ref|YP_001374215.1|  ATPase AAA-2 domain protein [Bacillus cer...   279    1e-73  
ref|YP_692199.1|  ATP-dependent Clp protease, ATP-binding subu...   279    2e-73  
ref|YP_173625.1|  ATP-dependent Clp protease ATP-binding subun...   279    2e-73  
ref|NP_768044.1|  ATP-dependent protease ATP-binding subunit [...   279    2e-73  
ref|YP_436994.1|  ATPase with chaperone activity, ATP-binding ...   279    2e-73  
ref|YP_001634655.1|  ATPase AAA-2 domain protein [Chloroflexus...   279    2e-73  
ref|ZP_02348128.1|  protein disaggregation chaperone [Salmonel...   279    2e-73 
ref|YP_541912.1|  protein disaggregation chaperone [Escherichi...   279    2e-73  
ref|YP_375817.1|  ATPase [Pelodictyon luteolum DSM 273] >gb|AB...   279    2e-73  
ref|YP_001279778.1|  ATPase AAA-2 domain protein [Psychrobacte...   278    2e-73  
ref|ZP_01161478.1|  putative clpB, ATPase with chaperone activ...   278    2e-73 
ref|ZP_01776855.1|  ATPase AAA-2 domain protein [Geobacter bem...   278    2e-73 
ref|ZP_02478978.1|  chaperone ClpB [Haemophilus parasuis 29755...   278    2e-73 
ref|ZP_02640067.1|  clpB protein [Clostridium perfringens CPE ...   278    2e-73 
ref|ZP_02632338.1|  clpB protein [Clostridium perfringens E st...   278    2e-73 
ref|YP_001477120.1|  ATPase AAA-2 domain protein [Serratia pro...   278    2e-73  
ref|NP_289147.1|  protein disaggregation chaperone [Escherichi...   278    2e-73  
ref|ZP_00121578.1|  COG0542: ATPases with chaperone activity, ...   278    2e-73 
gb|AAA24422.1|  ATP-dependent protease binding subunit [Escher...   278    2e-73 
ref|NP_695241.1|  protease [Bifidobacterium longum NCC2705] >g...   278    2e-73  
ref|NP_838164.1|  protein disaggregation chaperone [Shigella f...   278    3e-73  
ref|NP_311482.1|  protein disaggregation chaperone [Escherichi...   278    3e-73  
ref|ZP_02913318.1|  ATP-dependent chaperone ClpB [Geobacillus ...   278    3e-73 
ref|ZP_02569430.1|  protein disaggregation chaperone [Salmonel...   278    3e-73 
ref|ZP_01472677.1|  ATP-dependent Clp protease, Hsp 100, ATP-b...   278    3e-73 
ref|YP_376921.1|  ATPase [Synechococcus sp. CC9902] >gb|ABB258...   278    3e-73  
ref|YP_124032.1|  endopeptidase Clp ATP-binding chain B (ClpB)...   278    3e-73  
ref|YP_404365.1|  protein disaggregation chaperone [Shigella d...   278    3e-73  
ref|ZP_02076146.1|  hypothetical protein CLOL250_02934 [Clostr...   278    3e-73 
gb|AAX52926.1|  ClpC [Bifidobacterium animalis subsp. animalis]     278    3e-73 
ref|YP_731101.1|  ATP-dependent Clp protease, Hsp 100, ATP-bin...   278    3e-73  
ref|YP_127052.1|  endopeptidase Clp ATP-binding chain B (ClpB)...   278    3e-73  
ref|ZP_02138193.1|  ClpB protein [Vibrio fischeri MJ11] >gb|ED...   278    3e-73 
ref|ZP_02212288.1|  hypothetical protein CLOBAR_01905 [Clostri...   278    3e-73 
ref|NP_867440.1|  negative regulator of genetic competence Clp...   278    3e-73  
ref|NP_708444.2|  protein disaggregation chaperone [Shigella f...   278    3e-73  
ref|YP_001131092.1|  ATPase AAA-2 domain protein [Prosthecochl...   278    3e-73  
ref|ZP_01078133.1|  endopeptidase Clp ATP-binding chain B (Clp...   278    3e-73 
ref|ZP_01104746.1|  Chaperone clpB [gamma proteobacterium KT 7...   278    3e-73 
ref|ZP_01042083.1|  ATP-binding subunit of Clp protease and Dn...   278    3e-73 
ref|NP_213889.1|  ATP-dependent Clp protease [Aquifex aeolicus...   278    3e-73  
ref|YP_001244982.1|  ATPase AAA-2 domain protein [Thermotoga p...   278    3e-73  
ref|YP_203949.1|  protein disaggregation chaperone [Vibrio fis...   278    3e-73  
ref|YP_051434.1|  protein disaggregation chaperone [Erwinia ca...   278    4e-73  
ref|NP_562344.1|  clpB protein [Clostridium perfringens str. 1...   277    4e-73  
ref|ZP_01118020.1|  ATP-dependent Clp protease, ATP-binding su...   277    4e-73 
ref|NP_894282.1|  ATP-dependent Clp protease, Hsp 100, ATP-bin...   277    4e-73  
ref|ZP_00831746.1|  COG0542: ATPases with chaperone activity, ...   277    4e-73 
ref|YP_001105585.1|  clp protease ATP binding subunit [Sacchar...   277    4e-73  
ref|YP_001250501.1|  endopeptidase Clp ATP-binding chain B (Cl...   277    5e-73  
ref|YP_001237345.1|  Chaperone [Bradyrhizobium sp. BTAi1] >gb|...   277    5e-73  
ref|ZP_02442811.1|  hypothetical protein ANACOL_02104 [Anaerot...   277    5e-73 
ref|YP_001560905.1|  ATP-dependent chaperone ClpB [Clostridium...   277    5e-73  
ref|ZP_01629538.1|  ATPase [Nodularia spumigena CCY9414] >gb|E...   277    5e-73 
ref|YP_095776.1|  ClpB protein [Legionella pneumophila subsp. ...   277    5e-73  
ref|YP_001336551.1|  ATP-dependent protease, Hsp 100 [Klebsiel...   277    6e-73  
ref|YP_698735.1|  clpB protein [Clostridium perfringens SM101]...   277    6e-73  
ref|YP_001084218.1|  ATP-dependent protease Hsp 100 [Acinetoba...   277    6e-73  
ref|YP_001455423.1|  hypothetical protein CKO_03914 [Citrobact...   277    6e-73  
ref|YP_001560551.1|  ATPase AAA-2 domain protein [Clostridium ...   277    6e-73  
ref|YP_001569353.1|  hypothetical protein SARI_00266 [Salmonel...   277    6e-73  
ref|YP_864080.1|  ATPase AAA-2 domain protein [Magnetococcus s...   277    6e-73  
ref|YP_388153.1|  ATPase [Desulfovibrio desulfuricans G20] >gb...   277    6e-73  
ref|ZP_02900339.1|  ATP-dependent chaperone protein ClpB [Esch...   277    7e-73 
ref|ZP_02946730.1|  ATP-dependent chaperone ClpB [Methylocella...   277    7e-73 
ref|ZP_01965484.1|  hypothetical protein RUMOBE_03223 [Ruminoc...   277    7e-73 
ref|YP_720466.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   277    7e-73  
ref|ZP_00698260.1|  COG0542: ATPases with chaperone activity, ...   277    7e-73 
ref|ZP_02061227.1|  ATPase AAA-2 domain protein [Hydrogenobacu...   276    7e-73 
ref|NP_638417.1|  ATP-dependent Clp protease subunit [Xanthomo...   276    7e-73  
ref|YP_054994.1|  putative Clp-family ATP-binding protease [Pr...   276    7e-73  
ref|ZP_01166492.1|  ClpB protein [Oceanospirillum sp. MED92] >...   276    7e-73 
ref|YP_001714398.1|  ATP-dependent protease, Hsp 100, part of ...   276    8e-73  
ref|YP_001735586.1|  endopeptidase Clp ATP-binding chain B1 [S...   276    8e-73  
sp|Q6LMY0.2|CLPB_PHOPR  Chaperone protein clpB                      276    8e-73 
ref|YP_001124803.1|  ATP-dependent Clp protease, ATP-binding s...   276    8e-73  
ref|YP_001278585.1|  ATPase AAA-2 domain protein [Roseiflexus ...   276    8e-73  
ref|YP_001208279.1|  Chaperone [Bradyrhizobium sp. ORS278] >em...   276    9e-73  
ref|ZP_02028458.1|  hypothetical protein BIFADO_00889 [Bifidob...   276    9e-73 
ref|ZP_02954205.1|  clpB protein [Clostridium perfringens D st...   276    9e-73 
ref|ZP_02178006.1|  ATP-dependent Clp protease [Hydrogenivirga...   276    9e-73 
ref|YP_425844.1|  Chaperone clpB [Rhodospirillum rubrum ATCC 1...   276    9e-73  
ref|ZP_02919135.1|  hypothetical protein BIFDEN_02459 [Bifidob...   276    1e-72 
ref|YP_001232674.1|  ATPase AAA-2 domain protein [Geobacter ur...   276    1e-72  
ref|ZP_01450383.1|  ATP-binding subunit of Clp protease and Dn...   276    1e-72 
ref|YP_131148.1|  putative clpB, ATPase with chaperone activit...   276    1e-72  
ref|ZP_02061812.1|  ATP-dependent chaperone ClpB [Rickettsiell...   276    1e-72 
ref|NP_486362.1|  endopeptidase Clp ATP-binding chain [Nostoc ...   276    1e-72  
ref|YP_909436.1|  probable ATP-dependent Clp protease ATP-bind...   276    1e-72  
ref|ZP_02942237.1|  ATP-dependent chaperone ClpB [Cyanothece s...   276    1e-72 
ref|YP_001706899.1|  ATP-dependent protease, Hsp 100, part of ...   276    1e-72  
ref|YP_001005234.1|  protein disaggregation chaperone [Yersini...   276    1e-72  
ref|NP_218511.1|  ATP-dependent Clp protease subunit B (clpB) ...   276    1e-72  
emb|CAO86645.1|  unnamed protein product [Microcystis aerugino...   276    1e-72 
ref|ZP_02866157.1|  clpB protein [Clostridium perfringens C st...   276    1e-72 
ref|YP_878374.1|  clpB protein [Clostridium novyi NT] >gb|ABK6...   276    1e-72  
ref|YP_001140185.1|  chaperone clpB [Aeromonas salmonicida sub...   276    1e-72  
ref|YP_696119.1|  clpB protein [Clostridium perfringens ATCC 1...   276    1e-72  
ref|ZP_01111900.1|  ClpB protein [Alteromonas macleodii 'Deep ...   276    1e-72 
ref|ZP_00588906.1|  UvrB/UvrC protein:AAA ATPase, central regi...   276    1e-72 
ref|ZP_00824294.1|  COG0542: ATPases with chaperone activity, ...   276    1e-72 
ref|YP_001819559.1|  ATPase AAA-2 domain protein [Opitutus ter...   276    1e-72  
ref|ZP_01737644.1|  ATPase with chaperone activity, ATP-bindin...   276    2e-72 
ref|YP_001234944.1|  ATPase AAA-2 domain protein [Acidiphilium...   275    2e-72  
ref|YP_001527116.1|  AAA ATPase [Azorhizobium caulinodans ORS ...   275    2e-72  
ref|ZP_01645430.1|  ATPase AAA-2 [Stenotrophomonas maltophilia...   275    2e-72 
ref|ZP_01106314.1|  ATP-dependent Clp protease, ATP-binding su...   275    2e-72 
ref|YP_795806.1|  ATP-binding subunit of Clp protease and DnaK...   275    2e-72  
ref|ZP_01044555.1|  AAA ATPase [Nitrobacter sp. Nb-311A] >gb|E...   275    2e-72 
ref|NP_214154.1|  ATPase subunit of ATP-dependent protease [Aq...   275    2e-72  
ref|ZP_01385923.1|  UvrB/UvrC protein:AAA ATPase, central regi...   275    2e-72 
ref|ZP_00591961.1|  UvrB/UvrC protein:AAA ATPase, central regi...   275    2e-72 
ref|YP_001180831.1|  ATPase AAA-2 domain protein [Caldicellulo...   275    2e-72  
ref|YP_571215.1|  ATPase AAA-2 [Rhodopseudomonas palustris Bis...   275    2e-72  
ref|ZP_01895497.1|  ATPase with chaperone activity, ATP-bindin...   275    2e-72 
ref|NP_816879.1|  ATP-dependent Clp protease, ATP-binding subu...   275    2e-72  
ref|NP_406745.1|  protein disaggregation chaperone [Yersinia p...   275    2e-72  
ref|NP_668245.1|  protein disaggregation chaperone [Yersinia p...   275    2e-72  
ref|YP_001542808.1|  ATPase AAA-2 domain protein [Herpetosipho...   275    2e-72  
ref|YP_069389.1|  protein disaggregation chaperone [Yersinia p...   275    3e-72  
ref|YP_001212672.1|  ATPase with chaperone activity, ATP-bindi...   275    3e-72  
gb|EAY58132.1|  ATPase with chaperone activity, ATP-binding su...   275    3e-72 
ref|ZP_02000531.1|  ClpB protein [Beggiatoa sp. PS] >gb|EDN694...   275    3e-72 
ref|YP_807695.1|  ATP-binding subunit of Clp protease and DnaK...   275    3e-72  
ref|ZP_00155856.2|  COG0542: ATPases with chaperone activity, ...   275    3e-72 
ref|ZP_01787963.1|  DNA polymerase I [Haemophilus influenzae 3...   275    3e-72 
ref|NP_469609.1|  endopeptidase Clp ATP-binding chain C [Liste...   275    3e-72  
ref|ZP_01225106.1|  ClpB protein [marine gamma proteobacterium...   275    3e-72 
ref|NP_439019.1|  ATP-dependent Clp protease ATPase subunit [H...   275    3e-72  
ref|ZP_00820808.1|  COG0542: ATPases with chaperone activity, ...   275    3e-72 
ref|ZP_00156714.1|  COG0542: ATPases with chaperone activity, ...   275    3e-72 
ref|YP_454264.1|  protein disaggregation chaperone [Sodalis gl...   275    3e-72  
ref|YP_534120.1|  ATPase AAA-2 [Rhodopseudomonas palustris Bis...   275    3e-72  
ref|ZP_02632840.1|  negative regulator of genetic competence M...   275    3e-72 
ref|YP_697129.1|  negative regulator of genetic competence Mec...   275    3e-72  
ref|ZP_01785713.1|  hypothetical protein CGSHi22421_07768 [Hae...   275    3e-72 
ref|YP_001356345.1|  ATP-dependent Clp protease, ATP-binding s...   275    3e-72  
ref|ZP_01792243.1|  ClpB [Haemophilus influenzae PittHH] >gb|E...   275    3e-72 
ref|YP_001292795.1|  DNA polymerase I [Haemophilus influenzae ...   275    3e-72  
ref|YP_001139496.1|  hypothetical protein cgR_2580 [Corynebact...   274    4e-72  
ref|NP_601874.1|  ATPase with chaperone activity, ATP-binding ...   274    4e-72  
ref|YP_001661198.1|  ClpB protein [Microcystis aeruginosa NIES...   274    4e-72  
ref|ZP_01060719.1|  ATP-dependent Clp protease, ATP-binding su...   274    4e-72 
ref|YP_116621.1|  putative Clp protease [Nocardia farcinica IF...   274    4e-72  
ref|ZP_01924257.1|  ATPase AAA-2 domain protein [Victivallis v...   274    4e-72 
ref|NP_787193.1|  ATP-dependent Clp protease ATP-binding subun...   274    4e-72  
ref|ZP_01692471.1|  ATPase [Microscilla marina ATCC 23134] >gb...   274    4e-72 
ref|YP_944549.1|  chaperone ClpB containing ATPase AAA-2 domai...   274    4e-72  
ref|YP_001194929.1|  ATPase AAA-2 domain protein [Flavobacteri...   274    4e-72  
ref|ZP_00511878.1|  UvrB/UvrC protein:AAA ATPase, central regi...   274    4e-72 
ref|ZP_01853541.1|  negative regulator of genetic competence C...   274    4e-72 
ref|ZP_02640355.1|  negative regulator of genetic competence M...   274    4e-72 
ref|NP_441776.1|  ClpB protein [Synechocystis sp. PCC 6803] >s...   274    4e-72  
ref|NP_563357.1|  ClpC adenosine triphosphatase [Clostridium p...   274    4e-72  
ref|YP_874614.1|  ATP-dependent clp protease ATP-binding subun...   274    4e-72  
ref|ZP_01796555.1|  DNA polymerase I [Haemophilus influenzae R...   274    5e-72 
ref|YP_199976.1|  ATP-dependent Clp protease subunit [Xanthomo...   274    5e-72  
ref|YP_450258.1|  ATP-dependent Clp protease subunit [Xanthomo...   274    5e-72  
ref|ZP_00996430.1|  ATP-dependent protease ATP-binding subunit...   274    5e-72 
ref|YP_001105153.1|  putative ATP-dependent Clp protease [Sacc...   274    5e-72  
ref|ZP_01772028.1|  Hypothetical protein COLAER_01021 [Collins...   274    5e-72 
ref|YP_804906.1|  ATP-binding subunit of Clp protease and DnaK...   274    5e-72  
ref|YP_910817.1|  ATPase AAA-2 domain protein [Chlorobium phae...   274    5e-72  
ref|NP_356471.2|  ATP-dependent Clp protease, ATP-binding subu...   274    5e-72  
ref|NP_949769.1|  endopeptidase Clp: ATP-binding subunit B, cl...   274    5e-72  
ref|ZP_02235295.1|  hypothetical protein DORFOR_02181 [Dorea f...   274    6e-72 
ref|YP_001302474.1|  negative regulator of genetic competence ...   274    6e-72  
emb|CAL54243.1|  heat shock protein 100, putative / HSP100, pu...   274    6e-72 
ref|YP_704367.1|  ATP-binding subunit of ATP-dependent Clp pro...   273    6e-72  
ref|YP_001102688.1|  putative ATP-dependent Clp protease [Sacc...   273    6e-72  
ref|ZP_01966631.1|  hypothetical protein RUMTOR_00170 [Ruminoc...   273    6e-72 
ref|NP_565586.1|  CLPB-M/CLPB4/HSP98.7 (HEAT SHOCK PROTEIN 98....   273    6e-72  
ref|YP_861542.1|  ClpA/ClpB family chaperone [Gramella forseti...   273    7e-72  
ref|YP_487846.1|  AAA_5 ATPase [Rhodopseudomonas palustris HaA...   273    7e-72  
ref|ZP_02621125.1|  negative regulator of genetic competence C...   273    7e-72 
ref|ZP_02182677.1|  ATP-dependent Clp protease, ATP-binding su...   273    7e-72 
ref|YP_001579611.1|  ATP-dependent chaperone ClpB [Burkholderi...   273    7e-72  
ref|ZP_02115789.1|  ATPase AAA-2 domain protein [Elusimicrobiu...   273    7e-72 
ref|ZP_02039428.1|  hypothetical protein RUMGNA_00181 [Ruminoc...   273    8e-72 
ref|NP_463763.1|  endopeptidase Clp ATP-binding chain C [Liste...   273    8e-72  
ref|YP_001305666.1|  ATPase AAA-2 domain protein [Thermosipho ...   273    8e-72  
ref|YP_833293.1|  ATPase AAA-2 domain protein [Arthrobacter sp...   273    8e-72  
ref|ZP_00827770.1|  COG0542: ATPases with chaperone activity, ...   273    8e-72 
ref|ZP_02063763.1|  hypothetical protein BACOVA_00721 [Bactero...   273    8e-72 
ref|YP_699699.1|  negative regulator of genetic competence Mec...   273    8e-72  
gb|AAC44446.1|  ClpC ATPase                                         273    8e-72 
ref|ZP_01734625.1|  ATP-dependent Clp protease, ATP-binding su...   273    9e-72 
ref|YP_723053.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   273    9e-72  
ref|YP_412236.1|  ATPase with chaperone activity [Nitrosospira...   273    9e-72  
ref|ZP_02244243.1|  ATP-dependent Clp protease subunit [Xantho...   273    9e-72 
ref|YP_379783.1|  ATPase [Chlorobium chlorochromatii CaD3] >gb...   273    1e-71  
ref|ZP_00415580.1|  AAA ATPase, central region:Clp, N terminal...   273    1e-71 
ref|ZP_02435233.1|  hypothetical protein BACSTE_01475 [Bactero...   273    1e-71 
gb|EDT29156.1|  ATP-dependent chaperone ClpB [Oligotropha carb...   273    1e-71 
ref|NP_441882.1|  ClpB protein [Synechocystis sp. PCC 6803] >s...   273    1e-71  
emb|CAM32640.1|  ATP-dependent Clp protease subunit (heat-shoc...   273    1e-71 
ref|ZP_02929051.1|  ATP-dependent chaperone protein ClpB [Verr...   273    1e-71 
ref|YP_848397.1|  ClpB ATPase [Listeria welshimeri serovar 6b ...   273    1e-71  
ref|YP_704857.1|  ATP-binding subunit of ATP-dependent Clp pro...   273    1e-71  
ref|YP_099693.1|  ATP-dependent Clp protease [Bacteroides frag...   273    1e-71  
ref|YP_001291249.1|  ClpB [Haemophilus influenzae PittEE] >gb|...   273    1e-71  
ref|YP_212116.1|  negative regulator of genetic competence [Ba...   273    1e-71  
ref|YP_339457.1|  ATP-dependent protease, Hsp 100, part of mul...   273    1e-71  
ref|ZP_02040339.1|  hypothetical protein RUMGNA_01103 [Ruminoc...   272    1e-71 
ref|YP_001652103.1|  ATP-dependant Clp protease chain B [Actin...   272    1e-71  
ref|ZP_01216634.1|  putative clpB, ATPase with chaperone activ...   272    1e-71 
ref|ZP_01627655.1|  ATPase with chaperone activity, ATP-bindin...   272    1e-71 
ref|YP_878724.1|  Negative regulator of genetic competence clp...   272    1e-71  
ref|ZP_00986679.1|  COG0542: ATPases with chaperone activity, ...   272    1e-71 
ref|ZP_00604499.1|  UvrB/UvrC protein:AAA ATPase, central regi...   272    1e-71 
ref|ZP_01890904.1|  ATP-dependent Clp protease, ATP-binding su...   272    2e-71 
ref|ZP_01466628.1|  AAA ATPase [Stigmatella aurantiaca DW4/3-1...   272    2e-71 
ref|ZP_02073632.1|  hypothetical protein CLOL250_00373 [Clostr...   272    2e-71 
gb|AAL02102.1|AF404759_1  ClpB protease [Bacteroides fragilis]      272    2e-71 
ref|ZP_01516180.1|  ATPase AAA-2 [Chloroflexus aggregans DSM 9...   272    2e-71 
ref|YP_528020.1|  ClpB protein [Saccharophagus degradans 2-40]...   272    2e-71  
ref|ZP_02943522.1|  ATP-dependent chaperone ClpB [Micrococcus ...   272    2e-71 
ref|YP_858496.1|  ATP-dependent chaperone protein ClpB [Aeromo...   272    2e-71  
ref|XP_001775725.1|  predicted protein [Physcomitrella patens ...   272    2e-71  
ref|ZP_02733990.1|  negative regulator of genetic competence C...   272    2e-71 
ref|NP_683242.1|  endopeptidase Clp ATP-binding chain B [Therm...   272    2e-71  
ref|ZP_01170964.1|  ClpB protein [Bacillus sp. NRRL B-14911] >...   272    2e-71 
ref|YP_320661.1|  ATPase [Anabaena variabilis ATCC 29413] >gb|...   272    2e-71  
ref|YP_746971.1|  ATPase AAA-2 domain protein [Nitrosomonas eu...   272    2e-71  
ref|YP_001155231.1|  ATPase AAA-2 domain protein [Polynucleoba...   272    2e-71  
ref|ZP_00979764.1|  COG0542: ATPases with chaperone activity, ...   272    2e-71 
ref|YP_001765154.1|  ATP-dependent chaperone ClpB [Burkholderi...   272    2e-71  
ref|YP_633246.1|  ATP-dependent chaperone protein ClpB [Myxoco...   272    2e-71  
ref|YP_626069.1|  ATPase AAA-2 [Burkholderia cenocepacia AU 10...   272    2e-71  
ref|XP_001763692.1|  predicted protein [Physcomitrella patens ...   271    2e-71  
ref|ZP_01261920.1|  ClpB protein [Vibrio alginolyticus 12G01] ...   271    2e-71 
ref|ZP_01474371.1|  hypothetical protein VEx2w_02003076 [Vibri...   271    2e-71 
ref|YP_593838.1|  ATPase AAA-2 [Acidobacteria bacterium Ellin3...   271    2e-71  
ref|YP_001530576.1|  ATPase AAA-2 domain protein [Desulfococcu...   271    3e-71  
ref|ZP_02942797.1|  ATP-dependent chaperone ClpB [Cyanothece s...   271    3e-71 
ref|ZP_00950880.1|  ATP-dependent Clp protease, ATP-binding su...   271    3e-71 
ref|YP_001576819.1|  ATP-dependent Clp protease [Lactobacillus...   271    3e-71  
ref|YP_001818833.1|  ATP-dependent chaperone ClpB [Opitutus te...   271    3e-71  
ref|ZP_01916077.1|  probable atp-dependent protease (heat shoc...   271    3e-71 
ref|YP_660917.1|  ATPase AAA-2 [Pseudoalteromonas atlantica T6...   271    3e-71  
ref|YP_012854.1|  ClpC ATPase [Listeria monocytogenes str. 4b ...   271    3e-71  
ref|YP_677696.1|  ATP-dependent Clp protease, ATP-binding subu...   271    3e-71  
ref|YP_369386.1|  AAA ATPase, ClpB [Burkholderia sp. 383] >gb|...   271    3e-71  
ref|ZP_02938479.1|  ATPase AAA-2 domain protein [Sulfurihydrog...   271    3e-71 
ref|ZP_01858013.1|  ATP-dependent chaperone protein ClpB [Plan...   271    3e-71 
ref|YP_001618817.1|  ATPase with chaperone activity, two ATP-b...   271    3e-71  
ref|YP_171598.1|  ATP-dependent Clp protease ATP-binding subun...   271    3e-71  
ref|NP_940314.1|  ATP-dependent Clp protease ATP-binding subun...   271    4e-71  
ref|YP_718406.1|  ATP-dependent Clp protease, subunit B [Haemo...   271    4e-71  
ref|YP_615461.1|  ATPase AAA-2 [Sphingopyxis alaskensis RB2256...   271    4e-71  
ref|ZP_02438330.1|  hypothetical protein CLOSS21_00781 [Clostr...   271    4e-71 
ref|ZP_02907049.1|  ATP-dependent chaperone ClpB [Burkholderia...   271    4e-71 
ref|XP_001417871.1|  chaperone, Hsp100 family, ClpB-type [Ostr...   271    4e-71  
ref|ZP_02894181.1|  ATP-dependent chaperone ClpB [Burkholderia...   271    4e-71 
ref|YP_461928.1|  clpB protein [Syntrophus aciditrophicus SB] ...   271    4e-71  
ref|NP_796940.1|  ClpB protein [Vibrio parahaemolyticus RIMD 2...   271    4e-71  
ref|YP_001783422.1|  ATPase AAA-2 domain protein [Haemophilus ...   271    5e-71  
ref|YP_390684.1|  AAA ATPase [Thiomicrospira crunogena XCL-2] ...   271    5e-71  
ref|YP_001801078.1|  ATP-dependent Clp protease [Corynebacteri...   270    5e-71  
ref|YP_350562.1|  Chaperone clpB [Pseudomonas fluorescens PfO-...   270    5e-71  
ref|ZP_01996861.1|  hypothetical protein DORLON_02886 [Dorea l...   270    5e-71 
ref|YP_442726.1|  ATP-dependent Clp protease, ATP-binding subu...   270    5e-71  
ref|NP_519456.1|  PROBABLE ATP-DEPENDENT PROTEASE (HEAT SHOCK ...   270    5e-71  
ref|YP_572560.1|  ATPase AAA-2 [Chromohalobacter salexigens DS...   270    5e-71  
ref|YP_546306.1|  ATPase AAA-2 [Methylobacillus flagellatus KT...   270    6e-71  
sp|Q7X2S8.1|CLPB_MEIRU  Chaperone protein clpB >gb|AAP59445.1|...   270    6e-71 
ref|ZP_02355427.1|  ATP-dependent Clp protease, ATP-binding su...   270    6e-71 
ref|NP_928581.1|  protein disaggregation chaperone [Photorhabd...   270    6e-71  
ref|YP_001381349.1|  ATPase AAA-2 domain protein [Anaeromyxoba...   270    6e-71  
ref|NP_739223.1|  putative endopeptidase Clp ATP-binding chain...   270    6e-71  
ref|NP_246643.1|  ClpB [Pasteurella multocida subsp. multocida...   270    6e-71  
ref|NP_266798.1|  ATP-dependent protease ATP-binding subunit [...   270    6e-71  
ref|ZP_01048921.1|  ATP-dependent Clp protease, ATP-binding su...   270    6e-71 
gb|EAY56161.1|  ATPase with chaperone activity [Leptospirillum...   270    6e-71 
ref|NP_338246.1|  ATP-dependent Clp protease, ATP-binding subu...   270    7e-71  
ref|YP_773675.1|  ATPase AAA-2 domain protein [Burkholderia am...   270    7e-71  
ref|YP_001119613.1|  ATPase AAA-2 domain protein [Burkholderia...   270    7e-71  
ref|NP_857266.1|  PROBABLE ATP-DEPENDENT CLP PROTEASE ATP-BIND...   270    7e-71  
ref|NP_297671.1|  ATP-dependent Clp protease subunit [Xylella ...   270    7e-71  
gb|AAX52932.1|  ClpB [Bifidobacterium animalis subsp. animalis]     270    7e-71 
ref|ZP_01720103.1|  ATPase [Algoriphagus sp. PR1] >gb|EAZ80552...   270    7e-71 
gb|ABX88889.1|  heat shock protein [Edwardsiella ictaluri]          270    8e-71 
ref|ZP_02319163.1|  ClpC ATPase [Listeria monocytogenes FSL J2...   270    8e-71 
ref|ZP_02070576.1|  hypothetical protein BACUNI_01997 [Bactero...   270    8e-71 
ref|ZP_02027051.1|  hypothetical protein EUBVEN_02319 [Eubacte...   270    8e-71 
ref|YP_001416804.1|  ATPase AAA-2 domain protein [Xanthobacter...   270    9e-71  
ref|YP_155570.1|  ATP-binding subunit of Clp protease and DnaK...   270    9e-71  
ref|YP_001636713.1|  ATP-dependent chaperone ClpB [Chloroflexu...   270    9e-71  
ref|ZP_00945568.1|  ClpB protein [Ralstonia solanacearum UW551...   270    9e-71 
ref|ZP_02949703.1|  ATP-dependent chaperone ClpB [Clostridium ...   270    1e-70 
ref|YP_088975.1|  ClpA protein [Mannheimia succiniciproducens ...   270    1e-70  
ref|NP_842397.1|  ClpB ATPase dependent protease, chaperonin [...   270    1e-70  
ref|NP_779874.1|  ATP-dependent Clp protease subunit [Xylella ...   270    1e-70  
ref|ZP_01966527.1|  hypothetical protein RUMTOR_00065 [Ruminoc...   270    1e-70 
ref|ZP_00135209.1|  COG0542: ATPases with chaperone activity, ...   270    1e-70 
ref|YP_193207.1|  ATPase [Lactobacillus acidophilus NCFM] >gb|...   270    1e-70  
ref|YP_001263615.1|  ATPase AAA-2 domain protein [Sphingomonas...   270    1e-70  
ref|YP_163159.1|  ATP-dependent Clp protease [Zymomonas mobili...   270    1e-70  
ref|ZP_02463245.1|  ATP-dependent Clp protease, ATP-binding su...   269    1e-70 
ref|ZP_02432551.1|  hypothetical protein CLOSCI_02798 [Clostri...   269    1e-70 
ref|YP_445441.1|  ATP-dependent Clp protease, ATPase subunit [...   269    1e-70  
ref|YP_580108.1|  ATPase AAA-2 [Psychrobacter cryohalolentis K...   269    1e-70  
ref|ZP_02379403.1|  AAA ATPase, ClpB [Burkholderia ubonensis Bu]    269    1e-70 
ref|ZP_01302718.1|  AAA ATPase, central region [Sphingomonas s...   269    1e-70 
ref|YP_264110.1|  putative chaperonin clpA/B [Psychrobacter ar...   269    1e-70  
ref|ZP_02233480.1|  hypothetical protein DORFOR_00317 [Dorea f...   269    1e-70 
ref|YP_910327.1|  chaperone clpB [Bifidobacterium adolescentis...   269    1e-70  
ref|ZP_02029256.1|  hypothetical protein BIFADO_01710 [Bifidob...   269    1e-70 
ref|ZP_02163159.1|  ATP-dependent Clp protease, ATP-binding su...   269    1e-70 
ref|YP_001174107.1|  ClpB protein [Pseudomonas stutzeri A1501]...   269    1e-70  
ref|ZP_01996497.1|  hypothetical protein DORLON_02511 [Dorea l...   269    2e-70 
ref|ZP_00652823.1|  AAA ATPase, central region:Clp, N terminal...   269    2e-70 
ref|ZP_01900994.1|  ATPase AAA-2 [Roseobacter sp. AzwK-3b] >gb...   269    2e-70 
ref|YP_001059258.1|  ATPase AAA-2 [Burkholderia pseudomallei 6...   269    2e-70  
ref|ZP_01052579.1|  ATP-dependent Clp protease, ATP-binding su...   269    2e-70 
ref|YP_001631784.1|  ATP-dependent protease, ATPase subunit [B...   269    2e-70  
ref|YP_333784.1|  ClpB heat-shock protein [Burkholderia pseudo...   269    2e-70  
ref|ZP_01875947.1|  putative ATPase with chaperone activity [L...   269    2e-70 
gb|AAX52929.1|  ClpB [Bifidobacterium breve]                        269    2e-70 
ref|ZP_02362565.1|  ATP-dependent Clp protease, ATP-binding su...   268    2e-70 
ref|YP_001243522.1|  Chaperone clpB [Bradyrhizobium sp. BTAi1]...   268    2e-70  
ref|YP_115493.1|  ATP-dependent Clp protease, ATP-binding subu...   268    2e-70  
ref|YP_001307788.1|  ATPase AAA-2 domain protein [Clostridium ...   268    2e-70  
ref|YP_001350513.1|  ATP-dependent chaperone ClpB [Pseudomonas...   268    2e-70  
ref|YP_001618573.1|  ATPase with chaperone activity, two ATP-b...   268    2e-70  
ref|YP_879836.1|  negative regulator of genetic competence Clp...   268    2e-70  
ref|YP_103036.1|  ATP-dependent Clp protease, ATP-binding subu...   268    2e-70  
gb|ABO32597.1|  ATP-dependent Clp protease ATP-binding subunit...   268    2e-70 
ref|YP_001797337.1|  ATP-dependent chaperone ClpB [Polynucleob...   268    2e-70  
ref|ZP_02199353.1|  ATPase AAA-2 domain protein [Methylobacter...   268    2e-70 
gb|ABI13536.1|  ATP-dependent Clp protease ATP-binding subunit...   268    2e-70 
ref|YP_563863.1|  ATPase AAA-2 [Shewanella denitrificans OS217...   268    2e-70  
ref|YP_001295666.1|  ATPase with chaperone activity ATP-bindin...   268    2e-70  
ref|YP_892113.1|  chaperone ClpB [Campylobacter fetus subsp. f...   268    2e-70  
ref|NP_630495.1|  clp protease ATP binding subunit [Streptomyc...   268    2e-70  
emb|CAN69514.1|  hypothetical protein [Vitis vinifera]              268    2e-70 
ref|YP_808653.1|  ATP-binding subunit of Clp protease and DnaK...   268    2e-70  
ref|ZP_01958968.1|  hypothetical protein BACCAC_00556 [Bactero...   268    3e-70 
ref|ZP_01228098.1|  chaperone clpB [Aurantimonas sp. SI85-9A1]...   268    3e-70 
ref|YP_726714.1|  ATP-dependent protease Clp, ATPase subunit [...   268    3e-70  
ref|ZP_00999538.1|  ATP-dependent Clp protease, ATP-binding su...   268    3e-70 
emb|CAO15049.1|  unnamed protein product [Vitis vinifera]           268    3e-70 
ref|YP_588651.1|  ATP-dependent chaperone protein ClpB [Bauman...   268    3e-70  
ref|YP_001345295.1|  ATPase AAA-2 domain protein [Actinobacill...   268    3e-70  
ref|YP_160835.1|  ClpB protein [Azoarcus sp. EbN1] >emb|CAI099...   268    3e-70  
ref|NP_972927.1|  ATP-dependent Clp protease, ATP-binding subu...   268    3e-70  
ref|NP_906840.1|  CLP PROTEASE ATP-BINDING SUBUNIT [Wolinella ...   268    3e-70  
ref|YP_949224.1|  ClpA/ClpB family protein [Arthrobacter aures...   268    3e-70  
ref|YP_001804635.1|  ATP-dependent Clp protease, ATP-binding s...   268    3e-70  
ref|ZP_02621493.1|  ATP-dependent chaperone ClpB [Clostridium ...   268    3e-70 
ref|ZP_00121214.1|  COG0542: ATPases with chaperone activity, ...   268    4e-70 
ref|ZP_01748765.1|  ATP-dependent Clp protease, ATP-binding su...   268    4e-70 
ref|NP_696415.1|  protease of ClpA/ClpB type [Bifidobacterium ...   268    4e-70  
ref|NP_825691.1|  ATP-dependent Clp protease [Streptomyces ave...   268    4e-70  
ref|NP_347540.1|  ATPase with chaperon activity, two ATP-bindi...   268    4e-70  
ref|ZP_02862483.1|  hypothetical protein ANASTE_01702 [Anaerof...   268    4e-70 
ref|ZP_02917851.1|  hypothetical protein BIFDEN_01148 [Bifidob...   268    4e-70 
ref|ZP_01275022.1|  UvrB/UvrC protein:AAA ATPase, central regi...   268    4e-70 
ref|ZP_01126369.1|  ClpB protein [Nitrococcus mobilis Nb-231] ...   268    4e-70 
ref|ZP_02006661.1|  ATPase AAA-2 domain protein [Ralstonia pic...   268    4e-70 
ref|YP_108104.1|  ClpB heat-shock protein [Burkholderia pseudo...   267    4e-70  
emb|CAJ73829.1|  strongly similar to negative regulator of gen...   267    4e-70 
ref|ZP_00927846.1|  COG0542: ATPases with chaperone activity, ...   267    5e-70 
ref|YP_001189119.1|  ATPase AAA-2 domain protein [Pseudomonas ...   267    5e-70  
ref|ZP_01116332.1|  ATPase with chaperone activity, ATP-bindin...   267    5e-70 
ref|YP_471229.1|  ATP-dependent Clp protease, ATP-binding subu...   267    5e-70  
ref|YP_385794.1|  AAA ATPase [Geobacter metallireducens GS-15]...   267    5e-70  
ref|ZP_01763890.1|  ATP-dependent chaperone protein ClpB [Burk...   267    5e-70 
ref|ZP_00532807.1|  AAA ATPase, central region:Clp, N terminal...   267    5e-70 
ref|ZP_01315540.1|  hypothetical protein Bpse1_03005112 [Burkh...   267    5e-70 
ref|ZP_01093925.1|  ClpB protein [Blastopirellula marina DSM 3...   267    5e-70 
ref|ZP_01037840.1|  ATP-dependent Clp protease, ATP-binding su...   267    5e-70 
ref|ZP_01945966.1|  ATP-dependent chaperone ClpB [Coxiella bur...   267    5e-70 
ref|ZP_02218460.1|  ATP-dependent chaperone ClpB [Coxiella bur...   267    5e-70 
ref|ZP_02196324.1|  ClpB protein [Vibrio campbellii AND4] >gb|...   267    5e-70 
ref|YP_001307269.1|  ATPase AAA-2 domain protein [Clostridium ...   267    5e-70  
ref|YP_001272077.1|  ATPase AAA-2 domain protein [Lactobacillu...   267    6e-70  
ref|YP_253890.1|  hypothetical protein SH1975 [Staphylococcus ...   267    6e-70  
ref|ZP_01132627.1|  ATP-dependent protease, Hsp 100 [Pseudoalt...   267    6e-70 
ref|ZP_02860561.1|  ATP-dependent chaperone ClpB [Rhizobium le...   267    6e-70 
ref|YP_262372.1|  ClpB protein [Pseudomonas fluorescens Pf-5] ...   267    6e-70  
ref|NP_568314.1|  APG6/CLPB-P/CLPB3 (ALBINO AND PALE GREEN 6);...   267    6e-70  
ref|ZP_02296575.1|  ATPase AAA-2 domain protein [Rhizobium leg...   267    6e-70 
ref|NP_809811.1|  ATP-dependent Clp protease [Bacteroides thet...   267    6e-70  
ref|ZP_01868636.1|  ClpB protein [Vibrio shilonii AK1] >gb|EDL...   267    7e-70 
ref|YP_001363943.1|  ATPase AAA-2 domain protein [Kineococcus ...   267    7e-70  
ref|ZP_01878459.1|  ATPase AAA-2 [Roseovarius sp. TM1035] >gb|...   267    7e-70 
dbj|BAG14041.1|  chaperone ClpB [uncultured Termite group 1 ba...   267    7e-70 
ref|YP_769854.1|  putative chaperone ClpB (heat-shock protein)...   267    7e-70  
ref|ZP_01437237.1|  endopeptidase Clp ATP-binding chain B, clp...   266    7e-70 
ref|YP_584107.1|  ATPase AAA-2 [Ralstonia metallidurans CH34] ...   266    7e-70  
ref|YP_890312.1|  negative regulator of genetic competence Clp...   266    8e-70  
ref|YP_001358767.1|  ATP-dependent Clp protease, ATP-binding s...   266    8e-70  
ref|ZP_00682330.1|  AAA ATPase, central region:Clp, N terminal...   266    8e-70 
ref|ZP_02012391.1|  ATPase AAA-2 domain protein [Opitutaceae b...   266    8e-70 
ref|ZP_01721106.1|  endopeptidase Clp ATP-binding chain B [Alg...   266    8e-70 
ref|ZP_01612848.1|  ATP-dependent protease, Hsp 100, part of m...   266    8e-70 
ref|YP_420923.1|  ATPase with chaperone activity [Magnetospiri...   266    8e-70  
ref|YP_804593.1|  ATP-binding subunit of Clp protease and DnaK...   266    9e-70  
ref|ZP_02187888.1|  Chaperone clpB [alpha proteobacterium BAL1...   266    9e-70 
gb|EAY90532.1|  hypothetical protein OsI_011765 [Oryza sativa ...   266    9e-70 
ref|NP_001050410.1|  Os03g0426900 [Oryza sativa (japonica cult...   266    9e-70  
ref|NP_933508.1|  clpB protein [Vibrio vulnificus YJ016] >sp|Q...   266    9e-70  
ref|ZP_02084194.1|  hypothetical protein CLOBOL_01718 [Clostri...   266    1e-69 
ref|NP_873111.1|  ATP-dependant Clp protease chain B [Haemophi...   266    1e-69  
ref|YP_001003798.1|  ATPase AAA-2 domain protein [Halorhodospi...   266    1e-69  
ref|YP_001550958.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   266    1e-69  
ref|ZP_02422685.1|  hypothetical protein EUBSIR_01534 [Eubacte...   266    1e-69 
ref|ZP_02206798.1|  hypothetical protein COPEUT_01588 [Coproco...   266    1e-69 
ref|YP_001398457.1|  ATP-dependent chaperone protein ClpB [Cam...   266    1e-69  
ref|YP_001701299.1|  Probable ATP-dependent Clp protease ATP-b...   266    1e-69  
ref|ZP_02202973.1|  ATPase AAA-2 domain protein [Methylobacter...   266    1e-69 
ref|YP_982454.1|  ATPase AAA-2 domain protein [Polaromonas nap...   266    1e-69  
ref|ZP_01510124.1|  ATPase AAA-2 [Burkholderia phytofirmans Ps...   266    1e-69 
ref|NP_884084.1|  ATP-dependent protease, ATPase subunit [Bord...   266    1e-69  
ref|YP_001758074.1|  ATP-dependent chaperone ClpB [Methylobact...   266    1e-69  
ref|YP_001771845.1|  ATP-dependent chaperone ClpB [Methylobact...   266    1e-69  
ref|YP_641916.1|  ATPase AAA-2 [Mycobacterium sp. MCS] >ref|YP...   266    1e-69  
ref|XP_001701777.1|  ClpB chaperone, Hsp100 family [Chlamydomo...   266    1e-69  
ref|YP_535094.1|  Negative regulator of genetic competence [La...   266    1e-69  
gb|AAR01771.1|  putative heat shock protein, 5'-partial [Oryza...   266    1e-69 
ref|YP_498094.1|  AAA ATPase, central region [Novosphingobium ...   266    1e-69  
ref|YP_001780063.1|  clpB protein [Clostridium botulinum B1 st...   266    1e-69  
gb|ABF96724.1|  Chaperone clpB 1, putative, expressed [Oryza s...   266    1e-69 
ref|ZP_01663685.1|  putative ATP-dependent protease (heat shoc...   266    1e-69 
ref|ZP_00965519.1|  COG0542: ATPases with chaperone activity, ...   266    1e-69 
ref|NP_253232.1|  ClpB protein [Pseudomonas aeruginosa PAO1] >...   266    1e-69  
ref|YP_001382793.1|  clpB protein [Clostridium botulinum A str...   266    1e-69  
ref|ZP_02612419.1|  clpB protein [Clostridium botulinum NCTC 2...   266    1e-69 
ref|ZP_00971289.1|  COG0542: ATPases with chaperone activity, ...   266    1e-69 
ref|YP_001073397.1|  ATPase AAA-2 domain protein [Mycobacteriu...   266    1e-69  
sp|Q7UM33.2|CLPB_RHOBA  Chaperone protein clpB                      266    1e-69 
ref|YP_001831962.1|  ATP-dependent chaperone ClpB [Beijerincki...   266    2e-69  
ref|NP_819146.1|  clpB protein [Coxiella burnetii RSA 493] >re...   266    2e-69  
ref|NP_889828.1|  ATP-dependent protease, ATPase subunit [Bord...   266    2e-69  
ref|NP_959395.1|  ClpC [Mycobacterium avium subsp. paratubercu...   266    2e-69  
ref|ZP_02615940.1|  clpB protein [Clostridium botulinum Bf] >g...   265    2e-69 
ref|ZP_01251824.1|  ATP-dependent Clp protease, ATP-binding su...   265    2e-69 
ref|NP_879972.1|  ATP-dependent protease, ATPase subunit [Bord...   265    2e-69  
ref|YP_001396085.1|  ClpB [Clostridium kluyveri DSM 555] >gb|E...   265    2e-69  
ref|NP_868707.1|  ClpB protein [Rhodopirellula baltica SH 1] >...   265    2e-69  
ref|ZP_01120770.1|  ATP-dependent Clp protease, ATPase subunit...   265    2e-69 
ref|YP_056693.1|  ATP-dependent protease (Clp chaperone) [Prop...   265    2e-69  
ref|ZP_01363713.1|  hypothetical protein PaerPA_01000813 [Pseu...   265    2e-69 
ref|YP_296188.1|  AAA ATPase, central region:Clp, N terminal [...   265    2e-69  
ref|YP_001328164.1|  ATPase AAA-2 domain protein [Sinorhizobiu...   265    2e-69  
ref|YP_749367.1|  ATPase AAA-2 domain protein [Shewanella frig...   265    2e-69  
ref|YP_001679928.1|  chaperone clpb [Heliobacterium modestical...   265    2e-69  
ref|ZP_02438478.1|  hypothetical protein CLOSS21_00930 [Clostr...   265    2e-69 
ref|YP_001014463.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   265    2e-69  
dbj|BAE47139.1|  ClpB [Tetragenococcus halophilus]                  265    2e-69 
ref|YP_001547732.1|  ATPase AAA-2 domain protein [Herpetosipho...   265    2e-69  
ref|ZP_01864593.1|  ATP-dependent Clp protease [Erythrobacter ...   265    2e-69 
ref|YP_001490543.1|  ATP-dependent Clp protease, ATP-binding s...   265    2e-69  
ref|ZP_01987326.1|  chaperone ClpB [Vibrio harveyi HY01] >gb|E...   265    2e-69 
ref|ZP_02143343.1|  ATP-dependent Clp protease, ATP-binding su...   265    2e-69 
ref|YP_001389780.1|  clpB protein [Clostridium botulinum F str...   265    2e-69  
ref|ZP_01731998.1|  ClpB protein [Cyanothece sp. CCY0110] >gb|...   265    2e-69 
ref|YP_396392.1|  ATPase/chaperone ClpC, putative specificity ...   265    2e-69  
ref|ZP_01016108.1|  endopeptidase Clp: ATP-binding subunit B, ...   265    2e-69 
ref|ZP_01545920.1|  endopeptidase Clp ATP-binding chain B, clp...   265    2e-69 
ref|NP_828417.1|  ATP-dependent Clp protease [Streptomyces ave...   265    2e-69  
ref|YP_001785749.1|  clpB protein [Clostridium botulinum A3 st...   265    3e-69  
ref|YP_716770.1|  ATP-dependent protease, Hsp 100, part of mul...   265    3e-69  
ref|ZP_02841472.1|  ATP-dependent chaperone ClpB [Thauera sp. ...   265    3e-69 
ref|ZP_02945393.1|  ATP-dependent chaperone ClpB [Micrococcus ...   265    3e-69 
ref|YP_001503015.1|  ATPase AAA-2 domain protein [Shewanella p...   265    3e-69  
ref|YP_001444233.1|  hypothetical protein VIBHAR_01007 [Vibrio...   265    3e-69  
ref|YP_681098.1|  ATP-dependent Clp protease, ATP-binding subu...   265    3e-69  
ref|NP_601973.1|  ATPase with chaperone activity, ATP-binding ...   265    3e-69  
ref|YP_517901.1|  hypothetical protein DSY1668 [Desulfitobacte...   265    3e-69  
ref|ZP_02078844.1|  hypothetical protein CLOLEP_00281 [Clostri...   265    3e-69 
ref|YP_001691643.1|  ATP-dependent protease Clp ATP-binding su...   265    3e-69  
dbj|BAE06227.1|  heat shock protein [Solanum lycopersicum]          265    4e-69  
ref|YP_001252953.1|  heat shock protein [Clostridium botulinum...   265    4e-69  
ref|NP_471641.1|  clpB [Listeria innocua Clip11262] >sp|Q929G7...   265    4e-69  
ref|ZP_02152875.1|  ATP-dependent Clp protease, ATP-binding su...   264    4e-69 
ref|ZP_02011232.1|  ATPase AAA-2 domain protein [Opitutaceae b...   264    4e-69 
ref|YP_001425322.1|  ATP-dependent chaperone ClpB [Coxiella bu...   264    4e-69  
emb|CAM74613.1|  ATP-dependent Clp protease, ATP-binding subun...   264    4e-69 
ref|ZP_02121798.1|  ATPase AAA-2 [Methylobacterium nodulans OR...   264    4e-69 
ref|ZP_01884909.1|  ATP-dependent Clp protease, ATP-binding su...   264    4e-69 
ref|NP_386714.1|  PROBABLE ATP-DEPENDENT PROTEASE (HEAT SHOCK ...   264    4e-69  
gb|ABD52004.1|  ClpB [Methanohalophilus portucalensis]              264    4e-69 
ref|YP_457176.1|  ATP-dependent Clp protease [Erythrobacter li...   264    4e-69  
ref|YP_632993.1|  ATP-dependent Clp protease, ATP-binding subu...   264    5e-69  
ref|NP_759474.1|  ClpB protein [Vibrio vulnificus CMCP6] >sp|Q...   264    5e-69  
ref|YP_956135.1|  ATPase AAA-2 domain protein [Mycobacterium v...   264    5e-69  
ref|YP_566814.1|  ATPase AAA-2 [Methanococcoides burtonii DSM ...   264    5e-69  
ref|YP_523176.1|  ATPase AAA-2 [Rhodoferax ferrireducens T118]...   264    5e-69  
ref|ZP_01067431.1|  ATP-dependent chaperone protein ClpB [Camp...   264    5e-69 
ref|YP_001088534.1|  chaperone [Clostridium difficile 630] >re...   264    5e-69  
ref|YP_549026.1|  ATPase AAA-2 [Polaromonas sp. JS666] >gb|ABE...   264    5e-69  
ref|YP_001000212.1|  ATP-dependent chaperone protein ClpB [Cam...   264    5e-69  
ref|YP_001139593.1|  hypothetical protein cgR_2676 [Corynebact...   264    5e-69  
ref|ZP_01809569.1|  ATP-dependent CLP protease ATP-binding sub...   264    5e-69 
ref|ZP_01069815.1|  ATP-dependent chaperone protein ClpB [Camp...   264    5e-69 
ref|NP_281694.1|  ATP-dependent CLP protease ATP-binding subun...   264    5e-69  
ref|ZP_02688502.1|  clpB protein [Listeria monocytogenes FSL J...   264    6e-69 
ref|ZP_02056490.1|  ATPase AAA-2 domain protein [Methylobacter...   264    6e-69 
ref|ZP_00515150.1|  AAA ATPase, central region:Clp, N terminal...   264    6e-69 
ref|NP_780779.1|  negative regulator of genetic competence mec...   264    6e-69  
ref|YP_001031959.1|  ATP-dependent Clp protease ATP-binding su...   264    6e-69  
gb|AAD01783.1|  ClpC [Lactococcus lactis]                           264    6e-69 
ref|YP_001639812.1|  ATP-dependent chaperone ClpB [Methylobact...   264    6e-69  
ref|YP_001482049.1|  ATP-dependent CLP protease ATP-binding su...   264    6e-69  
ref|YP_001751394.1|  ATP-dependent chaperone ClpB [Pseudomonas...   263    6e-69  
ref|NP_301295.1|  putative ATP-dependent Clp protease [Mycobac...   263    6e-69  
ref|YP_675533.1|  ATPase AAA-2 [Mesorhizobium sp. BNC1] >gb|AB...   263    6e-69  
ref|ZP_01944630.1|  hypothetical protein LMSG_02200 [Listeria ...   263    7e-69 
ref|YP_001413027.1|  ATPase AAA-2 domain protein [Parvibaculum...   263    7e-69  
ref|YP_014829.1|  clpB protein [Listeria monocytogenes str. 4b...   263    7e-69  
ref|ZP_01385575.1|  AAA ATPase, central region:ATPase associat...   263    7e-69 
ref|YP_558648.1|  Heat-shock protein, chaperone ClpB [Burkhold...   263    7e-69  
ref|NP_733613.1|  ATP-dependent protease ATP-binding subunit [...   263    8e-69  
ref|ZP_01885529.1|  ATPase AAA-2 [Pedobacter sp. BAL39] >gb|ED...   263    8e-69 
ref|YP_844399.1|  ATPase AAA-2 domain protein [Syntrophobacter...   263    8e-69  
ref|NP_969820.1|  ATPase with chaperone activity, two ATP-bind...   263    8e-69  
ref|NP_719122.1|  clpB protein [Shewanella oneidensis MR-1] >s...   263    8e-69  
ref|ZP_00381176.1|  COG0542: ATPases with chaperone activity, ...   263    9e-69 
ref|NP_274481.1|  clpB protein [Neisseria meningitidis MC58] >...   263    9e-69  
ref|NP_781219.1|  clpB protein [Clostridium tetani E88] >sp|Q8...   263    9e-69  
ref|NP_465730.1|  hypothetical protein lmo2206 [Listeria monoc...   263    1e-68  
ref|YP_354488.1|  Chaperone ClpB [Rhodobacter sphaeroides 2.4....   263    1e-68  
ref|NP_816010.1|  ATP-dependent Clp protease, ATP-binding subu...   263    1e-68  
ref|YP_001041967.1|  ATPase AAA-2 domain protein [Rhodobacter ...   263    1e-68  
ref|YP_975400.1|  ClpB protein [Neisseria meningitidis FAM18] ...   263    1e-68  
ref|YP_001801197.1|  ATP-dependent Clp protease, ATP-binding s...   263    1e-68  
ref|YP_617433.1|  ATPase AAA-2 [Sphingopyxis alaskensis RB2256...   263    1e-68  
ref|YP_001132700.1|  ATPase AAA-2 domain protein [Mycobacteriu...   263    1e-68  
ref|ZP_01107726.1|  putative heat shock ClpB protein [Flavobac...   263    1e-68 
ref|ZP_01803038.1|  hypothetical protein CdifQ_04002326 [Clost...   263    1e-68 
ref|YP_249971.1|  ATP-dependent Clp protease, ATP-binding subu...   263    1e-68  
ref|YP_833215.1|  ATPase AAA-2 domain protein [Arthrobacter sp...   263    1e-68  
gb|EAY84741.1|  hypothetical protein OsI_005974 [Oryza sativa ...   262    1e-68 
ref|ZP_01368719.1|  ATPase AAA-2 [Desulfitobacterium hafniense...   262    1e-68 
ref|ZP_01772266.1|  Hypothetical protein COLAER_01270 [Collins...   262    1e-68 
ref|YP_735119.1|  ATPase AAA-2 domain protein [Shewanella sp. ...   262    1e-68  
ref|ZP_01592110.1|  ATPase AAA-2 [Geobacter lovleyi SZ] >gb|EA...   262    1e-68 
ref|YP_001020746.1|  putative ATP-dependent protease (heat sho...   262    1e-68  
ref|NP_001046096.1|  Os02g0181900 [Oryza sativa (japonica cult...   262    2e-68  
ref|XP_001712940.1|  ATP binding subunit of Clp protease [Bige...   262    2e-68  
ref|ZP_01057889.1|  ATP-dependent Clp protease, ATP-binding su...   262    2e-68 
gb|EAZ21979.1|  hypothetical protein OsJ_005462 [Oryza sativa ...   262    2e-68 
ref|ZP_02922886.1|  negative regulator of genetic competence [...   262    2e-68 
ref|NP_284398.1|  ClpB protein [Neisseria meningitidis Z2491] ...   262    2e-68  
ref|ZP_02839351.1|  ATP-dependent chaperone ClpB [Arthrobacter...   262    2e-68 
ref|YP_001812971.1|  ATP-dependent chaperone ClpB [Exiguobacte...   262    2e-68  
ref|YP_208130.1|  putative ClpB protein [Neisseria gonorrhoeae...   262    2e-68  
ref|YP_907684.1|  ATP-dependent protease ATP-binding subunit C...   262    2e-68  
ref|ZP_01067123.1|  ClpB protein [Vibrio sp. MED222] >gb|EAQ51...   262    2e-68 
ref|YP_001658940.1|  ClpB protein [Microcystis aeruginosa NIES...   262    2e-68  
ref|YP_850420.1|  chaperone ClpB [Listeria welshimeri serovar ...   262    2e-68  
ref|YP_001625018.1|  ClpB [Renibacterium salmoninarum ATCC 332...   262    2e-68  
ref|YP_001300550.1|  negative regulator of genetic competence ...   262    2e-68  
ref|ZP_00371071.1|  ATP-dependent Clp protease, ATP-binding su...   262    2e-68 
ref|ZP_01442955.1|  ATP-dependent Clp protease, ATP-binding su...   262    2e-68 
ref|ZP_02922061.1|  endopeptidase Clp ATP-binding chain B [Bac...   262    2e-68 
emb|CAJ50034.1|  ATP-dependent protease, ATPase subunit (chape...   262    2e-68 
gb|EDN75089.1|  endopeptidase ClpA [Mannheimia haemolytica PHL...   262    2e-68 
ref|YP_610130.1|  ATP-dependent Clp protease, ATP-binding subu...   262    2e-68  
ref|YP_375939.1|  ATPase [Pelodictyon luteolum DSM 273] >gb|AB...   262    2e-68  
ref|ZP_00630585.1|  AAA ATPase, central region:Clp, N terminal...   262    2e-68  
ref|ZP_02037926.1|  hypothetical protein BACCAP_03545 [Bactero...   262    2e-68 
ref|NP_104534.1|  endopeptidase Clp ATP-binding chain B, clpB ...   262    2e-68  
ref|YP_001221056.1|  ATPase with chaperone activity, ATP-bindi...   261    2e-68  
ref|YP_001599510.1|  ATP-dependent Clp protease ATP-binding su...   261    3e-68  
ref|YP_178631.1|  ATP-dependent chaperone protein ClpB [Campyl...   261    3e-68  
ref|YP_933070.1|  probable ATP-dependent Clp protease, ATP-bin...   261    3e-68  
ref|NP_419695.1|  ATP-dependent Clp protease, ATP-binding subu...   261    3e-68  
ref|YP_001709639.1|  putative ATP-dependent protease ATP-bindi...   261    3e-68  
gb|EDN35352.1|  ClpB protein [Francisella tularensis subsp. no...   261    3e-68 
ref|YP_483431.1|  ATPase AAA-2 [Frankia sp. CcI3] >gb|ABD13702...   261    3e-68  
ref|YP_947629.1|  ATP-dependent chaperone protein ClpB [Arthro...   261    3e-68  
ref|ZP_01753957.1|  ATP-dependent Clp protease, ATP-binding su...   261    4e-68 
ref|YP_188155.1|  ATP-dependent Clp protease, ATP-binding subu...   261    4e-68  
ref|ZP_01617213.1|  ATPase with chaperone activity, ATP-bindin...   261    4e-68 
ref|NP_764229.1|  clpB protein [Staphylococcus epidermidis ATC...   261    4e-68  
ref|ZP_01749787.1|  ATP-dependent Clp protease, ATP-binding su...   261    4e-68 
ref|ZP_02418269.1|  hypothetical protein ANACAC_00838 [Anaeros...   261    4e-68 
ref|YP_001169007.1|  ATPase AAA-2 domain protein [Rhodobacter ...   261    4e-68  
ref|XP_001698633.1|  ClpD chaperone, Hsp100 family [Chlamydomo...   261    4e-68  
ref|YP_001514773.1|  chaperone ClpB [Acaryochloris marina MBIC...   261    4e-68  
ref|YP_001531964.1|  ATPase AAA-2 domain protein [Dinoroseobac...   261    4e-68  
gb|EDO65608.1|  ClpB protein [Francisella tularensis subsp. ho...   261    4e-68 
ref|YP_512895.1|  ClpB protein [Francisella tularensis subsp. ...   261    4e-68  
ref|YP_001677589.1|  chaperone ClpB [Francisella philomiragia ...   261    4e-68  
emb|CAA73776.1|  heat shock protein [Campylobacter jejuni]          261    4e-68 
ref|NP_698844.1|  ATP-dependent Clp protease, ATP-binding subu...   261    4e-68  
ref|YP_222518.1|  ClpB, ATP-dependent Clp protease, ATP-bindin...   261    5e-68  
ref|YP_001628294.1|  Chaperone clpB [Brucella suis ATCC 23445]...   261    5e-68  
ref|ZP_02251420.1|  ATPase AAA-2 domain protein [Akkermansia m...   261    5e-68 
ref|ZP_00959599.1|  ATP-dependent Clp protease, ATP-binding su...   261    5e-68 
ref|YP_000329.1|  hemolysin B [Leptospira interrogans serovar ...   261    5e-68  
ref|YP_154107.1|  ATP-dependent clp protease ATP-binding subun...   260    6e-68  
ref|ZP_01202344.1|  ATP-dependent Clp protease [Flavobacteria ...   260    6e-68 
ref|YP_502751.1|  ATPase AAA-2 [Methanospirillum hungatei JF-1...   260    6e-68  
ref|YP_794936.1|  ATP-binding subunit of Clp protease and DnaK...   260    6e-68  
ref|ZP_02290223.1|  clpB protein [Listeria monocytogenes FSL J...   260    6e-68 
ref|ZP_02951321.1|  negative regulator of genetic competence C...   260    7e-68 
ref|ZP_02166958.1|  putative chaperone ClpB (heat-shock protei...   260    7e-68 
ref|YP_001121149.1|  AAA superfamily ATPase clpB [Francisella ...   260    7e-68  
ref|YP_899349.1|  chaperone clpB [Francisella tularensis subsp...   260    7e-68  
ref|NP_710572.1|  ATPase (clpc) [Leptospira interrogans serova...   260    7e-68  
ref|ZP_00992351.1|  ClpB protein [Vibrio splendidus 12B01] >gb...   260    7e-68 
ref|ZP_02883483.1|  ATP-dependent chaperone ClpB [Burkholderia...   260    7e-68 
ref|YP_001716630.1|  ATPase AAA-2 domain protein [Candidatus D...   260    7e-68  
ref|YP_001158985.1|  ATPase AAA-2 domain protein [Salinispora ...   260    8e-68  
ref|YP_001409832.1|  ATPase AAA-2 domain protein [Fervidobacte...   260    8e-68  
ref|YP_998335.1|  ATPase AAA-2 domain protein [Verminephrobact...   260    8e-68  
ref|YP_168473.1|  ATP-dependent Clp protease, ATP-binding subu...   260    8e-68  
ref|ZP_01697822.1|  ATPase AAA-2 [Bacillus coagulans 36D1] >gb...   260    9e-68 
ref|ZP_01862060.1|  ClpB protein [Bacillus sp. SG-1] >gb|EDL62...   260    9e-68 
ref|ZP_02060523.1|  ATPase AAA-2 domain protein [Hydrogenobacu...   260    9e-68 
ref|ZP_01976873.1|  clpB protein [Vibrio cholerae B33] >gb|EAZ...   259    9e-68 
gb|EDN38479.1|  hypothetical protein FTDG_01296 [Francisella t...   259    1e-67 
ref|YP_511929.1|  ATPase AAA-2 [Jannaschia sp. CCS1] >gb|ABD56...   259    1e-67  
ref|ZP_02891919.1|  ATPase AAA-2 domain protein [Burkholderia ...   259    1e-67 
emb|CAO86798.1|  clpB1 [Microcystis aeruginosa PCC 7806]            259    1e-67 
ref|YP_355789.1|  heat shock protein ClpB-like [Pelobacter car...   259    1e-67  
ref|ZP_02420152.1|  hypothetical protein ANACAC_02763 [Anaeros...   259    1e-67 
ref|YP_001377827.1|  ATPase AAA-2 domain protein [Anaeromyxoba...   259    1e-67  
ref|ZP_01896353.1|  clpB protein [Moritella sp. PE36] >gb|EDM6...   259    1e-67 
ref|ZP_01500493.1|  ATPase AAA-2 [Burkholderia phymatum STM815...   259    1e-67 
ref|ZP_01202814.1|  ATP-dependent Clp protease [Flavobacteria ...   259    1e-67 
ref|ZP_01038748.1|  ATP-dependent Clp protease [Erythrobacter ...   259    1e-67 
ref|YP_796845.1|  ATP-dependent Clp protease [Leptospira borgp...   259    1e-67  
ref|ZP_02288508.1|  ClpC ATPase [Listeria monocytogenes FSL J1...   259    1e-67 
ref|YP_612125.1|  ATPase AAA-2 [Silicibacter sp. TM1040] >gb|A...   259    1e-67  
ref|ZP_02210610.1|  hypothetical protein CLOBAR_00174 [Clostri...   259    1e-67 
ref|ZP_01956475.1|  clpB protein [Vibrio cholerae MZO-3] >gb|E...   259    1e-67 
ref|YP_170660.1|  ClpB protein [Francisella tularensis subsp. ...   259    1e-67  
ref|ZP_01815016.1|  ClpB protein [Vibrionales bacterium SWAT-3...   259    1e-67 
ref|YP_291211.1|  ATPase [Prochlorococcus marinus str. NATL2A]...   259    1e-67  
ref|NP_230360.1|  clpB protein [Vibrio cholerae O1 biovar elto...   259    1e-67  
ref|YP_001408297.1|  chaperone ClpB 1 [Campylobacter curvus 52...   259    1e-67  
ref|ZP_01483021.1|  hypothetical protein VchoR_02001029 [Vibri...   259    1e-67 
ref|YP_001216203.1|  clpB protein [Vibrio cholerae O395] >gb|A...   259    1e-67  
ref|ZP_01973054.1|  chaperone ClpB [Vibrio cholerae NCTC 8457]...   259    1e-67 
ref|YP_001404764.1|  ATPase AAA-2 domain protein [Candidatus M...   259    2e-67  
ref|YP_285927.1|  AAA ATPase, central region:Clp, N terminal [...   259    2e-67  
ref|YP_011091.1|  ATP-dependent Clp protease, ATP-binding subu...   259    2e-67  
ref|ZP_02206716.1|  hypothetical protein COPEUT_01505 [Coproco...   259    2e-67 
ref|YP_001095073.1|  ATPase AAA-2 domain protein [Shewanella l...   259    2e-67  
ref|YP_393035.1|  AAA ATPase [Sulfurimonas denitrificans DSM 1...   259    2e-67  
ref|YP_001353008.1|  ATP-dependent Clp protease ATP-binding su...   259    2e-67  
ref|ZP_01874899.1|  probable endopeptidase ATP-binding chain c...   259    2e-67 
ref|YP_001593669.1|  Chaperone clpB [Brucella canis ATCC 23365...   259    2e-67  
ref|YP_270571.1|  ATP-dependent chaperone protein ClpB [Colwel...   259    2e-67  
ref|YP_065646.1|  heat shock protein ClpB [Desulfotalea psychr...   259    2e-67  
ref|YP_001475305.1|  chaperone endopeptidase Clp ATP-binding c...   259    2e-67  
sp|Q8YJ91.2|CLPB_BRUME  Chaperone protein clpB                      259    2e-67 
ref|ZP_01129608.1|  ATP-dependent Clp protease, ATP-binding su...   258    2e-67 
ref|NP_940420.1|  Putative ATP-dependent protease regulatory s...   258    2e-67  
ref|YP_966736.1|  ATPase AAA-2 domain protein [Desulfovibrio v...   258    2e-67  
ref|NP_539113.1|  ATP-DEPENDENT CLP PROTEASE, ATP-BINDING SUBU...   258    2e-67  
ref|YP_901407.1|  ATPase AAA-2 domain protein [Pelobacter prop...   258    2e-67  
ref|YP_964510.1|  ATPase AAA-2 domain protein [Shewanella sp. ...   258    2e-67  
ref|YP_001675452.1|  ATPase AAA-2 domain protein [Shewanella h...   258    2e-67  
ref|YP_378160.1|  ATPase [Synechococcus sp. CC9902] >gb|ABB271...   258    3e-67  
ref|YP_301890.1|  putative ATPase subunit of an ATP-dependent ...   258    3e-67  
gb|ABP48137.1|  putative ATP-dependent Clp protease [Rhodococc...   258    3e-67 
ref|YP_001100404.1|  ATP-dependent protease, Hsp 100, part of ...   258    3e-67  
ref|YP_001259694.1|  ATP-dependent chaperone ClpB [Brucella ov...   258    3e-67  
ref|ZP_01622098.1|  ATPase [Lyngbya sp. PCC 8106] >gb|EAW35910...   258    3e-67 
ref|YP_001537157.1|  ATPase AAA-2 domain protein [Salinispora ...   258    3e-67  
gb|ABB73202.1|  heat shock protein 101 [Funaria hygrometrica]       258    3e-67 
ref|YP_001369589.1|  ATPase AAA-2 domain protein [Ochrobactrum...   258    3e-67  
ref|YP_366688.1|  putative ClpA/B protease, ATPase subunit [Bu...   258    3e-67  
sp|Q9Z6E4.1|CLPB_STRAL  Chaperone protein clpB >gb|AAD15989.1|...   258    3e-67 
ref|YP_001762075.1|  ATP-dependent chaperone ClpB [Shewanella ...   258    3e-67  
ref|NP_875474.1|  ATPase with chaperone activity ATP-binding s...   258    3e-67  
ref|YP_191868.1|  ATP-dependent Clp protease, ATP-binding subu...   258    3e-67  
ref|ZP_01844581.1|  ATPase AAA-2 domain protein [Shewanella ba...   258    4e-67 
ref|YP_001049412.1|  ATPase AAA-2 domain protein [Shewanella b...   258    4e-67  
ref|NP_631568.1|  chaperone [Streptomyces coelicolor A3(2)] >e...   257    5e-67  
ref|YP_987397.1|  ATPase AAA-2 domain protein [Acidovorax sp. ...   257    5e-67  
ref|ZP_00379952.1|  COG0542: ATPases with chaperone activity, ...   257    5e-67 
ref|YP_273034.1|  clpB protein [Pseudomonas syringae pv. phase...   257    5e-67  
ref|ZP_02151016.1|  ATP-dependent Clp protease, ATP-binding su...   257    5e-67 
ref|YP_001682619.1|  ATP-dependent chaperone ClpB [Caulobacter...   257    5e-67  
ref|YP_001585373.1|  ATPase AAA-2 domain protein [Burkholderia...   257    5e-67  
ref|NP_904369.1|  ATP-dependent Clp protease, ATP-binding subu...   257    5e-67  
ref|YP_745624.1|  clpB protein [Granulibacter bethesdensis CGD...   257    5e-67  
ref|NP_785445.1|  ATP-dependent Clp protease, ATP-binding subu...   257    6e-67  
ref|NP_790675.1|  clpB protein [Pseudomonas syringae pv. tomat...   257    6e-67  
ref|YP_712816.1|  ATP-dependent protease, Hsp 100, part of mul...   257    6e-67  
ref|XP_001781353.1|  predicted protein [Physcomitrella patens ...   257    7e-67  
ref|ZP_02132137.1|  ATPase AAA-2 domain protein [Desulfatibaci...   257    7e-67 
ref|ZP_01859868.1|  ATP-dependent Clp protease-like (class III...   257    7e-67 
ref|NP_347595.1|  ATPase with chaperone activity, two ATP-bind...   257    7e-67  
ref|YP_643458.1|  ATPase AAA-2 [Rubrobacter xylanophilus DSM 9...   257    7e-67  
gb|AAF91178.1|AF203700_1  ClpB [Phaseolus lunatus]                  257    7e-67 
ref|ZP_02146776.1|  hypothetical protein RGBS107_04916 [Phaeob...   256    8e-67 
ref|ZP_02916497.1|  ATP-dependent chaperone ClpB [Candidatus A...   256    8e-67 
ref|ZP_02426207.1|  hypothetical protein ALIPUT_02368 [Alistip...   256    8e-67 
ref|ZP_01740638.1|  ATPase AAA-2 [Rhodobacterales bacterium HT...   256    8e-67 
ref|YP_001610204.1|  ATP-dependent clp protease, atp-binding s...   256    9e-67  
ref|ZP_01506024.1|  ATPase AAA-2 [Burkholderia phymatum STM815...   256    9e-67 
ref|YP_001566221.1|  ATP-dependent chaperone ClpB [Delftia aci...   256    9e-67  
ref|YP_753199.1|  putative ATPase with chaperone activity, two...   256    9e-67  
ref|YP_849179.1|  ATP-dependent protease clpE [Listeria welshi...   256    1e-66  
ref|YP_679705.1|  heat shock protein with various ATPase domai...   256    1e-66  
ref|YP_233834.1|  AAA ATPase, central region:Clp, N terminal:C...   256    1e-66  
ref|ZP_02909429.1|  ATPase AAA-2 domain protein [Burkholderia ...   256    1e-66 
ref|ZP_00948685.1|  ATP-dependent Clp protease, ATP-binding su...   256    1e-66 
ref|ZP_02426924.1|  hypothetical protein CLORAM_00301 [Clostri...   256    1e-66 
ref|YP_777549.1|  ATPase AAA-2 domain protein [Burkholderia am...   256    1e-66  
ref|YP_001791051.1|  ATP-dependent chaperone ClpB [Leptothrix ...   256    1e-66  
ref|ZP_02092152.1|  hypothetical protein FAEPRAM212_02441 [Fae...   256    1e-66 
ref|ZP_00954139.1|  ATP-dependent Clp protease, ATP-binding su...   256    1e-66 
ref|ZP_01469235.1|  ATPase [Synechococcus sp. BL107] >gb|EAU71...   256    1e-66 
ref|ZP_00952774.1|  endopeptidase Clp: ATP-binding subunit B, ...   256    1e-66 
ref|ZP_02873113.1|  ATP-dependent protease ATP-binding subunit...   256    1e-66 
ref|ZP_02078026.1|  hypothetical protein EUBDOL_01834 [Eubacte...   256    1e-66 
ref|YP_001187860.1|  ATPase AAA-2 domain protein [Pseudomonas ...   256    1e-66  
ref|ZP_00604068.1|  AAA ATPase, central region:Clp, N terminal...   256    1e-66 
ref|YP_621285.1|  ATPase AAA-2 [Burkholderia cenocepacia AU 10...   256    1e-66  
ref|YP_001774681.1|  ATPase AAA-2 domain protein [Burkholderia...   256    1e-66  
ref|YP_759360.1|  ATP-dependent chaperone protein ClpB [Hyphom...   256    2e-66  
ref|NP_901614.1|  ATP-dependent Clp protease subunit; heat-sho...   256    2e-66  
ref|YP_001816399.1|  ATPase AAA-2 domain protein [Burkholderia...   255    2e-66  
ref|YP_001406413.1|  chaperone ClpB [Campylobacter hominis ATC...   255    2e-66  
ref|ZP_01708007.1|  ATPase AAA-2 [Shewanella putrefaciens 200]...   255    2e-66 
gb|EAY67126.1|  AAA ATPase, central region [Burkholderia cenoc...   255    2e-66 
ref|YP_001466745.1|  chaperone ClpB 1 [Campylobacter concisus ...   255    2e-66  
sp|Q96UX5|HSP78_CANAL  Heat shock protein 78, mitochondrial pr...   255    2e-66 
ref|YP_001338508.1|  ATPase with chaperone activity, ATP-bindi...   255    2e-66  
ref|YP_969614.1|  ATPase AAA-2 domain protein [Acidovorax aven...   255    2e-66  
ref|ZP_00976921.1|  COG0542: ATPases with chaperone activity, ...   255    2e-66 
ref|YP_001824938.1|  putative ATP-dependent protease subunit [...   255    2e-66  
ref|NP_645674.1|  hypothetical protein MW0857 [Staphylococcus ...   255    2e-66  
ref|YP_001498924.1|  ClpB [Rickettsia massiliae MTU5] >gb|ABV8...   255    2e-66  
ref|ZP_01982043.1|  clpB protein [Vibrio cholerae 623-39] >gb|...   255    2e-66 
ref|YP_042972.1|  putative ATPase subunit of an ATP-dependent ...   255    2e-66  
ref|YP_040360.1|  putative ATPase subunit of an ATP-dependent ...   255    2e-66  
ref|ZP_02272132.1|  ClpB protein [Fusobacterium nucleatum subs...   255    2e-66 
ref|YP_928475.1|  clpB protein [Shewanella amazonensis SB2B] >...   255    2e-66  
ref|YP_499465.1|  ATP-dependent Clp protease, ATP-binding subu...   255    2e-66  
ref|YP_506019.1|  ClpB protein [Neorickettsia sennetsu str. Mi...   255    2e-66  
ref|ZP_02434714.1|  hypothetical protein BACSTE_00943 [Bactero...   255    2e-66 
ref|YP_034116.1|  ATP-dependent clp protease, ATP-binding subu...   255    3e-66  
sp|P17422.2|CLPB_DICNO  Chaperone protein clpB                      255    3e-66 
ref|ZP_02157403.1|  clpB protein [Shewanella benthica KT99] >g...   255    3e-66 
ref|YP_904357.1|  endopeptidase ATP binding protein (chain B) ...   255    3e-66  
ref|ZP_01734788.1|  putative heat shock ClpB protein [Flavobac...   255    3e-66 
gb|EDK87629.1|  ATP-binding ClpB chaperone [Fusobacterium nucl...   255    3e-66 
ref|YP_873877.1|  ATPase AAA-2 domain protein [Acidothermus ce...   255    3e-66  
ref|NP_371499.1|  ClpB chaperone homolog [Staphylococcus aureu...   254    3e-66  
ref|ZP_01872328.1|  CLP PROTEASE ATP-BINDING SUBUNIT [Caminiba...   254    3e-66 
ref|YP_545279.1|  ATPase AAA-2 [Methylobacillus flagellatus KT...   254    3e-66  
emb|CAO44278.1|  unnamed protein product [Vitis vinifera]           254    3e-66 
ref|YP_001209038.1|  ATP-dependent protease ClpB [Dichelobacte...   254    3e-66  
gb|ABZ94981.1|  ATP-dependent Clp protease [Leptospira biflexa...   254    3e-66 
ref|YP_862297.1|  chaperone ClpB [Gramella forsetii KT0803] >e...   254    3e-66  
ref|XP_648266.1|  AAA family ATPase [Entamoeba histolytica HM-...   254    3e-66  
ref|YP_795664.1|  ATP-binding subunit of Clp protease and DnaK...   254    3e-66  
ref|YP_806976.1|  ATP-binding subunit of Clp protease and DnaK...   254    3e-66  
sp|Q8RHQ8.2|CLPB_FUSNN  Chaperone protein clpB                      254    3e-66 
ref|YP_001475229.1|  ATPase AAA-2 domain protein [Shewanella s...   254    3e-66  
ref|YP_960651.1|  ATPase AAA-2 domain protein [Marinobacter aq...   254    3e-66  
ref|ZP_01891479.1|  putative heat shock ClpB protein [unidenti...   254    3e-66 
gb|EDS89008.1|  hypothetical protein EHI_005657 [Entamoeba his...   254    4e-66 
ref|YP_032669.1|  ATP-dependent clp protease, ATP-binding subu...   254    4e-66  
ref|ZP_02043583.1|  hypothetical protein ACTODO_00427 [Actinom...   254    4e-66 
ref|ZP_01001982.1|  Chaperone ClpB [Loktanella vestfoldensis S...   254    4e-66 
ref|ZP_00588794.1|  ATPas [Pelodictyon phaeoclathratiforme BU-...   254    4e-66 
ref|NP_602741.1|  ClpB protein [Fusobacterium nucleatum subsp....   254    4e-66  
ref|NP_267681.1|  ClpB protein [Lactococcus lactis subsp. lact...   254    4e-66  
ref|ZP_01960435.1|  hypothetical protein BACCAC_02050 [Bactero...   254    4e-66 
ref|YP_001172855.1|  chaperone-associated ATPase, putative [Ps...   254    5e-66  
ref|ZP_00511619.1|  AAA ATPase, central region:Protein of unkn...   254    5e-66 
ref|XP_650916.1|  heat shock protein 101 [Entamoeba histolytic...   254    5e-66  
ref|YP_001372995.1|  ATPase AAA-2 domain protein [Ochrobactrum...   254    5e-66  
ref|YP_001469653.1|  ATPase AAA-2 domain protein [Thermotoga l...   254    5e-66  
gb|EDS89397.1|  heat shock protein, putative [Entamoeba histol...   254    5e-66 
ref|NP_660995.1|  ATP-dependent Clp protease, ATP-binding subu...   254    5e-66  
ref|YP_001580473.1|  ATPase AAA-2 domain protein [Burkholderia...   254    5e-66  
ref|YP_001550110.1|  putative ATP-dependent Clp protease, Hsp ...   254    5e-66  
gb|EDS88935.1|  heat shock protein, putative [Entamoeba histol...   254    5e-66 
ref|ZP_01520999.1|  ATPase AAA-2 [Comamonas testosteroni KF-1]...   254    5e-66 
ref|YP_121618.1|  putative Clp protease ATP-binding subunit [N...   254    6e-66  
ref|XP_648944.1|  AAA family ATPase [Entamoeba histolytica HM-...   254    6e-66  
ref|XP_001739140.1|  heat shock protein, putative [Entamoeba d...   254    6e-66  
ref|YP_001535046.1|  ATPase AAA-2 domain protein [Salinispora ...   254    6e-66  
ref|XP_652630.1|  AAA family ATPase [Entamoeba histolytica HM-...   254    6e-66  
gb|EDS89785.1|  heat shock protein, putative [Entamoeba histol...   254    6e-66 
gb|AAA23344.1|  ATP-dependent protease [Dichelobacter nodosus]      254    6e-66 
ref|YP_001131208.1|  ATPase AAA-2 domain protein [Prosthecochl...   254    6e-66  
ref|YP_389901.1|  ATPase [Desulfovibrio desulfuricans G20] >gb...   253    7e-66  
ref|XP_647882.1|  heat shock protein 101 [Entamoeba histolytic...   253    7e-66  
ref|XP_648214.1|  HSP101-related protein [Entamoeba histolytic...   253    7e-66  
ref|YP_001109282.1|  putative Clp protease ATP-binding subunit...   253    7e-66  
ref|ZP_01091456.1|  negative regulator of genetic competence C...   253    7e-66 
ref|ZP_01079357.1|  putative ATP-dependent Clp protease, Hsp 1...   253    7e-66 
ref|XP_653452.1|  AAA family ATPase [Entamoeba histolytica HM-...   253    7e-66  
ref|YP_823552.1|  ATPase AAA-2 domain protein [Solibacter usit...   253    7e-66  
ref|YP_755881.1|  ATPase AAA-2 domain protein [Maricaulis mari...   253    7e-66  
ref|ZP_01158260.1|  ATP-dependent Clp protease, ATP-binding su...   253    7e-66 
ref|YP_382761.1|  ATPase [Synechococcus sp. CC9605] >gb|ABB362...   253    8e-66  
ref|YP_883920.1|  chaperone ClpB [Mycobacterium avium 104] >gb...   253    8e-66  
ref|YP_063109.1|  ATP-dependent Clp protease, ATP-binding subu...   253    8e-66  
ref|YP_001827966.1|  putative chaperone [Streptomyces griseus ...   253    8e-66  
ref|YP_001156984.1|  ATPase AAA-2 domain protein [Salinispora ...   253    9e-66  
ref|ZP_02094815.1|  hypothetical protein PEPMIC_01583 [Peptost...   253    9e-66 
ref|ZP_00143139.1|  ClpB protein [Fusobacterium nucleatum subs...   253    9e-66 
ref|XP_001736770.1|  heat shock protein, putative [Entamoeba d...   253    1e-65  
ref|NP_859640.1|  ATP-dependent CLP protease ClpA [Helicobacte...   253    1e-65  
ref|YP_535756.1|  Chaperone [Lactobacillus salivarius UCC118] ...   253    1e-65  
ref|YP_814127.1|  ATP-binding subunit of Clp protease and DnaK...   253    1e-65  
ref|NP_972639.1|  ATPase, AAA family [Treponema denticola ATCC...   253    1e-65  
ref|NP_745459.1|  chaperone-associated ATPase, putative [Pseud...   253    1e-65  
ref|ZP_00531652.1|  ATPas [Chlorobium phaeobacteroides BS1] >g...   253    1e-65 
ref|ZP_02250730.1|  ATPase AAA-2 domain protein [Akkermansia m...   253    1e-65 
ref|YP_380264.1|  ATPase [Chlorobium chlorochromatii CaD3] >gb...   253    1e-65  
ref|XP_001736499.1|  heat shock protein, putative [Entamoeba d...   253    1e-65  
ref|YP_559130.1|  Putative ATP-dependent Clp protease, ATP- bi...   253    1e-65  
ref|NP_243045.1|  ATP-dependent proteinase [Bacillus haloduran...   253    1e-65  
ref|NP_813508.1|  endopeptidase Clp ATP-binding chain B [Bacte...   253    1e-65  
gb|EDS88678.1|  chaperone clpB, putative [Entamoeba histolytic...   253    1e-65 
ref|ZP_01517600.1|  ATPase AAA-2 [Comamonas testosteroni KF-1]...   253    1e-65 
ref|NP_470333.1|  ATP-dependent protease [Listeria innocua Cli...   253    1e-65  
ref|ZP_02445002.1|  hypothetical protein ANACOL_04337 [Anaerot...   253    1e-65 
ref|ZP_01690660.1|  chaperone ClpB [Microscilla marina ATCC 23...   253    1e-65 
ref|XP_953433.1|  endopeptidase (CLP homologue) ATP-binding ch...   253    1e-65  
ref|ZP_01121357.1|  endopeptidase Clp ATP-binding chain B [Rob...   253    1e-65 
ref|NP_898435.1|  putative ATP-dependent Clp protease, Hsp 100...   253    1e-65  
ref|YP_594504.1|  ATPases with chaperone activity, ATP-binding...   252    1e-65  
ref|XP_001740777.1|  chaperone Clpb, putative [Entamoeba dispa...   252    1e-65  
ref|ZP_02162596.1|  ATPase AAA-2 [Kordia algicida OT-1] >gb|ED...   252    2e-65 
ref|XP_001741332.1|  heat shock protein, putative [Entamoeba d...   252    2e-65  
ref|ZP_02422906.1|  hypothetical protein EUBSIR_01757 [Eubacte...   252    2e-65 
ref|YP_705452.1|  ATP-binding subunit of heat shock protein Cl...   252    2e-65  
ref|ZP_01941808.1|  negative regulator of genetic competence C...   252    2e-65 
ref|YP_198014.1|  ATP-binding subunit of Clp protease and DnaK...   252    2e-65  
ref|NP_464522.1|  ATP-dependent protease [Listeria monocytogen...   252    2e-65  
ref|YP_193548.1|  ATP-dependent Clp protease, ATP-binding subu...   252    2e-65  
ref|YP_395651.1|  Chaperone ClpB [Lactobacillus sakei subsp. s...   252    2e-65  
ref|ZP_02866770.1|  hypothetical protein CLOSPI_00570 [Clostri...   252    2e-65 
ref|YP_001577121.1|  ATP-dependent Clp protease, ATP-binding s...   252    2e-65  
ref|NP_962787.1|  ClpB [Mycobacterium avium subsp. paratubercu...   252    2e-65  
gb|EDS88661.1|  chaperone clpB, putative [Entamoeba histolytic...   252    2e-65 
ref|XP_763809.1|  hypothetical protein TP04_0174 [Theileria pa...   252    2e-65  
ref|XP_001737903.1|  heat shock protein, putative [Entamoeba d...   251    2e-65  
ref|ZP_02007623.1|  ATPase AAA-2 domain protein [Ralstonia pic...   251    3e-65 
ref|XP_001737197.1|  chaperone Clpb, putative [Entamoeba dispa...   251    3e-65  
ref|YP_001266017.1|  ATPase AAA-2 domain protein [Pseudomonas ...   251    3e-65  
ref|XP_764437.1|  ATP-dependent Clp protease ATP-binding subun...   251    3e-65  
ref|NP_742786.1|  ATP-dependent Clp protease, ATP-binding subu...   251    3e-65  
ref|ZP_01048884.1|  putative heat shock ClpB protein [Cellulop...   251    3e-65 
ref|YP_912989.1|  ATPase AAA-2 domain protein [Chlorobium phae...   251    3e-65  
ref|YP_798201.1|  Endopeptidase Clp, ATP-dependent proteolytic...   251    3e-65  
ref|YP_446924.1|  ATP-dependent chaperone protein ClpB [Salini...   251    3e-65  
ref|ZP_00142463.1|  clpB protein [Rickettsia sibirica 246] >gb...   251    3e-65 
ref|ZP_00628604.1|  AAA ATPase, central region:Clp, N terminal...   251    3e-65  
ref|YP_001666918.1|  ATP-dependent chaperone ClpB [Pseudomonas...   251    3e-65  
ref|NP_964351.1|  ATP-dependent clp protease ATP-binding subun...   251    3e-65  
ref|XP_001735209.1|  heat shock protein, putative [Entamoeba d...   251    3e-65  
ref|YP_001296639.1|  ATPase with chaperone activity ATP-bindin...   251    3e-65  
ref|ZP_00591584.1|  ATPas [Prosthecochloris aestuarii DSM 271]...   251    3e-65 
emb|CAD32531.1|  putative clp protease [uncultured bacterium]       251    4e-65 
ref|YP_925541.1|  ATPase AAA-2 domain protein [Nocardioides sp...   251    4e-65  
ref|YP_416331.1|  putative ATP-dependent protease protein [Sta...   251    4e-65  
ref|XP_001733400.1|  heat shock protein, putative [Entamoeba d...   251    4e-65  
ref|ZP_02185902.1|  ATP-dependent Clp protease, ATP-binding su...   251    4e-65 
emb|CAK99717.1|  putative atpase with chaperone activity, clp ...   251    4e-65 
gb|AAD00218.1|  clpB [Mycobacterium bovis]                          251    4e-65 
ref|NP_214898.1|  PROBABLE ENDOPEPTIDASE ATP BINDING PROTEIN (...   251    4e-65  
gb|EDS88920.1|  chaperone clpB, putative [Entamoeba histolytic...   251    4e-65 
ref|XP_001739061.1|  chaperone protein ClpB, putative [Entamoe...   251    5e-65  
ref|ZP_01313912.1|  ATPase AAA-2 [Desulfuromonas acetoxidans D...   251    5e-65 
ref|YP_942478.1|  chaperone endopeptidase Clp ATP-binding chai...   251    5e-65  
sp|Q4UN57.2|CLPB_RICFE  Chaperone protein clpB                      251    5e-65 
ref|XP_460208.1|  hypothetical protein DEHA0E22000g [Debaryomy...   251    5e-65  
ref|NP_359696.1|  clpB protein [Rickettsia conorii str. Malish...   250    6e-65  
ref|ZP_00983040.1|  COG0542: ATPases with chaperone activity, ...   250    6e-65 
ref|ZP_00369128.1|  clpB protein VC0711 [Campylobacter lari RM...   250    6e-65 
ref|YP_001246351.1|  ATPase AAA-2 domain protein [Staphylococc...   250    7e-65  
ref|ZP_02335869.1|  clpB protein [Rickettsia africae ESF-5]         250    7e-65 
ref|YP_001494172.1|  clpB protein [Rickettsia rickettsii str. ...   250    7e-65  
ref|YP_903983.1|  ATPase AAA-2 domain protein [Candidatus Ruth...   250    8e-65  
ref|YP_001219552.1|  ATP-dependent Clp protease ATP-binding su...   250    8e-65  
ref|ZP_02182995.1|  hypothetical protein FBALC1_09952 [Flavoba...   250    8e-65 
ref|YP_277699.1|  ATP-dependent protease [Candidatus Blochmann...   250    8e-65  
ref|YP_812587.1|  ATP-binding subunit of Clp protease and DnaK...   250    8e-65  
gb|ABI13537.1|  ATP-dependent Clp protease ATP-binding subunit...   250    9e-65 
ref|YP_618666.1|  ATP-dependent Clp protease, ATP-binding subu...   250    9e-65  
ref|YP_001124979.1|  ATP-dependent Clp protease-like (class II...   250    9e-65  
ref|ZP_01011813.1|  ATP-dependent Clp protease, ATP-binding su...   250    9e-65 
ref|YP_988552.1|  chaperone ClpB [Bartonella bacilliformis KC5...   249    1e-64  
ref|YP_817689.1|  ATP-binding subunit of Clp protease and DnaK...   249    1e-64  
ref|YP_001301048.1|  endopeptidase Clp ATP-binding chain B [Ba...   249    1e-64  
ref|YP_001380489.1|  ATPase AAA-2 domain protein [Anaeromyxoba...   249    1e-64  
ref|YP_637655.1|  ATPase AAA-2 [Mycobacterium sp. MCS] >ref|YP...   249    1e-64  
ref|ZP_02073142.1|  hypothetical protein BACUNI_04602 [Bactero...   249    1e-64 
ref|YP_592648.1|  ATPase AAA-2 [Acidobacteria bacterium Ellin3...   249    1e-64  
ref|YP_001692820.1|  ATP-dependent protease Clp ATP-binding su...   249    1e-64  
ref|YP_001195755.1|  ATPase AAA-2 domain protein [Flavobacteri...   249    2e-64  
ref|NP_966034.1|  ATP-dependent Clp protease, ATP-binding subu...   249    2e-64  
ref|YP_288261.1|  ATPase [Thermobifida fusca YX] >gb|AAZ54238....   249    2e-64  
ref|ZP_02094605.1|  hypothetical protein PEPMIC_01372 [Peptost...   249    2e-64 
ref|YP_001105952.1|  clp protease ATP binding subunit [Sacchar...   249    2e-64  
ref|ZP_00373142.1|  ATP-dependent Clp protease, ATP-binding su...   248    2e-64 
ref|ZP_00950628.1|  putative heat shock ClpB protein [Croceiba...   248    2e-64 
ref|ZP_00372220.1|  ATP-dependent Clp protease, ATP-binding su...   248    2e-64 
ref|YP_885138.1|  chaperone ClpB [Mycobacterium smegmatis str....   248    3e-64  
ref|NP_712060.1|  ATPase with chaperone activity, two ATP-bind...   248    3e-64  
ref|YP_197547.1|  ClpB protein [Ehrlichia ruminantium str. Wel...   248    3e-64  
gb|AAC83688.2|  101 kDa heat shock protein; HSP101 [Nicotiana ...   248    3e-64 
ref|YP_001491771.1|  clpB protein [Rickettsia canadensis str. ...   248    3e-64  
ref|YP_804136.1|  ATP-binding subunit of Clp protease and DnaK...   248    3e-64  
ref|YP_180504.1|  heat shock protein ClpB [Ehrlichia ruminanti...   248    3e-64  
ref|YP_001955.1|  ATP-dependent protease [Leptospira interroga...   248    4e-64  
ref|YP_001704992.1|  Chaperone ClpB [Mycobacterium abscessus] ...   248    4e-64  
gb|AAA66338.1|  heat shock protein                                  248    4e-64  
ref|ZP_01314938.1|  hypothetical protein Wendoof_01000216 [Wol...   247    5e-64 
ref|YP_001131528.1|  ATPase AAA-2 domain protein [Mycobacteriu...   247    5e-64  
ref|XP_001415741.1|  chaperone, Hsp100 family, ClpB-type [Ostr...   247    5e-64  
ref|NP_249150.1|  probable ClpA/B protease ATP binding subunit...   247    6e-64  
ref|NP_984638.1|  AEL223Cp [Ashbya gossypii ATCC 10895] >gb|AA...   247    6e-64  
ref|NP_222970.1|  HEAT SHOCK PROTEIN [Helicobacter pylori J99]...   247    6e-64  
ref|YP_001728873.1|  ATPase with chaperone activity, ATP-bindi...   247    6e-64  
ref|ZP_02030459.1|  hypothetical protein PARMER_00430 [Parabac...   247    6e-64 
gb|EAZ54753.1|  hypothetical protein PACG_03381 [Pseudomonas a...   247    6e-64 
ref|YP_788632.1|  putative ClpA/B protease ATP binding subunit...   247    6e-64  
ref|YP_664343.1|  ATP-dependent Clp protease, ATP-binding subu...   247    7e-64  
gb|AAA67927.1|  AtHSP101                                            247    7e-64 
ref|ZP_00967188.1|  COG0542: ATPases with chaperone activity, ...   247    7e-64 
ref|ZP_01909579.1|  ATP-dependent chaperone protein ClpB [Ples...   247    7e-64 
ref|NP_565083.1|  ATHSP101 (HEAT SHOCK PROTEIN 101); ATP bindi...   247    7e-64  
ref|ZP_02068377.1|  hypothetical protein BACOVA_05393 [Bactero...   247    7e-64 
ref|ZP_01363362.1|  hypothetical protein PaerPA_01000456 [Pseu...   247    7e-64 
gb|ACB42801.1|  putative ATP-dependent Clp protease, Hsp 100, ...   247    8e-64 
ref|ZP_01691216.1|  chaperone ClpB [Microscilla marina ATCC 23...   247    8e-64 
ref|XP_505330.1|  hypothetical protein [Yarrowia lipolytica] >...   247    8e-64  
ref|NP_784926.1|  ATP-dependent Clp protease, ATP-binding subu...   246    8e-64  
ref|ZP_01507392.1|  ATPase AAA-2 [Burkholderia phytofirmans Ps...   246    8e-64 
ref|YP_210841.1|  putative heat shock ClpB protein [Bacteroide...   246    8e-64  
ref|ZP_00972399.1|  COG0542: ATPases with chaperone activity, ...   246    8e-64 
ref|ZP_00371777.1|  ATP-dependent Clp protease, ATP-binding su...   246    9e-64 
ref|XP_721128.1|  hypothetical protein CaO19_8503 [Candida alb...   246    9e-64  
ref|ZP_00231737.1|  negative regulator of genetic competence C...   246    1e-63 
ref|ZP_02319886.1|  ATP-dependent Clp protease, ATP-binding su...   246    1e-63 
ref|ZP_02912919.1|  ATPase AAA-2 domain protein [Geobacillus s...   246    1e-63 
ref|ZP_01926925.1|  negative regulator of genetic competence C...   246    1e-63 
ref|YP_053661.1|  ATPase subunit of ATP-dependant protease [Me...   246    1e-63  
ref|YP_001486504.1|  S14 family endopeptidase ClpE [Bacillus p...   246    1e-63  
ref|ZP_02915777.1|  ATPase AAA-2 domain protein [Candidatus Am...   246    1e-63 
ref|YP_001345959.1|  probable ClpA/B protease ATP binding subu...   246    1e-63  
gb|AAQ83842.1|  ATP-dependent Clp proteinase-like protein [Bac...   246    1e-63 
ref|ZP_01254403.1|  endopeptidase Clp ATP-binding chain B [Psy...   246    1e-63 
ref|NP_596117.1|  mitochondrial matrix chaperone Hsp78 (predic...   246    1e-63  
ref|YP_098489.1|  endopeptidase Clp ATP-binding chain B [Bacte...   246    1e-63  
ref|YP_001504602.1|  ATPase AAA-2 domain protein [Frankia sp. ...   246    1e-63  
ref|ZP_01060964.1|  putative heat shock ClpB protein [Flavobac...   246    1e-63 
ref|NP_878485.1|  ATP-dependent protease, Hsp 100, part of nov...   246    1e-63  
ref|NP_964670.1|  ATP-dependent clp protease ATP-binding subun...   245    2e-63  
ref|YP_840901.1|  ATP-dependent protease Clp, ATPase subunit [...   245    2e-63  
ref|YP_007727.1|  probable endopeptidase Clp ATP-binding chain...   245    2e-63  
gb|AAC16900.1|  ClpB chaperone homolog [Lactococcus lactis sub...   245    2e-63 
ref|YP_013618.1|  ATP-dependent Clp protease, ATP-binding subu...   245    2e-63  
ref|YP_001032307.1|  ATP-dependent Clp protease [Lactococcus l...   245    3e-63  
ref|XP_001269148.1|  heat shock protein/chaperonin HSP78, puta...   245    3e-63  
ref|YP_809534.1|  ATP-binding subunit of Clp protease and DnaK...   244    3e-63  
ref|YP_001302606.1|  endopeptidase Clp ATP-binding chain B [Pa...   244    3e-63  
ref|YP_815163.1|  ATP-binding subunit of Clp protease and DnaK...   244    4e-63  
ref|XP_001767261.1|  predicted protein [Physcomitrella patens ...   244    4e-63  
ref|YP_196588.1|  ClpB protein [Ehrlichia ruminantium str. Gar...   244    4e-63  
ref|NP_892328.1|  putative ATP-dependent Clp protease, Hsp 100...   244    4e-63  
ref|XP_001528763.1|  heat shock protein 78, mitochondrial prec...   244    5e-63  
emb|CAI94866.2|  heat shock protein 101 [Triticum turgidum sub...   244    5e-63 
ref|ZP_01172205.1|  ATP-dependent Clp protease-like (class III...   244    5e-63 
ref|YP_951503.1|  ATPase AAA-2 domain protein [Mycobacterium v...   244    5e-63  
ref|YP_330445.1|  ATP-dependent Clp protease, ATP-binding subu...   244    5e-63  
emb|CAN72669.1|  hypothetical protein [Vitis vinifera]              244    5e-63 
ref|NP_722326.1|  class III stress response-related ATP-depend...   244    5e-63  
ref|YP_538542.1|  ClpB [Rickettsia bellii RML369-C] >ref|YP_00...   244    6e-63  
emb|CAO64447.1|  unnamed protein product [Vitis vinifera]           244    6e-63 
gb|AAX08108.1|  heat shock protein 101 [Vitis vinifera]             244    6e-63 
gb|AAD17691.1|  ATP-dependent protease ClpE [Listeria monocyto...   244    6e-63 
ref|ZP_00785186.1|  ATP-dependent Clp protease, ATP-binding su...   244    6e-63 
emb|CAL49983.1|  CLPB1_SYNEL Chaperone clpB 1 dbj|BAC08941.1| ...   244    6e-63 
emb|CAI65391.1|  ATP-dependent Clp protease, ATP binding subun...   244    6e-63 
ref|YP_810129.1|  ATP-binding subunit of Clp protease and DnaK...   244    7e-63  
ref|YP_303277.1|  AAA ATPase, central region:Clp, N terminal [...   243    7e-63  
ref|YP_627007.1|  ATP-dependent protease binding subunit/heat ...   243    7e-63  
ref|ZP_02919277.1|  hypothetical protein STRINF_00112 [Strepto...   243    8e-63 
ref|ZP_01544252.1|  stress response-related ATPase, class III ...   243    8e-63 
emb|CAI94867.2|  heat shock protein 101 [Triticum turgidum sub...   243    9e-63 
gb|AAF01280.1|AF174433_1  heat shock protein 101 [Triticum aes...   243    9e-63  
ref|ZP_01051988.1|  putative heat shock ClpB protein [Tenaciba...   243    1e-62 
emb|CAJ31810.1|  101 kDa heat shock protein [Aegilops umbellul...   243    1e-62 
emb|CAJ31809.1|  101 kDa heat shock protein [Aegilops umbellul...   243    1e-62 
ref|NP_688818.1|  ATP-dependent Clp protease, ATP-binding subu...   243    1e-62  
gb|EAY71883.1|  ATPase with chaperone activity ATP-binding sub...   243    1e-62 
ref|NP_721783.1|  putative Clp proteinase, ATP-binding subunit...   243    1e-62  
ref|NP_266713.1|  ATP-dependent protease ATP-binding subunit [...   243    1e-62  
ref|YP_535279.1|  ATP-dependent clp protease ATP-binding subun...   243    1e-62  
ref|YP_808572.1|  ATP-binding subunit of Clp protease and DnaK...   243    1e-62  
ref|YP_396074.1|  ATPase/chaperone ClpE, putative specificity ...   243    1e-62  
ref|XP_001609933.1|  ClpB, putative [Babesia bovis] >gb|EDO063...   242    2e-62  
ref|NP_789679.1|  heat shock protein ClpB [Tropheryma whipplei...   242    2e-62  
ref|NP_787874.1|  ATP-dependent protase ATP-binding subunit [T...   242    2e-62  
ref|YP_001031878.1|  ATP-dependent Clp protease ATP-binding su...   242    2e-62  
gb|AAO49455.1|AF487263_3  heat shock protein 78 [Leptosphaeria...   242    2e-62 
ref|NP_207062.1|  ATP-dependent protease binding subunit (clpB...   242    2e-62  
ref|YP_141013.1|  ATP-dependent Clp protease [Streptococcus th...   242    2e-62  
ref|YP_139123.1|  ATP-dependent Clp protease [Streptococcus th...   242    2e-62  
gb|AAD22629.1|AF097363_1  heat shock protein 101 [Triticum aes...   242    2e-62  
ref|YP_818058.1|  ATP-binding subunit of Clp protease and DnaK...   242    2e-62  
ref|XP_001483083.1|  hypothetical protein PGUG_05038 [Pichia g...   242    2e-62  
ref|YP_820106.1|  ATP-binding subunit of Clp protease and DnaK...   242    2e-62  
ref|YP_293114.1|  AAA ATPase, central region:Clp, N terminal [...   242    2e-62  
gb|AAD01782.1|  ClpE [Lactococcus lactis]                           242    2e-62 
ref|XP_635137.1|  AAA ATPase domain-containing protein [Dictyo...   242    2e-62  
emb|CAI94865.2|  heat shock protein 101 [Triticum turgidum sub...   242    2e-62 
gb|AAD26530.1|AF083327_1  101 kDa heat shock protein [Zea mays]     241    3e-62  
ref|YP_001200044.1|  ATPases with chaperone activity, ATP-bind...   241    3e-62  
ref|YP_001035096.1|  ATPases with chaperone activity, ATP-bind...   241    3e-62  
gb|AAS87594.1|  putative heat shock protein [Solanum phureja]       241    3e-62 
ref|YP_001197858.1|  ATPases with chaperone activity, ATP-bind...   241    3e-62  
emb|CAI94864.2|  heat shock protein 101 [Triticum turgidum sub...   241    3e-62 
ref|XP_001566479.1|  ATP-dependent Clp protease subunit, heat ...   241    3e-62  
ref|NP_001104935.1|  heat-shock protein 101 [Zea mays] >gb|AAD...   241    3e-62  
gb|AAC83689.2|  101 kDa heat shock protein; HSP101 [Triticum a...   241    3e-62 
ref|ZP_01506759.1|  ATPase AAA-2 [Burkholderia phytofirmans Ps...   241    4e-62 
gb|EAY98724.1|  hypothetical protein OsI_019957 [Oryza sativa ...   241    4e-62 
sp|Q54316|HLYB_TREHY  Hemolysin B >emb|CAA51655.1| hemolysin [...   241    4e-62 
ref|XP_001220867.1|  conserved hypothetical protein [Chaetomiu...   241    4e-62  
ref|NP_001056066.1|  Os05g0519700 [Oryza sativa (japonica cult...   241    4e-62  
ref|NP_389253.1|  ATP-dependent Clp protease-like (class III s...   241    4e-62  
gb|EAZ34966.1|  hypothetical protein OsJ_018449 [Oryza sativa ...   241    5e-62 
ref|YP_504852.1|  ATP-dependent chaperone protein ClpB [Anapla...   241    5e-62  
gb|AAS87593.1|  putative heat shock protein [Solanum tuberosum...   241    5e-62 
gb|ABK22818.1|  unknown [Picea sitchensis]                          241    5e-62 
ref|ZP_01471323.1|  putative ATP-dependent Clp protease, Hsp 1...   240    6e-62 
ref|ZP_02090178.1|  hypothetical protein FAEPRAM212_00416 [Fae...   240    6e-62 
ref|NP_814457.1|  ATP-dependent Clp protease, ATP-binding subu...   240    7e-62  
ref|YP_001009029.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   240    7e-62  
ref|YP_481876.1|  ATPase AAA-2 [Frankia sp. CcI3] >gb|ABD12147...   240    7e-62  
ref|YP_001492858.1|  clpB protein [Rickettsia akari str. Hartf...   240    7e-62  
ref|YP_001483863.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   240    7e-62  
ref|NP_302608.1|  heat shock protein [Mycobacterium leprae TN]...   240    7e-62  
ref|ZP_01452722.1|  putative ATPase with chaperone activity, t...   240    8e-62 
ref|YP_001010552.1|  putative ATP-dependent Clp protease, Hsp ...   240    8e-62  
ref|YP_819655.1|  ATP-binding subunit of Clp protease and DnaK...   240    8e-62  
ref|NP_720997.1|  ATP-dependent protease ClpE [Streptococcus m...   240    8e-62  
ref|ZP_00544710.1|  AAA ATPase, central region:Clp, N terminal...   240    8e-62 
ref|YP_140508.1|  ATP-dependent Clp protease, ATP-binding subu...   240    9e-62  
ref|YP_138621.1|  ATP-dependent Clp protease, ATP-binding subu...   240    9e-62  
ref|XP_454711.1|  unnamed protein product [Kluyveromyces lacti...   240    9e-62  
ref|YP_424350.1|  ATP-dependent Clp protease, ATP-binding subu...   240    9e-62  
ref|NP_975593.1|  ATP dependant protease ClpB [Mycoplasma myco...   239    1e-61  
ref|YP_067062.1|  ATP-binding ClpB chaperone [Rickettsia typhi...   239    1e-61  
ref|ZP_02184997.1|  ATP-dependent Clp protease, ATP-binding su...   239    1e-61 
ref|XP_001797402.1|  hypothetical protein SNOG_07047 [Phaeosph...   239    1e-61  
ref|ZP_02424936.1|  hypothetical protein ALIPUT_01070 [Alistip...   239    1e-61 
ref|XP_001748844.1|  predicted protein [Monosiga brevicollis M...   239    1e-61  
ref|XP_752483.1|  heat shock protein/chaperonin HSP78 [Aspergi...   239    2e-61  
emb|CAA69406.1|  heat shock protein [Helicobacter pylori]           239    2e-61 
ref|XP_001210406.1|  heat shock protein 78, mitochondrial prec...   239    2e-61  
ref|YP_812435.1|  ATP-binding subunit of Clp protease and DnaK...   239    2e-61  
ref|ZP_00603582.1|  UvrB/UvrC protein:AAA ATPase, central regi...   239    2e-61 
ref|XP_847791.1|  Serine peptidase, putative [Leishmania major...   239    2e-61  
emb|CAC87117.1|  heat shock protein 101 [Oryza sativa (japonic...   239    2e-61 
ref|XP_001698806.1|  ClpB chaperone, Hsp100 family [Chlamydomo...   239    2e-61  
ref|ZP_01833778.1|  ATP-dependent Clp protease, ATP-binding su...   239    2e-61 
ref|XP_001264651.1|  heat shock protein/chaperonin HSP78, puta...   239    2e-61  
ref|YP_618512.1|  ATP-dependent Clp protease, ATP-binding subu...   238    2e-61  
ref|NP_296935.1|  ATP-dependent Clp protease, ATP-binding subu...   238    2e-61  
ref|ZP_02717118.1|  ATP-dependent Clp protease ATP-binding sub...   238    2e-61 
ref|ZP_01829182.1|  ATP-dependent Clp protease ATP-binding sub...   238    2e-61 
ref|NP_345312.1|  ATP-dependent Clp protease, ATP-binding subu...   238    2e-61  
ref|ZP_01819070.1|  ATP-dependent Clp protease ATP-binding sub...   238    2e-61 
ref|NP_358319.1|  ATP dependent protease [Streptococcus pneumo...   238    2e-61  
ref|ZP_02715055.1|  ATP-dependent Clp protease ATP-binding sub...   238    2e-61 
ref|ZP_02710278.1|  ATP-dependent Clp protease ATP-binding sub...   238    2e-61 
ref|ZP_01125295.1|  putative ATP-dependent Clp protease, Hsp 1...   238    2e-61 
ref|ZP_02709430.1|  negative regulator of genetic competence C...   238    3e-61 
ref|ZP_01827966.1|  ATP-dependent Clp protease, ATP-binding su...   238    3e-61 
ref|ZP_01822182.1|  ATP-dependent Clp protease ATP-binding sub...   238    3e-61 
ref|NP_687518.1|  ATP-dependent Clp protease, ATP-binding subu...   238    3e-61  
emb|CAA86116.1|  100 kDa heat shock protein (Hsp100) [Leishman...   238    3e-61 
ref|ZP_00785116.1|  ATP-dependent Clp protease, ATP-binding su...   238    3e-61 
ref|ZP_00790824.1|  ATP-dependent Clp protease, ATP-binding su...   238    3e-61 
ref|YP_292765.1|  ATPase [Prochlorococcus marinus str. NATL2A]...   238    3e-61  
ref|ZP_01817785.1|  ATP-dependent Clp protease, ATP-binding su...   238    3e-61 
ref|ZP_01275211.1|  UvrB/UvrC protein:AAA ATPase, central regi...   238    3e-61 
ref|YP_001695552.1|  chaperone ClpB 1 [Streptococcus pneumonia...   238    3e-61  
ref|NP_734999.1|  hypothetical protein gbs0535 [Streptococcus ...   238    3e-61  
ref|NP_346605.1|  ATP-dependent Clp protease, ATP-binding subu...   238    3e-61  
ref|ZP_02709301.1|  chaperone ClpB 1 [Streptococcus pneumoniae...   238    3e-61 
ref|YP_001836879.1|  ATP-dependent Clp protease, ATP-binding s...   238    3e-61  
ref|ZP_01821720.1|  ATP-dependent Clp protease, ATP-binding su...   238    3e-61 
ref|YP_810247.1|  ATP-binding subunit of Clp protease and DnaK...   238    3e-61  
ref|ZP_02721971.1|  ATP-dependent Clp protease, ATP-binding su...   238    4e-61 
ref|YP_817407.1|  ATP-dependent Clp protease, ATP-binding subu...   238    4e-61  
gb|AAR37417.1|  heat shock protein HSP101 [Zea mays]                238    4e-61 
ref|ZP_01821515.1|  ATP-dependent Clp protease, ATP-binding su...   238    4e-61 
gb|ABO43774.1|  ClpE [Lactobacillus reuteri]                        238    4e-61 
ref|NP_220430.1|  CLPB PROTEIN (clpB) [Rickettsia prowazekii s...   238    4e-61  
ref|ZP_02713467.1|  ATP-dependent Clp protease, ATP-binding su...   238    4e-61 
ref|YP_001226100.1|  Chaperone ClpB [Synechococcus sp. WH 7803...   238    4e-61  
ref|YP_001090830.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   238    5e-61  
gb|ACB43206.1|  endopeptidase Clp ATP-binding chain C [Pauline...   237    5e-61 
ref|ZP_02011238.1|  ATPase AAA-2 domain protein [Opitutaceae b...   237    7e-61 
ref|YP_001449990.1|  ATP dependent Clp protease, ATP-binding s...   237    8e-61  
ref|ZP_01831371.1|  ATP-dependent Clp protease, ATP-binding su...   237    8e-61 
ref|NP_219791.1|  ClpC Protease ATPase [Chlamydia trachomatis ...   237    8e-61  
ref|YP_001420940.1|  ClpE [Bacillus amyloliquefaciens FZB42] >...   236    8e-61  
ref|YP_328094.1|  negative regulator of genetic competence [Ch...   236    8e-61  
ref|YP_001109041.1|  clp protease ATP binding subunit [Sacchar...   236    8e-61  
ref|ZP_02718188.1|  ATP-dependent Clp protease, ATP-binding su...   236    9e-61 
ref|XP_361992.2|  conserved hypothetical protein [Magnaporthe ...   236    9e-61  
ref|YP_001654615.1|  ATP-dependent Clp protease [Chlamydia tra...   236    9e-61  
ref|XP_001612023.1|  Clp amino terminal domain containing prot...   236    1e-60  
ref|YP_001014112.1|  putative ATP-dependent Clp protease, Hsp ...   236    1e-60  
ref|XP_001466653.1|  ATP-dependent Clp protease subunit, heat ...   236    1e-60  
gb|AAB09427.1|  ClpB [Mycoplasma capricolum]                        236    1e-60 
ref|NP_010544.1|  Oligomeric mitochondrial matrix chaperone th...   236    1e-60  
ref|ZP_01502714.1|  ATPase AAA-2 [Burkholderia phymatum STM815...   236    1e-60 
ref|YP_397077.1|  ATPase [Prochlorococcus marinus str. MIT 931...   236    1e-60  
gb|EDN60590.1|  heat shock protein 78 [Saccharomyces cerevisia...   236    2e-60 
ref|YP_001034657.1|  ATP dependent protease, putative [Strepto...   236    2e-60  
gb|AAC37362.1|  heat shock protein 78                               236    2e-60 
emb|CAB08073.1|  heat shock protein 100 [Leishmania donovani]       236    2e-60 
ref|YP_001271921.1|  ATPase AAA-2 domain protein [Lactobacillu...   236    2e-60  
ref|NP_892698.1|  ATP-dependent Clp protease, Hsp 100, ATP-bin...   235    2e-60  
ref|YP_008510.1|  probable endopeptidase ATP-binding chain clp...   235    2e-60  
ref|ZP_02710811.1|  ATP-dependent Clp protease, ATP-binding su...   235    2e-60 
ref|YP_601393.1|  Negative regulator of genetic competence clp...   235    3e-60  
ref|XP_651134.1|  heat shock protein 101 [Entamoeba histolytic...   235    3e-60  
ref|YP_731918.1|  ATPases with chaperone activity, ATP-binding...   235    3e-60  
ref|NP_665571.1|  putative endopeptidase Clp ATP-binding chain...   235    3e-60  
ref|ZP_01697710.1|  ATPase AAA-2 [Bacillus coagulans 36D1] >gb...   235    3e-60 
ref|YP_597504.1|  negative regulator of genetic competence [St...   235    3e-60  
ref|YP_001129239.1|  putative stress response-related Clp ATPa...   235    3e-60  
ref|ZP_01543808.1|  ATP-dependent Clp protease-like [Oenococcu...   235    3e-60 
ref|ZP_01835717.1|  ATP-dependent Clp protease ATP-binding sub...   234    3e-60 
ref|NP_608085.1|  putative endopeptidase Clp ATP-binding chain...   234    3e-60  
emb|CAH41011.1|  clpL2 protein [Oenococcus oeni]                    234    3e-60 
ref|XP_802639.1|  ATP-dependent Clp protease subunit, heat sho...   234    3e-60  
ref|YP_281214.1|  negative regulator of genetic competence [St...   234    3e-60  
ref|NP_905329.1|  clpB protein [Porphyromonas gingivalis W83] ...   234    3e-60  
ref|YP_061080.1|  ClpC [Streptococcus pyogenes MGAS10394] >gb|...   234    4e-60  
ref|YP_001036114.1|  ATP-dependent Clp protease, ATP-binding s...   234    4e-60  
ref|YP_596966.1|  ATP-dependent endopeptidase clp ATP-binding ...   234    4e-60  
ref|NP_270008.1|  putative endopeptidase Clp ATP-binding chain...   234    4e-60  
ref|XP_001908246.1|  unnamed protein product [Podospora anseri...   234    5e-60  
ref|XP_449729.1|  hypothetical protein CAGL0M08822g [Candida g...   234    5e-60  
ref|XP_001747710.1|  predicted protein [Monosiga brevicollis M...   234    5e-60  
ref|XP_001382316.2|  Heat shock protein 78, mitochondrial prec...   234    5e-60  
ref|YP_001199341.1|  ATPases with chaperone activity, ATP-bind...   234    6e-60  
ref|YP_280644.1|  ATP-dependent Clp protease ATP-binding subun...   233    7e-60  
ref|NP_664967.1|  putative ATP-dependent protease [Streptococc...   233    7e-60  
ref|YP_001128183.1|  putative ATP-dependent Clp protease ATP-b...   233    7e-60  
ref|NP_607597.1|  putative ATP-dependent protease [Streptococc...   233    7e-60  
ref|YP_060579.1|  ATP-dependent clp protease ATP-binding subun...   233    7e-60  
ref|YP_602841.1|  ATP-dependent endopeptidase clp ATP-binding ...   233    8e-60  
ref|NP_300494.1|  ClpC protease [Chlamydophila pneumoniae J138...   233    8e-60  
ref|ZP_02036713.1|  hypothetical protein BACCAP_02324 [Bactero...   233    8e-60 
ref|NP_224637.1|  ClpC Protease [Chlamydophila pneumoniae CWL0...   233    8e-60  
ref|NP_444865.1|  ATP-dependent Clp protease, ATP-binding subu...   233    8e-60  
ref|ZP_02091244.1|  hypothetical protein FAEPRAM212_01515 [Fae...   233    8e-60 
ref|YP_176943.1|  ATP-dependent Clp protease ATP-binding subun...   233    1e-59  
ref|NP_269585.1|  putative ATP-dependent protease [Streptococc...   233    1e-59  
ref|XP_964055.1|  heat shock protein 78, mitochondrial precurs...   233    1e-59  
ref|YP_282603.1|  ATP-dependent clp protease ATP-binding subun...   233    1e-59  
gb|EAY86173.1|  hypothetical protein OsI_007406 [Oryza sativa ...   233    1e-59 
ref|XP_654068.1|  heat shock protein 101 [Entamoeba histolytic...   233    1e-59  
dbj|BAD27912.1|  putative endopeptidase Clp ATP-binding chain ...   233    1e-59 
ref|YP_001696949.1|  Chaperone clpB [Lysinibacillus sphaericus...   233    1e-59  
gb|AAO73810.2|  heat shock protein CLPA [Paracoccidioides bras...   233    1e-59 
ref|XP_001392464.1|  hypothetical protein An08g03480 [Aspergil...   233    1e-59  
ref|YP_603351.1|  Negative regulator of genetic competence clp...   233    1e-59  
ref|YP_001201537.1|  ATPases with chaperone activity, ATP-bind...   233    1e-59  
ref|NP_218988.1|  ATPase (clpC) [Treponema pallidum subsp. pal...   232    2e-59  
ref|ZP_01820255.1|  ATP-dependent Clp protease, ATP-binding su...   232    2e-59 
ref|ZP_02919786.1|  hypothetical protein STRINF_00638 [Strepto...   232    2e-59 
ref|XP_636444.1|  AAA ATPase domain-containing protein [Dictyo...   232    2e-59  
ref|YP_001451248.1|  ATP-dependent Clp proteinase, ATP-binding...   232    2e-59  
ref|NP_001047048.1|  Os02g0537400 [Oryza sativa (japonica cult...   232    2e-59  
ref|XP_001243073.1|  conserved hypothetical protein [Coccidioi...   232    2e-59  
ref|YP_001018769.1|  putative ATP-dependent Clp protease, Hsp ...   231    3e-59  
ref|YP_001090451.1|  putative ATP-dependent Clp protease, Hsp ...   231    3e-59  
ref|NP_691802.1|  ATP-dependent Clp proteinase [Oceanobacillus...   231    3e-59  
ref|YP_396707.1|  ATPase [Prochlorococcus marinus str. MIT 931...   231    3e-59  
ref|YP_001010961.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   231    4e-59  
ref|XP_679991.1|  hypothetical protein PB000872.00.0 [Plasmodi...   231    4e-59  
ref|NP_895909.1|  putative ATP-dependent Clp protease, Hsp 100...   231    4e-59  
ref|XP_725369.1|  heat shock protein ClpB [Plasmodium yoelii y...   231    4e-59  
ref|XP_001229857.1|  heat shock protein HSP98 [Chaetomium glob...   231    5e-59  
ref|XP_381191.1|  hypothetical protein FG01015.1 [Gibberella z...   231    5e-59  
ref|XP_957228.1|  heat shock protein 101 [Neurospora crassa OR...   231    5e-59  
ref|NP_829225.1|  ATP-dependent Clp protease, ATP-binding subu...   231    5e-59  
ref|ZP_01726104.1|  ClpB [Bacillus sp. B14905] >gb|EAZ83380.1|...   231    5e-59 
ref|XP_001825230.1|  hypothetical protein [Aspergillus oryzae ...   230    6e-59  
ref|XP_001740003.1|  chaperone Clpb, putative [Entamoeba dispa...   230    6e-59  
ref|XP_658767.1|  hypothetical protein AN1163.2 [Aspergillus n...   230    6e-59  
emb|CAD10780.2|  HSP100 protein [Phycomyces blakesleeanus] >em...   230    7e-59 
ref|XP_369944.1|  hypothetical protein MGG_06459 [Magnaporthe ...   230    8e-59  
ref|XP_001243782.1|  hypothetical protein CIMG_03223 [Coccidio...   230    9e-59  
ref|YP_219762.1|  negative regulator of genetic competence clp...   230    9e-59  
ref|YP_001728546.1|  ATPases with chaperone activity, ATP-bind...   230    9e-59  
ref|ZP_00365685.1|  COG0542: ATPases with chaperone activity, ...   229    1e-58 
ref|XP_001546108.1|  heat shock protein [Botryotinia fuckelian...   229    1e-58  
ref|XP_951576.1|  heat shock protein 78 [Trypanosoma brucei TR...   229    1e-58  
ref|XP_001349358.1|  hypothetical protein PF08_0063 [Plasmodiu...   229    2e-58  
ref|YP_001008620.1|  putative ATP-dependent Clp protease, Hsp ...   229    2e-58  
ref|YP_515569.1|  ATP-dependent Clp endopeptidase ATP-binding ...   229    2e-58  
ref|XP_001566028.1|  ATP-dependent Clp protease subunit, heat ...   229    2e-58  
ref|XP_951738.1|  ATP-dependent Clp protease subunit, heat sho...   229    2e-58  
sp|P31543|CLP_TRYBB  Heat shock protein 100 (Protein CLP) >gb|...   228    2e-58 
ref|XP_001615005.1|  chaperone clpB 1, putative [Plasmodium vi...   228    2e-58  
ref|YP_078710.1|  ATP-dependent Clp protease-like (class III s...   228    2e-58  
ref|ZP_02170205.1|  Fibronectin, type III domain protein [Baci...   228    2e-58 
ref|YP_001483431.1|  putative ATP-dependent Clp protease, Hsp ...   228    3e-58  
pir||E35905  endopeptidase Clp (EC 3.4.21.-) ATP-binding chain...   228    3e-58 
ref|XP_001912654.1|  unnamed protein product [Podospora anseri...   228    3e-58  
ref|YP_001621109.1|  ATP-dependent Clp protease ATP-binding su...   228    3e-58  
ref|NP_296767.1|  ATP-dependent Clp protease, subunit B [Chlam...   228    4e-58  
ref|XP_566689.1|  heat shock protein [Cryptococcus neoformans ...   228    4e-58  
ref|NP_596503.1|  heat shock protein Hsp104 (predicted) [Schiz...   228    4e-58  
ref|ZP_01083628.1|  putative ATP-dependent Clp protease, Hsp 1...   228    4e-58 
ref|XP_752896.1|  heat shock protein Hsp98/Hsp104/ClpA [Asperg...   227    5e-58  
ref|XP_001647396.1|  hypothetical protein Kpol_1018p70 [Vander...   227    6e-58  
ref|XP_001389736.1|  hypothetical protein An01g13350 [Aspergil...   227    7e-58  
ref|YP_515295.1|  ATP-dependent Clp endopeptidase ATP-binding ...   227    7e-58  
ref|YP_001654452.1|  chaperone-protease ClpB [Chlamydia tracho...   227    7e-58  
ref|YP_001653464.1|  chaperone-protease ClpB [Chlamydia tracho...   227    7e-58  
ref|NP_219616.1|  Clp Protease ATPase [Chlamydia trachomatis D...   227    7e-58  
ref|YP_327914.1|  ClpB [Chlamydia trachomatis A/HAR-13] >gb|AA...   227    7e-58  
ref|XP_745474.1|  hypothetical protein PC000511.02.0 [Plasmodi...   226    9e-58  
ref|XP_001586571.1|  hypothetical protein SS1G_12558 [Scleroti...   226    1e-57  
ref|XP_001792623.1|  hypothetical protein SNOG_02004 [Phaeosph...   226    1e-57  
ref|YP_314995.1|  ATP-dependent Clp protease, ATP-binding subu...   226    1e-57  
ref|YP_016062.1|  ATP-dependent Clp protease, ATPase subunit [...   226    1e-57  
gb|AAA88777.1|  ClpB                                                226    1e-57 
ref|ZP_02081522.1|  hypothetical protein CLOLEP_02998 [Clostri...   226    2e-57 
ref|XP_001264231.1|  heat shock protein Hsp98/Hsp104/ClpA, put...   225    2e-57  
ref|XP_001558489.1|  hypothetical protein BC1G_03338 [Botryoti...   225    3e-57  
ref|XP_658462.1|  hypothetical protein AN0858.2 [Aspergillus n...   224    3e-57  
ref|XP_001592469.1|  conserved hypothetical protein [Sclerotin...   224    4e-57  
ref|XP_001818161.1|  hypothetical protein [Aspergillus oryzae ...   224    4e-57  
ref|YP_001305849.1|  ATPase AAA-2 domain protein [Thermosipho ...   224    4e-57  
ref|ZP_00743154.1|  ClpB protein [Bacillus thuringiensis serov...   224    4e-57 
ref|ZP_02245562.1|  endopeptidase ATP binding protein subunit ...   224    5e-57 
ref|ZP_02422592.1|  hypothetical protein EUBSIR_01441 [Eubacte...   224    5e-57 
ref|YP_194739.1|  ATP-dependent protease [Lactobacillus acidop...   224    5e-57  
ref|XP_001873798.1|  predicted protein [Laccaria bicolor S238N...   224    5e-57  
ref|ZP_01551799.1|  ATPase with chaperone activity [Methylophi...   224    5e-57 
ref|XP_822269.1|  serine peptidase, putative [Leishmania major...   224    7e-57  
ref|NP_874627.1|  ATPase with chaperone activity, ATP-binding ...   223    8e-57  
ref|XP_001462758.1|  ATP-dependent Clp protease subunit, heat ...   223    1e-56  
ref|YP_966976.1|  ATP-dependent Clp protease, ATP-binding subu...   223    1e-56  
ref|XP_648318.1|  heat shock protein 101 [Entamoeba histolytic...   223    1e-56  
ref|YP_010821.1|  ATP-dependent Clp protease, ATP-binding subu...   223    1e-56  
ref|NP_044564.1|  Clp protease ATP binding subunit [Toxoplasma...   223    1e-56  
ref|NP_829489.1|  ATP-dependent Clp protease, subunit B [Chlam...   223    1e-56  
ref|XP_001268738.1|  heat shock protein Hsp98/Hsp104/ClpA, put...   223    1e-56  
ref|XP_001729295.1|  hypothetical protein MGL_3762 [Malassezia...   223    2e-56  
ref|XP_001828710.1|  hypothetical protein CC1G_11300 [Coprinop...   223    2e-56  
ref|YP_219998.1|  putative ClpB ATPase stress response protein...   222    2e-56  
ref|XP_001210911.1|  heat shock protein HSP98 [Aspergillus ter...   222    2e-56  
ref|NP_073026.1|  ATP-dependent Clp protease, ATPase subunit [...   221    3e-56  
gb|AAF01451.2|AF188207_1  HSP100 [Pleurotus sajor-caju]             221    4e-56 
ref|YP_001578146.1|  ATP-dependent protease [Lactobacillus hel...   221    4e-56  
gb|ABI13538.1|  ATP-dependent Clp protease ATP-binding subunit...   221    4e-56 
ref|ZP_02125262.1|  ATPase with chaperone activity ATP-binding...   220    6e-56 
ref|YP_001790696.1|  ATP-dependent Clp protease, ATP-binding s...   220    7e-56  
ref|NP_853274.1|  Clp [Mycoplasma gallisepticum R] >sp|Q7NAZ3....   219    1e-55  
ref|XP_817674.1|  ATP-dependent Clp protease subunit, heat sho...   219    2e-55  
ref|YP_001021651.1|  putative ATP-dependent clp protease ATP-b...   219    2e-55  
ref|XP_001831116.1|  hypothetical protein CC1G_04007 [Coprinop...   218    2e-55  
ref|NP_224352.1|  Clp Protease ATPase [Chlamydophila pneumonia...   218    2e-55  
ref|NP_876421.1|  ClpB [Chlamydophila pneumoniae TW-183] >gb|A...   218    2e-55  
ref|NP_445171.1|  ATP-dependent Clp protease, subunit B [Chlam...   218    3e-55  
ref|XP_804864.1|  ATP-dependent Clp protease subunit, heat sho...   218    3e-55  
ref|YP_412932.1|  ATPase with chaperone activity [Nitrosospira...   218    3e-55  
ref|ZP_02888792.1|  ATP-dependent Clp protease, ATP-binding su...   218    4e-55 
ref|ZP_01128133.1|  ATP-dependent Clp protease, ATP-binding su...   218    4e-55 
ref|ZP_02619435.1|  chaperone ClpB [Clostridium botulinum Bf] ...   217    5e-55 
ref|YP_001798171.1|  ATP-dependent Clp protease, ATP-binding s...   217    6e-55  
emb|CAM75600.1|  ATP-dependent Clp protease ATP-binding subuni...   217    6e-55 
ref|ZP_02932019.1|  chaperone ClpB [Ureaplasma urealyticum ser...   217    6e-55 
ref|YP_632353.1|  ClpA/B family protein [Myxococcus xanthus DK...   217    7e-55  
ref|YP_069925.1|  ATP-dependent Clp protease ATP-binding subun...   217    7e-55  
ref|YP_001473625.1|  ATP-dependent Clp protease, ATP-binding s...   217    8e-55  
ref|NP_110220.1|  ATP-dependent protease binding subunit ClpB ...   216    9e-55  
ref|ZP_00924466.1|  COG0542: ATPases with chaperone activity, ...   216    1e-54 
ref|NP_404961.1|  ATP-dependent Clp protease ATP-binding subun...   216    1e-54  
ref|ZP_02335627.1|  ATP-dependent Clp protease ATP-binding sub...   216    1e-54 
ref|NP_670109.1|  ATP-dependent Clp protease ATP-binding subun...   216    1e-54  
ref|ZP_02442608.1|  hypothetical protein ANACOL_01901 [Anaerot...   216    1e-54 
ref|YP_001156525.1|  ATP-dependent Clp protease, ATP-binding s...   216    1e-54  
ref|NP_757764.1|  ATP-dependent protease binding subunit [Myco...   216    1e-54  
ref|YP_932636.1|  probable ATP-dependent Clp protease, ATP-bin...   216    1e-54  
ref|YP_001176131.1|  ATP-dependent Clp protease ATP-binding su...   216    1e-54  
ref|YP_774456.1|  ATP-dependent Clp protease, ATP-binding subu...   216    1e-54  
ref|NP_836541.1|  ATP-dependent Clp protease ATP-binding subun...   216    1e-54  
ref|NP_706768.2|  ATP-dependent Clp protease ATP-binding subun...   216    1e-54  
gb|ABB02581.1|  ATPase [Lactobacillus reuteri]                      216    2e-54 
ref|XP_001701404.1|  ClpB chaperone, Hsp100 family [Chlamydomo...   216    2e-54  
ref|ZP_00698367.1|  COG0542: ATPases with chaperone activity, ...   216    2e-54 
ref|YP_370088.1|  AAA ATPase, Clp [Burkholderia sp. 383] >gb|A...   216    2e-54  
ref|XP_001739693.1|  chaperone Clpb, putative [Entamoeba dispa...   216    2e-54  
ref|NP_903339.1|  ATP-dependent Clp protease, ATP-binding subu...   216    2e-54  
ref|ZP_02378088.1|  ATP-dependent Clp protease, ATP-binding su...   216    2e-54 
ref|YP_403944.1|  ATP-dependent Clp protease ATP-binding subun...   216    2e-54  
ref|ZP_01916331.1|  Putative ATP-dependent Clp protease ATP- b...   216    2e-54 
ref|NP_286654.1|  ATP-dependent Clp protease ATP-binding subun...   216    2e-54  
pdb|1KSF|X  Chain X, Crystal Structure Of Clpa, An Hsp100 Chap...   216    2e-54  
ref|ZP_00724849.1|  COG0542: ATPases with chaperone activity, ...   216    2e-54 
ref|YP_851973.1|  ATP-dependent Clp protease ATP-binding subun...   216    2e-54  
ref|YP_407316.1|  ATP-dependent Clp protease ATP-binding subun...   216    2e-54  
ref|NP_881357.1|  ATP-dependent clp protease ATP-binding [Bord...   216    2e-54  
gb|AAN79491.1|AE016758_95  ATP-dependent clp protease ATP-bind...   216    2e-54  
ref|YP_391381.1|  AAA ATPase [Thiomicrospira crunogena XCL-2] ...   216    2e-54  
ref|ZP_02751300.1|  ATP-dependent Clp protease ATP-binding sub...   215    2e-54 
ref|ZP_02908835.1|  ATP-dependent Clp protease, ATP-binding su...   215    2e-54 
ref|YP_621783.1|  ATP-dependent Clp protease ATP-binding subun...   215    2e-54  
ref|ZP_02903637.1|  ATP-dependent Clp protease ATP-binding sub...   215    2e-54 
gb|EAY63913.1|  ATP-dependent Clp protease ATP-binding subunit...   215    2e-54 
ref|ZP_00980332.1|  COG0542: ATPases with chaperone activity, ...   215    2e-54 
ref|YP_001334581.1|  ATP-binding component of serine protease ...   215    2e-54  
ref|ZP_00987211.1|  COG0542: ATPases with chaperone activity, ...   215    3e-54 
ref|YP_001578969.1|  ATP-dependent Clp protease, ATP-binding s...   215    3e-54  
ref|ZP_02361944.1|  ATP-dependent Clp protease ATP-binding sub...   215    3e-54 
ref|YP_688404.1|  ATP-dependent Clp protease ATP-binding subun...   215    3e-54  
gb|EAY68108.1|  ATP-dependent Clp protease ATP-binding subunit...   215    3e-54 
ref|YP_544619.1|  ATPase AAA-2 [Methylobacillus flagellatus KT...   215    3e-54  
ref|YP_159563.1|  probable ATP-dependent protease [Azoarcus sp...   215    3e-54  
ref|ZP_02354763.1|  ATP-dependent Clp protease ATP-binding sub...   215    3e-54 
ref|YP_001120426.1|  ATP-dependent Clp protease, ATP-binding s...   214    3e-54  
ref|NP_888564.1|  ATP-dependent clp protease ATP-binding [Bord...   214    3e-54  
ref|NP_884803.1|  ATP-dependent clp protease ATP-binding [Bord...   214    4e-54  
gb|AAA23583.1|  ClpA protein                                        214    4e-54 
ref|NP_968191.1|  ATP-dependent Clp protease subunit [Bdellovi...   214    4e-54  
ref|ZP_00733788.1|  COG0542: ATPases with chaperone activity, ...   214    4e-54 
ref|YP_999201.1|  ATP-dependent Clp protease, ATP-binding subu...   214    4e-54  
ref|YP_706636.1|  ATP-binding subunit of heat shock protein Cl...   214    4e-54  
ref|YP_427196.1|  ATP-dependent Clp protease ATP-binding subun...   214    4e-54  
ref|ZP_02462608.1|  ATP-dependent Clp protease ATP-binding sub...   214    4e-54 
ref|ZP_01498641.1|  ATP-dependent Clp protease, ATP-binding su...   214    5e-54 
ref|YP_050747.1|  ATP-dependent Clp protease ATP-binding subun...   214    5e-54  
ref|ZP_01660273.1|  putative ATP-dependent protease (ATP-bindi...   214    5e-54 
ref|YP_001761070.1|  ATP-dependent Clp protease, ATP-binding s...   214    5e-54  
ref|YP_001270658.1|  ATPase AAA-2 domain protein [Lactobacillu...   214    6e-54  
ref|ZP_01274338.1|  AAA ATPase, central region:ATPase associat...   214    6e-54 
ref|ZP_02006761.1|  ATP-dependent Clp protease, ATP-binding su...   214    6e-54 
ref|ZP_00826885.1|  COG0542: ATPases with chaperone activity, ...   214    6e-54 
ref|YP_107526.1|  putative ATP-dependent Clp protease ATP-bind...   214    6e-54  
ref|YP_001005814.1|  ATP-dependent Clp protease ATP-binding su...   214    6e-54  
ref|ZP_00822373.1|  COG0542: ATPases with chaperone activity, ...   214    7e-54 
ref|YP_332525.1|  ATP-dependent Clp protease ATP-binding subun...   214    7e-54  
ref|YP_001228617.1|  Chaperone ClpB [Synechococcus sp. RCC307]...   213    8e-54  
emb|CAJ49698.1|  ATP-dependent clp protease ATP-binding (chape...   213    8e-54 
ref|YP_001438538.1|  hypothetical protein ESA_02456 [Enterobac...   213    8e-54  
ref|YP_001477906.1|  ATP-dependent Clp protease, ATP-binding s...   213    8e-54  
ref|YP_001093692.1|  ATP-dependent Clp protease, ATP-binding s...   213    8e-54  
ref|YP_001631269.1|  ATP-dependent clp protease ATP-binding [B...   213    8e-54  
ref|YP_986095.1|  ATP-dependent Clp protease, ATP-binding subu...   213    8e-54  
ref|XP_001730028.1|  hypothetical protein MGL_3014 [Malassezia...   213    8e-54  
ref|ZP_00830364.1|  COG0542: ATPases with chaperone activity, ...   213    9e-54 
ref|YP_001235656.1|  ATP-dependent Clp protease, ATP-binding s...   213    9e-54  
ref|ZP_01323239.1|  hypothetical protein BpseP_03003041 [Burkh...   213    1e-53 
ref|XP_455896.1|  unnamed protein product [Kluyveromyces lacti...   213    1e-53  
ref|ZP_00834675.1|  COG0542: ATPases with chaperone activity, ...   213    1e-53 
dbj|BAD94394.1|  ATP-dependent Clp protease, ATP-binding subun...   213    1e-53 
ref|NP_841765.1|  ClpA, ATP dependent protease, chaperonin [Ni...   213    1e-53  
ref|NP_359591.1|  Class III stress response-related ATPase, tr...   213    1e-53  
ref|YP_971574.1|  ATP-dependent Clp protease, ATP-binding subu...   213    1e-53  
ref|YP_420486.1|  ATPase with chaperone activity, ATP-binding ...   213    1e-53  
ref|ZP_01334615.1|  hypothetical protein Bpse4_03002821 [Burkh...   213    1e-53 
ref|ZP_02843385.1|  ATP-dependent Clp protease, ATP-binding su...   213    1e-53 
ref|YP_441319.1|  ATP-dependent Clp protease, ATP-binding subu...   213    1e-53  
ref|NP_852641.1|  Clp protease ATP binding subunit [Eimeria te...   213    2e-53  
ref|YP_388591.1|  ATPase [Desulfovibrio desulfuricans G20] >gb...   213    2e-53  
ref|ZP_02179382.1|  ATP-dependent Clp protease [Hydrogenivirga...   212    2e-53 
ref|YP_750938.1|  ATP-dependent Clp protease, ATP-binding subu...   212    2e-53  
ref|YP_727495.1|  ATP-dependent protease Clp, ATPase subunit [...   212    2e-53  
ref|YP_001100696.1|  ATP-dependent specificity subunit of clpA...   212    2e-53  
ref|ZP_01346062.1|  hypothetical protein Bmal10_03001333 [Burk...   212    2e-53 
ref|YP_001172799.1|  ATP-dependent Clp protease, ATP-binding s...   212    2e-53  
ref|YP_001543655.1|  ATPase AAA-2 domain protein [Herpetosipho...   212    2e-53  
ref|ZP_02344137.1|  hypothetical protein Sentente_07759 [Salmo...   212    3e-53 
ref|XP_774263.1|  hypothetical protein CNBG2440 [Cryptococcus ...   212    3e-53  
ref|YP_001753481.1|  ATP-dependent Clp protease, ATP-binding s...   212    3e-53  
ref|YP_215887.1|  ATP-dependent Clp protease ATP-binding subun...   212    3e-53  
ref|NP_455435.1|  ATP-dependent Clp protease ATP-binding subun...   212    3e-53  
ref|YP_001571037.1|  hypothetical protein SARI_02016 [Salmonel...   212    3e-53  
ref|NP_459922.1|  ATP-dependent Clp protease ATP-binding subun...   212    3e-53  
ref|ZP_01908453.1|  probable ATP-dependent Clp protease [Plesi...   211    3e-53 
ref|ZP_01682855.1|  ATPase family associated with various cell...   211    3e-53 
ref|YP_745572.1|  ATP-dependent clp protease ATP-binding subun...   211    3e-53  
ref|XP_572184.1|  chaperone [Cryptococcus neoformans var. neof...   211    3e-53  
ref|ZP_00943309.1|  Hypothetical Protein RRSL_03844 [Ralstonia...   211    3e-53 
ref|YP_260985.1|  ATP-dependent clp protease, ATP-binding subu...   211    3e-53  
ref|YP_286295.1|  AAA ATPase, central region:Clp, N terminal [...   211    3e-53  
ref|ZP_02647337.1|  hypothetical protein Senterenterica_17042 ...   211    3e-53 
ref|YP_151077.1|  ATP-dependent Clp protease ATP-binding subun...   211    3e-53  
ref|ZP_02058774.1|  ATP-dependent Clp protease, ATP-binding su...   211    3e-53 
ref|YP_004149.1|  ATP-dependent clp protease ATP-binding subun...   211    3e-53  
ref|YP_001453757.1|  hypothetical protein CKO_02198 [Citrobact...   211    3e-53  
ref|YP_585034.1|  ATPase AAA-2 [Ralstonia metallidurans CH34] ...   211    3e-53  
ref|XP_001643627.1|  hypothetical protein Kpol_478p4 [Vanderwa...   211    4e-53  
ref|YP_001354204.1|  ATP-dependent Clp protease ATP-binding su...   211    4e-53  
ref|XP_001881766.1|  predicted protein [Laccaria bicolor S238N...   211    4e-53  
ref|YP_001187881.1|  ATP-dependent Clp protease, ATP-binding s...   211    4e-53  
ref|YP_560185.1|  Putative ATP-dependent Clp protease ATP- bin...   211    4e-53  
ref|YP_129365.1|  ATP-dependent Clp protease ATP-binding subun...   211    4e-53  
ref|YP_001564524.1|  ATP-dependent Clp protease, ATP-binding s...   211    4e-53  
ref|NP_520585.1|  PROBABLE ATP-DEPENDENT PROTEASE (ATP-BINDING...   211    4e-53  
ref|NP_251310.1|  ATP-binding protease component ClpA [Pseudom...   211    4e-53  
ref|YP_064622.1|  ATP-dependent Clp protease, ATP-binding subu...   211    5e-53  
ref|ZP_01460310.1|  negative regulator of genetic competence C...   211    5e-53 
ref|XP_504490.1|  hypothetical protein [Yarrowia lipolytica] >...   211    5e-53  
ref|YP_191043.1|  ATP-dependent Clp protease ATP-binding subun...   211    5e-53  
ref|NP_965754.1|  ATP-dependent clp protease ATP-binding subun...   211    5e-53  
ref|ZP_00055924.1|  COG0542: ATPases with chaperone activity, ...   211    6e-53 
ref|ZP_01221208.1|  Putative ATP-dependent Clp protease, ATP-b...   210    6e-53 
ref|YP_527159.1|  protein of unknown function DUF104 [Saccharo...   210    7e-53  
ref|YP_296957.1|  AAA ATPase, central region:Clp, N terminal [...   210    7e-53  
ref|NP_986630.1|  AGL036Cp [Ashbya gossypii ATCC 10895] >gb|AA...   210    7e-53  
ref|NP_421271.1|  ATP-dependent Clp protease, ATP-binding subu...   210    8e-53  
ref|ZP_02199634.1|  ATP-dependent Clp protease, ATP-binding su...   210    8e-53 
gb|EAY77800.1|  hypothetical protein OsI_031759 [Oryza sativa ...   210    9e-53 
ref|YP_742286.1|  ATP-dependent Clp protease, ATP-binding subu...   210    1e-52  
ref|ZP_01078100.1|  ATP-binding protease component ClpA [Marin...   209    1e-52 
ref|ZP_01946886.1|  ATP-dependent Clp protease ATP-binding sub...   209    1e-52 
ref|XP_741888.1|  heat shock protein 101 [Plasmodium chabaudi ...   209    1e-52  
ref|NP_820191.1|  ATP-dependent Clp protease, ATP-binding subu...   209    2e-52  
ref|ZP_01511096.1|  ATP-dependent Clp protease, ATP-binding su...   209    2e-52 
ref|ZP_02121372.1|  AAA ATPase [Methylobacterium nodulans ORS ...   209    2e-52 
ref|YP_454782.1|  ATP-dependent Clp protease ATP-binding subun...   209    2e-52  
ref|ZP_02884724.1|  ATP-dependent Clp protease, ATP-binding su...   209    2e-52 
ref|YP_349319.1|  ATP-dependent clp protease, ATP-binding subu...   209    2e-52  
ref|YP_815627.1|  ATP-binding subunit of Clp protease and DnaK...   209    2e-52  
ref|ZP_02158453.1|  ATP-dependent Clp protease, ATP-binding su...   208    2e-52 
ref|YP_236253.1|  AAA ATPase, central region:Clp, N terminal:P...   208    3e-52  
ref|YP_001684761.1|  ATP-dependent Clp protease, ATP-binding s...   208    3e-52  
ref|YP_275267.1|  ATP-dependent clp protease, ATP-binding subu...   208    3e-52  
ref|YP_524002.1|  ATPase AAA-2 [Rhodoferax ferrireducens T118]...   208    3e-52  
ref|YP_865674.1|  ATP-dependent Clp protease, ATP-binding subu...   208    3e-52  
ref|ZP_01544408.1|  ATP-dependent Clp protease, ATP-binding su...   208    3e-52 
ref|XP_459498.1|  hypothetical protein DEHA0E04774g [Debaryomy...   208    3e-52  
ref|NP_928885.1|  ATP-dependent Clp protease ATP-binding subun...   208    3e-52  
ref|XP_952853.1|  ClpB protein, putative [Theileria annulata s...   208    4e-52  
ref|YP_141959.1|  ATP-dependent proteinase ATP-binding subunit...   208    4e-52  
ref|YP_001502387.1|  ATP-dependent Clp protease, ATP-binding s...   208    4e-52  
ref|YP_759752.1|  ATP-dependent Clp protease, ATP-binding subu...   207    4e-52  
ref|NP_793136.1|  ATP-dependent clp protease, ATP-binding subu...   207    4e-52  
ref|YP_140032.1|  ATP-dependent proteinase ATP-binding subunit...   207    4e-52  
ref|YP_001673946.1|  ATP-dependent Clp protease, ATP-binding s...   207    4e-52  
ref|YP_820924.1|  ATP-binding subunit of Clp protease and DnaK...   207    5e-52  
ref|YP_549752.1|  ATPase AAA-2 [Polaromonas sp. JS666] >gb|ABE...   207    5e-52  
ref|YP_810181.1|  ATP-binding subunit of Clp protease and DnaK...   207    5e-52  
ref|ZP_01340504.1|  hypothetical protein Bmal2_03001804 [Burkh...   207    5e-52 
ref|ZP_01156447.1|  ATP-dependent Clp protease, ATP-binding su...   207    5e-52 
ref|YP_001355851.1|  ATP-dependent Clp protease, ATP-binding s...   207    6e-52  
ref|YP_001142237.1|  ATP-dependent Clp protease, ATP-binding s...   207    7e-52  
ref|ZP_01450136.1|  ATP-dependent specificity subunit of clpA-...   207    7e-52 
ref|YP_562841.1|  ATPase AAA-2 [Shewanella denitrificans OS217...   207    7e-52  
ref|YP_001597058.1|  ATP-dependent Clp protease ATP-binding su...   207    7e-52  
ref|YP_594993.1|  ATPases with chaperone activity, ATP-binding...   207    7e-52  
ref|YP_001414063.1|  ATP-dependent Clp protease, ATP-binding s...   207    8e-52  
ref|ZP_02000345.1|  ATP-dependent Clp protease ATP-binding sub...   207    8e-52 
ref|YP_001603705.1|  ATP-dependent Clp protease ATP-binding su...   207    9e-52  
ref|YP_607831.1|  ATP-dependent Clp protease, ATP-binding subu...   207    9e-52  
ref|ZP_02191831.1|  ATPase with chaperone activity, ATP-bindin...   207    9e-52 
ref|NP_078226.1|  ATP-dependent serine proteinase - heat shock...   206    1e-51  
ref|ZP_01234929.1|  Putative ATP-dependent Clp protease, ATP-b...   206    1e-51 
ref|YP_574486.1|  ATPase AAA-2 [Chromohalobacter salexigens DS...   206    1e-51  
ref|ZP_01114287.1|  ATPase with chaperone activity, ATP-bindin...   206    1e-51 
ref|YP_856388.1|  ATP-dependent Clp protease, ATP-binding subu...   206    1e-51  
ref|YP_615225.1|  ATPase AAA-2 [Sphingopyxis alaskensis RB2256...   206    1e-51  
ref|YP_534963.1|  ATP-dependent clp protease ATP-binding subun...   206    1e-51  
ref|YP_634161.1|  ATP-dependent Clp protease, ATP-binding subu...   206    1e-51  
ref|YP_001002969.1|  ATP-dependent Clp protease, ATP-binding s...   206    1e-51  
ref|YP_344411.1|  ATP-dependent Clp protease [Nitrosococcus oc...   206    1e-51  
ref|ZP_01064774.1|  ATP-dependent Clp protease, ATP-binding su...   206    1e-51 
ref|ZP_01518714.1|  ATP-dependent Clp protease, ATP-binding su...   206    2e-51 
ref|XP_725815.1|  ClpB protein [Plasmodium yoelii yoelii str. ...   206    2e-51  
ref|YP_982165.1|  ATP-dependent Clp protease, ATP-binding subu...   206    2e-51  
ref|ZP_01159910.1|  Putative ATP-dependent Clp protease, ATP-b...   206    2e-51 
ref|YP_001342101.1|  ATP-dependent Clp protease, ATP-binding s...   206    2e-51  
ref|YP_001750265.1|  ATP-dependent Clp protease, ATP-binding s...   206    2e-51  
ref|ZP_00417361.1|  AAA ATPase, central region:Clp, N terminal...   206    2e-51 
ref|ZP_02919516.1|  hypothetical protein STRINF_00358 [Strepto...   206    2e-51 
gb|AAZ53478.2|  ATP-dependent protease binding protein [Mycopl...   205    2e-51 
ref|YP_287501.1|  ATP-dependent protease binding protein [Myco...   205    2e-51  
ref|YP_748236.1|  ATP-dependent Clp protease, ATP-binding subu...   205    2e-51  
ref|YP_001832787.1|  ATP-dependent Clp protease, ATP-binding s...   205    3e-51  
ref|ZP_01814135.1|  ATP-dependent Clp protease ATP-binding sub...   205    3e-51 
ref|YP_278903.1|  ATP-dependent protease binding protein [Myco...   205    3e-51  
ref|ZP_01863612.1|  ATPase [Erythrobacter sp. SD-21] >gb|EDL49...   205    3e-51 
ref|ZP_01898250.1|  ATP-dependent Clp protease, ATP-binding su...   205    3e-51 
ref|ZP_01625320.1|  hypothetical protein MGP2080_11248 [marine...   205    3e-51 
ref|YP_619721.1|  ATP-dependent Clp protease, ATP-binding subu...   205    3e-51  
gb|AAZ44192.2|  ATP-dependent protease binding protein [Mycopl...   205    3e-51 
ref|YP_115791.1|  ATP-dependent serine proteinase, heat shock ...   205    3e-51  
ref|YP_813778.1|  ATP-binding subunit of Clp protease and DnaK...   205    3e-51  
ref|ZP_01306208.1|  ATP-binding protease component ClpA [Ocean...   205    3e-51 
ref|YP_661944.1|  ATP-dependent Clp protease, ATP-binding subu...   205    3e-51  
emb|CAA64596.1|  Clp (C?) [Plasmodium falciparum] >emb|CAA6096...   205    3e-51 
ref|ZP_01304927.1|  ATP dependent Clp protease [Sphingomonas s...   204    3e-51 
ref|NP_273877.1|  ATP-dependent Clp protease, ATP-binding subu...   204    4e-51  
ref|XP_676304.1|  heat shock protein 101 [Plasmodium berghei s...   204    4e-51  
ref|XP_446531.1|  unnamed protein product [Candida glabrata] >...   204    4e-51  
ref|ZP_01040838.1|  ATPase [Erythrobacter sp. NAP1] >gb|EAQ284...   204    4e-51 
ref|ZP_01548479.1|  endopeptidase Clp ATP-binding chain A [Sta...   204    4e-51 
ref|NP_797393.1|  ATP-dependent Clp protease ATP-binding subun...   204    5e-51  
ref|YP_533185.1|  ATPase AAA-2 [Rhodopseudomonas palustris Bis...   204    5e-51  
ref|ZP_01989999.1|  ATP-dependent Clp protease ATP-binding sub...   204    5e-51 
ref|YP_459524.1|  ATPase [Erythrobacter litoralis HTCC2594] >g...   204    5e-51  
ref|YP_207563.1|  ClpA [Neisseria gonorrhoeae FA 1090] >gb|AAW...   204    5e-51  
ref|ZP_01476050.1|  hypothetical protein VEx2w_02001414 [Vibri...   204    6e-51 
ref|ZP_00992516.1|  ATP-dependent Clp protease, ATP-binding su...   204    6e-51 
ref|NP_539733.1|  ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUN...   204    6e-51  
ref|ZP_01749887.1|  ATP-dependent Clp protease, ATP-binding su...   204    6e-51 
gb|EDN57296.1|  ATP-dependent Clp protease ATP-binding subunit...   204    6e-51 
ref|ZP_02195980.1|  ATP-dependent Clp protease ATP-binding sub...   204    7e-51 
ref|YP_001769154.1|  ATP-dependent Clp protease, ATP-binding s...   204    7e-51  
ref|YP_570182.1|  ATPase AAA-2 [Rhodopseudomonas palustris Bis...   204    7e-51  
dbj|BAC95086.1|  ATP-dependent Clp protease, ATP-binding subun...   203    8e-51  
ref|YP_001627837.1|  ATP-dependent Clp protease ATP-binding su...   203    8e-51  
ref|YP_001259087.1|  ATP-dependent Clp protease ATP-binding su...   203    8e-51  
prf||1717391A  protein Hsp104                                       203    9e-51 
ref|NP_013074.1|  Heat shock protein that cooperates with Ydj1...   203    9e-51  
ref|ZP_01165892.1|  ATP-binding protease component ClpA [Ocean...   203    9e-51 
ref|XP_001615285.1|  heat shock protein 101, putative [Plasmod...   203    9e-51  
ref|NP_935115.2|  ATP-dependent Clp protease ATP-binding subun...   203    1e-50  
ref|YP_001168402.1|  ATP-dependent Clp protease, ATP-binding s...   203    1e-50  
ref|ZP_01134767.1|  ATP-dependent specificity subunit of clpA-...   203    1e-50 
ref|YP_001669840.1|  ATP-dependent Clp protease, ATP-binding s...   203    1e-50  
ref|NP_283818.1|  ATP-dependent protease ATP-binding protein [...   203    1e-50  
ref|YP_001444764.1|  hypothetical protein VIBHAR_01567 [Vibrio...   203    1e-50  
ref|ZP_01437793.1|  endopeptidase Clp ATP-binding chain A [Ful...   203    1e-50 
ref|ZP_01286840.1|  AAA ATPase, central region:Clp, N terminal...   202    1e-50 
ref|YP_486012.1|  AAA_5 ATPase [Rhodopseudomonas palustris HaA...   202    1e-50  
ref|ZP_01002133.1|  Chaperonin clpA/B [Loktanella vestfoldensi...   202    1e-50 
ref|ZP_01011564.1|  ATP-dependent Clp protease, ATP-binding su...   202    1e-50 
ref|ZP_02150267.1|  ATP-dependent Clp protease, ATP-binding su...   202    1e-50 
ref|NP_746138.1|  ATP-dependent Clp protease, ATP-binding subu...   202    1e-50  
ref|ZP_01478739.1|  hypothetical protein VchoM_02002103 [Vibri...   202    1e-50 
ref|YP_318308.1|  AAA ATPase [Nitrobacter winogradskyi Nb-255]...   202    2e-50  
ref|ZP_02145228.1|  ATP-dependent Clp protease ATP-binding sub...   202    2e-50 
ref|YP_001267162.1|  ATP-dependent Clp protease, ATP-binding s...   202    2e-50  
ref|ZP_00631320.1|  AAA ATPase, central region:Clp, N terminal...   202    2e-50  
ref|NP_230789.1|  ATP-dependent Clp protease ATP-binding subun...   202    2e-50  
ref|ZP_01047322.1|  AAA ATPase [Nitrobacter sp. Nb-311A] >gb|E...   202    2e-50 
ref|NP_294311.1|  ATP-dependent Clp protease, ATP-binding subu...   202    2e-50  
ref|ZP_00998372.1|  ATP-dependent Clp protease, ATP-binding su...   202    2e-50 
ref|YP_974859.1|  putative ATP-dependent protease ATP-binding ...   202    2e-50  
ref|YP_001598939.1|  ATP-dependent Clp protease ATP-binding su...   202    2e-50  
ref|XP_001484089.1|  hypothetical protein PGUG_03470 [Pichia g...   202    2e-50  
ref|YP_357669.1|  ATP-binding component of serine protease [Pe...   202    2e-50  
emb|CAG70311.1|  ATP-dependent Clp protease, ATP-binding subun...   202    2e-50 
ref|ZP_01870359.1|  ATP-dependent Clp protease ATP-binding sub...   202    2e-50 
ref|XP_001386272.1|  hypothetical protein PICST_85379 [Pichia ...   202    2e-50  
ref|ZP_01879380.1|  ATP-dependent Clp protease ATP-binding sub...   202    2e-50 
ref|YP_577666.1|  ATPase AAA-2 [Nitrobacter hamburgensis X14] ...   202    2e-50  
ref|YP_146821.1|  ATP-dependent Clp protease [Geobacillus kaus...   202    2e-50  
ref|YP_046052.1|  ATP-binding protease component [Acinetobacte...   202    2e-50  
ref|YP_927931.1|  ATP-dependent Clp protease, ATP-binding subu...   202    3e-50  
ref|ZP_02132528.1|  ATP-dependent Clp protease, ATP-binding su...   202    3e-50 
ref|NP_786784.1|  ATP-dependent Clp protease, ATP-binding subu...   202    3e-50  
ref|ZP_01313214.1|  ATPase AAA-2 [Desulfuromonas acetoxidans D...   201    3e-50 
ref|YP_869392.1|  ATP-dependent Clp protease, ATP-binding subu...   201    3e-50  
ref|ZP_01616520.1|  ATP-binding protease component ClpA [marin...   201    3e-50 
ref|YP_001251742.1|  ATP binding protease component ClpA [Legi...   201    3e-50  
ref|XP_001525370.1|  heat shock protein 104 [Lodderomyces elon...   201    3e-50  
ref|YP_352348.1|  Chaperonin clpA/B [Rhodobacter sphaeroides 2...   201    3e-50  
ref|XP_762577.1|  hypothetical protein UM06430.1 [Ustilago may...   201    3e-50  
ref|YP_733781.1|  ATP-dependent Clp protease, ATP-binding subu...   201    3e-50  
ref|YP_123208.1|  ATP-dependent Clp protease ATP-binding subun...   201    4e-50  
ref|YP_737773.1|  ATP-dependent Clp protease, ATP-binding subu...   201    4e-50  
ref|YP_094853.1|  ATP binding protease component ClpA [Legione...   201    4e-50  
ref|YP_269594.1|  ATP-dependent Clp protease, ATP-binding subu...   201    4e-50  
ref|YP_942194.1|  ATP-dependent Clp protease, ATP-binding subu...   201    4e-50  
ref|ZP_01463907.1|  ATP-dependent Clp protease ATP-binding sub...   201    4e-50 
ref|YP_782316.1|  ATP-dependent Clp protease, ATP-binding subu...   201    4e-50  
ref|ZP_01612932.1|  ATP-dependent specificity subunit of clpA-...   201    4e-50 
ref|NP_718211.1|  ATP-dependent Clp protease, ATP-binding subu...   201    4e-50  
ref|YP_001619091.1|  endopeptidase ATPase with chaperone activ...   201    5e-50  
ref|YP_988888.1|  ATP-dependent Clp protease ATP-binding subun...   201    5e-50  
ref|YP_001260636.1|  ATP-dependent Clp protease, ATP-binding s...   201    5e-50  
ref|YP_614086.1|  ATP-dependent Clp protease ATP-binding subun...   201    5e-50  
ref|ZP_01453045.1|  AAA ATPase, central region:Clp, N terminal...   201    5e-50 
ref|ZP_02278561.1|  ATP-dependent Clp protease, ATP-binding su...   201    6e-50 
ref|ZP_01055036.1|  ATP-dependent Clp protease, ATP-binding su...   201    6e-50 
ref|ZP_00961546.1|  ATP-dependent Clp protease, ATP-binding su...   201    6e-50 
ref|YP_495349.1|  ATP dependent Clp protease [Novosphingobium ...   201    6e-50  
ref|YP_126210.1|  ATP-dependent Clp protease ATP-binding subun...   201    6e-50  
ref|YP_001195616.1|  ATPase AAA-2 domain protein [Flavobacteri...   200    7e-50  
ref|ZP_01111934.1|  ATP-dependent specificity subunit of clpA-...   200    7e-50 
ref|ZP_02957392.1|  ATP-dependent Clp protease, ATP-binding su...   200    7e-50 
ref|YP_001370566.1|  ATP-dependent Clp protease, ATP-binding s...   200    7e-50  
ref|XP_001347846.1|  heat shock protein 101 [Plasmodium falcip...   200    7e-50  
ref|ZP_01872386.1|  ENDOPEPTIDASE CLP ATP-BINDING CHAIN A [Cam...   200    7e-50 
ref|YP_001084939.1|  ATP-binding protease component [Acinetoba...   200    7e-50  
ref|ZP_01755537.1|  ATP-dependent Clp protease, ATP-binding su...   200    8e-50 
ref|YP_001206502.1|  ATP-dependent specificity subunit of clpA...   200    8e-50  
ref|YP_001713548.1|  ATP-binding protease component [Acinetoba...   200    8e-50  
ref|YP_693005.1|  ATP-dependent Clp protease, ATP-binding subu...   200    9e-50  
ref|ZP_01826522.1|  S-ribosylhomocysteinase [Streptococcus pne...   200    9e-50 
ref|ZP_01894147.1|  ATPase with chaperone activity, ATP-bindin...   200    9e-50 
ref|YP_205148.1|  ATPase and specificity subunit of ClpA-ClpP ...   200    9e-50  
ref|NP_771793.1|  ClpA-like protein [Bradyrhizobium japonicum ...   200    9e-50  
ref|ZP_02135938.1|  ATPase and specificity subunit of ClpA-Clp...   200    1e-49 
ref|NP_348449.1|  ATP-dependent Clp proteinase [Clostridium ac...   200    1e-49  
ref|YP_100119.1|  ATP-dependent Clp protease ATP-binding subun...   200    1e-49  
ref|NP_948486.1|  endopeptidase Clp: ATP-binding chain A [Rhod...   200    1e-49  
ref|YP_001835059.1|  ATP-dependent Clp protease, ATP-binding s...   199    1e-49  
sp|Q06716|CLPL_LACLA  ATP-dependent Clp protease ATP-binding s...   199    1e-49 
ref|YP_001209564.1|  ATP-dependent Clp protease ATP-binding su...   199    1e-49  
ref|NP_102423.1|  endopeptidase Clp ATP-binding chain A [Mesor...   199    1e-49  
ref|ZP_00957850.1|  ATP-dependent Clp protease, ATP-binding su...   199    1e-49 
ref|ZP_01223854.1|  hypothetical protein GB2207_01772 [marine ...   199    1e-49 
ref|YP_001359363.1|  ATP-dependent Clp protease, ATP-binding s...   199    1e-49  
ref|YP_114227.1|  ATP-dependent Clp protease, ATP-binding subu...   199    1e-49  
emb|CAI78765.1|  endopeptidase clp atp-binding chain A [uncult...   199    2e-49 
ref|YP_001707368.1|  ATP-binding protease component [Acinetoba...   199    2e-49  
ref|NP_269087.1|  putative ATP-dependent Clp proteinase (ATP-b...   199    2e-49  
ref|ZP_02718821.1|  ATP-dependent Clp protease, ATP-binding su...   199    2e-49 
ref|ZP_01101088.1|  ATP-dependent clp protease, ATP-binding su...   199    2e-49 
gb|ABZ94867.1|  Endopeptidase Clp, ATP-dependent proteolytic s...   199    2e-49 
ref|YP_162140.1|  ATPase [Zymomonas mobilis subsp. mobilis ZM4...   199    2e-49  
ref|ZP_01227496.1|  ATP-dependent Clp protease, ATP-binding su...   199    2e-49 
gb|AAG17282.1|AF254897_1  ClpA-like protein [Bradyrhizobium ja...   199    2e-49 
gb|AAD25872.1|AF027500_2  ATP-dependent Clp protease regulator...   199    2e-49 
ref|YP_804474.1|  ATP-binding subunit of Clp protease and DnaK...   199    2e-49  
ref|ZP_01744088.1|  ATP-dependent Clp protease, ATP-binding su...   198    3e-49 
gb|ABY70710.1|  ClpC [Sarcocystis sp. QSZ-2008-1]                   198    3e-49 
sp|P05444|CLPA_RHOBL  ClpA homolog protein >emb|CAA77308.1| UR...   198    3e-49 
ref|ZP_02174753.1|  ATPase AAA-2 domain protein [Anaeromyxobac...   198    3e-49 
ref|YP_001530362.1|  ATP-dependent Clp protease, ATP-binding s...   198    3e-49  
gb|ABY70711.1|  ClpC [Sarcocystis sp. QSZ-2008-2]                   198    3e-49 
ref|ZP_01738237.1|  ATPase with chaperone activity, ATP-bindin...   198    3e-49 
ref|ZP_00781451.1|  ATP-dependent Clp protease, ATP-binding su...   198    3e-49 
ref|ZP_02714236.1|  ATP-dependent Clp protease, ATP-binding su...   198    3e-49 
ref|ZP_01819559.1|  phospho-N-acetylmuramoyl-pentapeptide-tran...   198    3e-49 
ref|NP_357901.1|  ATP-dependent protease ATP-binding subunit [...   198    3e-49  
ref|YP_460222.1|  ATPase clp protease ATP binding subunit [Syn...   198    4e-49  
ref|ZP_00787526.1|  ATP-dependent Clp protease, ATP-binding su...   198    4e-49 
ref|ZP_01407717.1|  hypothetical protein SpneT_02001863 [Strep...   198    4e-49 
ref|ZP_01824471.1|  phospho-N-acetylmuramoyl-pentapeptide-tran...   198    4e-49 
ref|ZP_02714889.1|  ATP-dependent Clp protease, ATP-binding su...   198    4e-49 
ref|NP_344873.1|  ATP-dependent Clp protease, ATP-binding subu...   198    4e-49  
ref|ZP_02711131.1|  ATP-dependent Clp protease, ATP-binding su...   198    4e-49 
ref|ZP_01741638.1|  ATP-dependent Clp protease, ATP-binding su...   198    4e-49 
ref|ZP_01833929.1|  phospho-N-acetylmuramoyl-pentapeptide-tran...   198    4e-49 
ref|YP_963172.1|  ATP-dependent Clp protease, ATP-binding subu...   198    4e-49  
ref|ZP_02325887.1|  ATPase AAA-2 domain protein [Anaeromyxobac...   198    4e-49 
ref|YP_001183747.1|  ATP-dependent Clp protease, ATP-binding s...   198    4e-49  
ref|ZP_01834490.1|  phospho-N-acetylmuramoyl-pentapeptide-tran...   197    4e-49 
ref|ZP_02709167.1|  ATP-dependent Clp protease ATP-binding sub...   197    5e-49 
ref|ZP_02153054.1|  ATP-dependent Clp protease, ATP-binding su...   197    5e-49 
ref|ZP_01706421.1|  ATP-dependent Clp protease, ATP-binding su...   197    5e-49 
ref|NP_688301.1|  ATP-dependent Clp protease, ATP-binding subu...   197    5e-49  
ref|ZP_01447050.1|  Chaperonin clpA/B [alpha proteobacterium H...   197    5e-49 
ref|YP_417872.1|  ATP-dependent proteinase chain [Staphylococc...   197    5e-49  
ref|YP_604681.1|  ATPase AAA-2 [Deinococcus geothermalis DSM 1...   197    5e-49  
ref|YP_756516.1|  ATP-dependent Clp protease, ATP-binding subu...   197    6e-49  
ref|YP_280142.1|  ATP-dependent protease ATP-binding subunit [...   197    6e-49  
ref|NP_607092.1|  putative ATP-dependent Clp proteinase (ATP-b...   197    6e-49  
ref|ZP_02062034.1|  ATP-dependent Clp protease ATP-binding sub...   197    6e-49 
ref|YP_001280482.1|  ATP-dependent Clp protease, ATP-binding s...   197    6e-49  
ref|YP_168372.1|  ATP-dependent Clp protease, ATP-binding subu...   197    6e-49  
ref|ZP_00948368.1|  ATP-dependent Clp protease, ATP-binding su...   197    7e-49 
ref|YP_598361.1|  ATP-dependent endopeptidase clp ATP-binding ...   197    7e-49  
ref|YP_001128663.1|  putative ATP-dependent protease ATP-bindi...   197    7e-49  
ref|YP_060029.1|  ATP-dependent protease ATP-binding subunit [...   197    7e-49  
ref|ZP_00366605.1|  COG0542: ATPases with chaperone activity, ...   197    7e-49 
ref|YP_602280.1|  ATP-dependent endopeptidase clp ATP-binding ...   197    7e-49  
ref|YP_508983.1|  ATPase AAA-2 [Jannaschia sp. CCS1] >gb|ABD53...   197    8e-49  
ref|YP_001693859.1|  ATP-dependent Clp protease ATP-binding su...   197    8e-49  
ref|ZP_00786444.1|  ATP-dependent Clp protease, ATP-binding su...   197    9e-49 
ref|YP_001366665.1|  ATP-dependent Clp protease, ATP-binding s...   197    9e-49  
ref|ZP_00790241.1|  ATP-dependent Clp protease, ATP-binding su...   196    9e-49 
gb|AAK55313.1|AF348341_1  caseinolytic protease C [Plasmodium ...   196    1e-48 
ref|NP_735813.1|  hypothetical protein gbs1376 [Streptococcus ...   196    1e-48  
ref|XP_740795.1|  hypothetical protein PC301182.00.0 [Plasmodi...   196    1e-48  
ref|YP_001050834.1|  ATP-dependent Clp protease, ATP-binding s...   196    1e-48  
ref|YP_465614.1|  AAA ATPase [Anaeromyxobacter dehalogenans 2C...   196    1e-48  
ref|YP_001419414.1|  ATP-dependent Clp protease, ATP-binding s...   196    1e-48  
ref|NP_354371.1|  ATP-dependent Clp protease, ATP-binding subu...   196    1e-48  
ref|YP_001240704.1|  ATP-dependent specificity subunit of clpA...   196    1e-48  
ref|ZP_01908316.1|  AAA ATPase [Plesiocystis pacifica SIR-1] >...   196    1e-48 
ref|YP_844181.1|  ATP-dependent Clp protease, ATP-binding subu...   196    1e-48  
ref|YP_596482.1|  ATP-dependent endopeptidase clp ATP-binding ...   196    1e-48  
ref|YP_392973.1|  AAA ATPase [Sulfurimonas denitrificans DSM 1...   196    1e-48  
ref|ZP_01817065.1|  phospho-N-acetylmuramoyl-pentapeptide-tran...   196    1e-48 
ref|YP_001524511.1|  AAA ATPase [Azorhizobium caulinodans ORS ...   196    1e-48  
ref|YP_683707.1|  ATP-dependent Clp protease, ATP-binding subu...   196    1e-48  
ref|ZP_02139747.1|  ATP-dependent Clp protease, ATP-binding su...   196    1e-48 
ref|NP_294841.1|  ATP-dependent Clp protease, ATP-binding subu...   196    1e-48  
ref|YP_001615033.1|  ATPase with chaperone activity, two ATP-b...   196    2e-48  
ref|ZP_02295100.1|  ATP-dependent Clp protease, ATP-binding su...   196    2e-48 
ref|ZP_00405060.1|  COG0542: ATPases with chaperone activity, ...   196    2e-48 
ref|YP_469420.1|  ATP-dependent Clp protease, ATP-binding subu...   196    2e-48  
ref|YP_363780.1|  ATP-dependent Clp protease subunit [Xanthomo...   196    2e-48  
ref|YP_767807.1|  putative ATP-dependent Clp protease ATP-bind...   196    2e-48  
ref|ZP_01642145.1|  ATP-dependent Clp protease, ATP-binding su...   196    2e-48 
ref|YP_394816.1|  ATPase/chaperone ClpL, putative specificity ...   196    2e-48  
ref|XP_716227.1|  hypothetical protein CaO19_6387 [Candida alb...   196    2e-48  
ref|NP_642327.1|  ATP-dependent Clp protease subunit [Xanthomo...   196    2e-48  
ref|ZP_01902222.1|  ATP-dependent Clp protease ATP-binding sub...   196    2e-48 
ref|YP_904095.1|  ATPase AAA-2 domain protein [Candidatus Ruth...   195    2e-48  
ref|NP_721354.1|  putative Clp-like ATP-dependent protease, AT...   195    2e-48  
ref|YP_155064.1|  ATP-binding subunit of Clp protease and DnaK...   195    2e-48  
gb|AAK60625.1|AF362390_1  heat shock protein Hsp104 [Candida a...   195    2e-48 
gb|AAK60626.1|AF362391_1  heat shock protein Hsp104 [Candida a...   195    2e-48 
gb|AAK55310.1|AF348338_1  caseinolytic protease C [Plasmodium ...   195    3e-48 
ref|ZP_00874580.1|  AAA ATPase, central region [Streptococcus ...   195    3e-48 
ref|XP_716146.1|  hypothetical protein CaO19_13747 [Candida al...   195    3e-48  
gb|AAK55316.1|AF348344_1  caseinolytic protease C [Plasmodium ...   195    3e-48 
ref|YP_001219648.1|  ATP-dependent Clp protease ATP-binding su...   195    3e-48  
ref|ZP_02857608.1|  ATP-dependent Clp protease, ATP-binding su...   195    3e-48 
ref|YP_001036016.1|  ATP-dependent protease, ATP-binding subun...   195    3e-48  
ref|YP_032342.1|  Endopeptidase clp ATP-binding chain a [Barto...   195    3e-48  
ref|YP_001256763.1|  ClpB [Mycoplasma agalactiae PG2] >emb|CAL...   195    3e-48  
ref|ZP_02243291.1|  ATP-dependent Clp protease subunit [Xantho...   194    4e-48 
ref|YP_001378657.1|  ATPase AAA-2 domain protein [Anaeromyxoba...   194    4e-48  
ref|YP_001451122.1|  ATP-dependent proteinase ATP-binding chai...   194    4e-48  
ref|YP_817673.1|  ATP-binding subunit of Clp protease and DnaK...   194    4e-48  
ref|ZP_01035275.1|  ATP-dependent Clp protease, ATP-binding su...   194    4e-48 
ref|YP_201192.1|  ATP-dependent Clp protease subunit [Xanthomo...   194    5e-48  
ref|YP_451441.1|  ATP-dependent Clp protease subunit [Xanthomo...   194    5e-48  
ref|ZP_01017924.1|  ClpA, ATP-dependent Clp protease, ATP-bind...   194    5e-48 
ref|YP_673934.1|  ATP-dependent Clp protease, ATP-binding subu...   194    5e-48  
ref|YP_340239.1|  ATP-dependent specificity subunit of clpA-cl...   194    6e-48  
ref|YP_001378030.1|  ATP-dependent Clp protease, ATP-binding s...   194    6e-48  
ref|ZP_01829819.1|  phospho-N-acetylmuramoyl-pentapeptide-tran...   194    7e-48 
ref|XP_001709001.1|  ClpB protein [Giardia lamblia ATCC 50803]...   194    7e-48  
ref|YP_001037642.1|  ATP-dependent Clp protease, ATP-binding s...   194    7e-48  
ref|YP_041973.1|  putative ATP-dependent protease ATP-binding ...   194    8e-48  
ref|YP_433587.1|  ATPase with chaperone activity, ATP-binding ...   193    8e-48  
ref|NP_385593.1|  PROBABLE ATP-DEPENDENT CLP PROTEASE ATP-BIND...   193    9e-48  
gb|EDT30129.1|  ATP-dependent Clp protease ATP-binding subunit...   193    1e-47 
ref|YP_001326803.1|  ATP-dependent Clp protease, ATP-binding s...   193    1e-47  
ref|NP_637332.1|  ATP-dependent Clp protease subunit [Xanthomo...   193    1e-47  
emb|CAP51621.1|  ATP-dependent Clp protease subunit [Xanthomon...   193    1e-47 
ref|ZP_01441525.1|  ATP-dependent Clp protease, ATP-binding su...   193    1e-47 
ref|YP_001727474.1|  ATPase with chaperone activity, ATP-bindi...   192    2e-47  
ref|YP_187355.1|  ATP-dependent Clp protease, putative [Staphy...   192    2e-47  
ref|NP_647286.1|  ATP-dependent Clp proteinase chain clpL [Sta...   192    2e-47  
ref|YP_495120.1|  putative ATP-dependent Clp proteinase [Staph...   192    2e-47  
ref|NP_373072.1|  ATP-dependent Clp proteinase chain [Staphylo...   192    2e-47  
ref|YP_001333482.1|  ATP-dependent Clp protease, ATP-binding s...   192    2e-47  
ref|YP_001609301.1|  Clp protease subunit [Bartonella tribocor...   192    2e-47  
ref|YP_033447.1|  Endopeptidase clp ATP-binding chain a [Barto...   192    3e-47  
ref|ZP_01886047.1|  putative ATP-dependent protease [Pedobacte...   191    4e-47 
ref|XP_727082.1|  ATP-dependent Clp protease ATPase subunit [P...   191    5e-47  
ref|YP_580938.1|  ATPase AAA-2 [Psychrobacter cryohalolentis K...   191    5e-47  
ref|YP_211655.1|  putative ATP-dependent protease [Bacteroides...   191    5e-47  
gb|AAK64290.2|  ClpL [Lactobacillus rhamnosus]                      191    5e-47 
gb|AAW22449.1|  ClpL [Lactobacillus rhamnosus]                      191    5e-47 
gb|AAK55314.1|AF348342_1  caseinolytic protease C [Plasmodium ...   191    6e-47 
ref|YP_264780.1|  probable ATP-dependent Clp protease [Psychro...   191    6e-47  
ref|ZP_01875652.1|  probable ATP-dependent protease [Lentispha...   191    6e-47 
ref|NP_966949.1|  ATP-dependent Clp protease, ATP-binding subu...   190    7e-47  
ref|ZP_01314905.1|  hypothetical protein Wendoof_01000251 [Wol...   190    8e-47 
ref|ZP_00373328.1|  ATP-dependent Clp protease, ATP-binding su...   190    9e-47 
ref|YP_001395718.1|  ClpA [Clostridium kluyveri DSM 555] >gb|E...   190    9e-47  
gb|EAZ22682.1|  hypothetical protein OsJ_006165 [Oryza sativa ...   190    1e-46 
ref|ZP_00372662.1|  ATP-dependent Clp protease, ATP-binding su...   189    1e-46 
ref|YP_001490812.1|  ATP-dependent Clp protease, ATP-binding s...   189    1e-46  
ref|ZP_01823612.1|  ATP-dependent Clp protease, ATP-binding su...   189    1e-46 
ref|ZP_00876291.1|  COG0542: ATPases with chaperone activity, ...   189    2e-46 
ref|NP_906587.1|  ENDOPEPTIDASE CLP ATP-BINDING CHAIN A [Wolin...   188    3e-46  
ref|ZP_01216529.1|  ATP-dependent Clp protease, ATP-binding su...   188    3e-46 
ref|YP_099236.1|  endopeptidase Clp ATP-binding chain B [Bacte...   188    4e-46  
ref|ZP_02172760.1|  ATP-dependent Clp protease, ATP-binding su...   187    6e-46 
ref|ZP_02324432.1|  ATP-dependent Clp protease, ATP-binding su...   187    7e-46 
ref|YP_464001.1|  AAA ATPase [Anaeromyxobacter dehalogenans 2C...   187    7e-46  
ref|NP_219238.1|  ATP-dependent Clp protease subunit A (clpA) ...   187    8e-46  
ref|YP_001534273.1|  ATP-dependent Clp protease, ATP-binding s...   187    8e-46  
ref|XP_001617680.1|  hypothetical protein NEMVEDRAFT_v1g156990...   187    9e-46  
ref|YP_001311218.1|  ATPase AAA-2 domain protein [Clostridium ...   186    1e-45  
ref|YP_807245.1|  ATP-binding subunit of Clp protease and DnaK...   186    1e-45  
ref|YP_001765.1|  ATP-dependent Clp protease, ATP-binding subu...   186    1e-45  
ref|NP_712285.1|  ATPase with chaperone activity, ATP-binding ...   186    1e-45  
ref|NP_298732.1|  ATP-dependent Clp protease subunit [Xylella ...   186    1e-45  
ref|XP_001693009.1|  chaperone, Hsp100 family [Chlamydomonas r...   186    1e-45  
ref|NP_778887.1|  ATP-dependent Clp protease subunit [Xylella ...   186    1e-45  
ref|ZP_00679857.1|  AAA ATPase, central region:Clp, N terminal...   186    1e-45 
gb|AAV34209.1|  caseinolytic protease C [Plasmodium ovale]          186    2e-45 
ref|YP_801183.1|  ATP-dependent clp protease ATP-binding subun...   185    3e-45  
ref|ZP_00876287.1|  UvrB/UvrC protein:AAA ATPase, central regi...   185    3e-45 
ref|ZP_00651069.1|  AAA ATPase, central region:Clp, N terminal...   185    3e-45 
ref|YP_001775406.1|  ATP-dependent Clp protease subunit [Xylel...   184    4e-45  
ref|YP_604939.1|  ATPase AAA-2 [Deinococcus geothermalis DSM 1...   184    4e-45  
ref|YP_797802.1|  ATP-dependent clp protease ATP-binding subun...   184    5e-45  
gb|AAL00952.1|AF401667_2  chaperone ATP-dependent protease [La...   184    7e-45 
ref|ZP_02167950.1|  probable atp-dependent clp protease atp-bi...   184    8e-45 
ref|XP_001737555.1|  chaperone protein ClpB, putative [Entamoe...   182    2e-44  
sp|Q7WSY8.1|CLPB_PROFR  Chaperone protein clpB >emb|CAD59396.1...   182    2e-44 
ref|YP_179239.1|  ATP-dependent Clp protease, ATP-binding subu...   182    2e-44  
gb|AAK55309.1|AF348337_1  caseinolytic protease C [Plasmodium ...   182    2e-44 
ref|YP_001277685.1|  ATPase AAA-2 domain protein [Roseiflexus ...   182    3e-44  
ref|NP_282256.1|  ATP-dependent CLP protease ATP-binding subun...   181    3e-44  
ref|YP_001000786.1|  ATP-dependent Clp protease, ATP-binding s...   181    4e-44  
ref|ZP_00544963.1|  AAA ATPase, central region:Clp, N terminal...   181    4e-44 
ref|YP_001482625.1|  ATP-dependent Clp protease, ATP-binding s...   181    4e-44  
gb|AAK55312.1|AF348340_1  caseinolytic protease C [Plasmodium ...   181    5e-44 
ref|ZP_01071070.1|  ATP-dependent Clp protease ATP-binding sub...   181    6e-44 
ref|YP_001397779.1|  ATP-dependent Clp protease, ATP-binding s...   181    7e-44  
ref|ZP_01069007.1|  ATP-dependent Clp protease, ATP-binding su...   180    9e-44 
gb|AAK55311.1|AF348339_1  caseinolytic protease C [Plasmodium ...   180    1e-43 
ref|ZP_02950481.1|  ATP-dependent Clp protease ATP-binding sub...   180    1e-43 
ref|ZP_01747202.1|  ATP-dependent Clp protease, ATP-binding su...   180    1e-43 
ref|ZP_02069890.1|  hypothetical protein BACUNI_01307 [Bactero...   180    1e-43 
gb|ABZ94305.1|  ATP-dependent clp protease ATP-binding subunit...   179    1e-43 
ref|XP_001118013.1|  PREDICTED: similar to suppressor of K+ tr...   179    1e-43  
ref|ZP_00370208.1|  ATPases with chaperone activity, ATP-bindi...   179    2e-43 
gb|AAV34208.1|  caseinolytic protease C [Plasmodium chabaudi] ...   179    2e-43 
gb|AAA23341.1|  ATP-dependent protease [Dichelobacter nodosus]      178    4e-43 
ref|YP_196404.1|  ATP-dependent Clp protease ATP-binding subun...   177    8e-43  
ref|YP_180330.1|  ATP-dependent Clp protease, ATP-binding subu...   177    8e-43  
ref|NP_972725.1|  ATP-dependent Clp protease, ATP-binding subu...   176    1e-42  
ref|ZP_01993554.1|  chaperone ClpB [Vibrio parahaemolyticus AQ...   175    4e-42 
ref|XP_973935.1|  PREDICTED: similar to Caseinolytic peptidase...   174    4e-42  
ref|YP_001601887.1|  Chaperone clpB [Gluconacetobacter diazotr...   174    7e-42  
gb|AAT78357.1|  caseinolytic protease C [Plasmodium cathemerium]    173    1e-41 
ref|YP_891884.1|  ATP-dependent Clp protease ATP-binding subun...   173    1e-41  
ref|YP_303099.1|  ATP-dependent clp protease [Ehrlichia canis ...   173    1e-41  
ref|ZP_00367134.1|  ATP-dependent Clp protease, ATP-binding su...   173    1e-41 
ref|ZP_01477248.1|  hypothetical protein VEx2w_02000084 [Vibri...   171    5e-41 
gb|EDN58573.1|  ATPases with chaperone activity, ATP-binding s...   171    6e-41 
ref|ZP_01260096.1|  putative ClpA/B-type protease [Vibrio algi...   171    6e-41 
ref|ZP_02195485.1|  putative ClpA/B-type protease [Vibrio camp...   171    7e-41 
ref|YP_632985.1|  ClpA/B family protein [Myxococcus xanthus DK...   170    7e-41  
ref|XP_743367.1|  ATP-dependent Clp protease [Plasmodium chaba...   170    8e-41  
ref|YP_001297964.1|  ATP-dependent Clp protease, ATP-binding s...   170    9e-41  
gb|AAK55315.1|AF348343_1  caseinolytic protease C [Plasmodium ...   170    1e-40 
ref|ZP_01984789.1|  AAA ATPase [Vibrio harveyi HY01] >gb|EDL70...   169    1e-40 
ref|NP_861095.1|  ATP-dependent CLP protease ClpB [Helicobacte...   169    2e-40  
ref|YP_001447993.1|  ClpA/B type protease [Vibrio harveyi ATCC...   169    2e-40  
ref|YP_001406670.1|  ATP-dependent CLP protease ATP-binding su...   168    3e-40  
ref|ZP_01687149.1|  ATPases with chaperone activity ClpC, two ...   168    3e-40 
ref|NP_275427.1|  ATP-dependent Clp protease regulatory subuni...   167    5e-40  
ref|ZP_01906183.1|  ATP-dependent chaperone protein ClpB [Ples...   167    5e-40 
ref|YP_632974.1|  ATP-dependent chaperone protein ClpB [Myxoco...   167    5e-40  
ref|ZP_02460162.1|  ATP-dependent Clp protease, ATP-binding su...   167    6e-40 
ref|ZP_02415922.1|  Clp-type ATPase chaperone protein [Burkhol...   167    7e-40 
ref|ZP_02510376.1|  Clp-type ATPase chaperone protein [Burkhol...   167    7e-40 
ref|ZP_02502531.1|  ATP-dependent Clp protease, ATP-binding su...   167    7e-40 
ref|ZP_00442528.1|  COG0542: ATPases with chaperone activity, ...   167    8e-40 
ref|ZP_02544650.1|  clp protease ATP binding subunit [candidat...   167    8e-40 
ref|NP_770227.1|  ATP-dependent Clp protease ATP-binding subun...   167    9e-40  
ref|ZP_01825517.1|  ATP-dependent Clp protease, ATP-binding su...   167    9e-40 
ref|ZP_02407408.1|  ATP-dependent Clp protease, ATP-binding su...   167    1e-39 
ref|ZP_01044407.1|  ATP-binding subunit of Clp protease and Dn...   167    1e-39 
ref|ZP_02475654.1|  Clp-type ATPase chaperone protein [Burkhol...   167    1e-39 
dbj|BAA93566.1|  heat shock protein [Escherichia coli O157:H7]      166    1e-39 
ref|YP_153937.1|  ATP-dependent clp protease ATP-binding subun...   166    1e-39  
ref|NP_734856.1|  hypothetical protein gbs0388 [Streptococcus ...   166    1e-39  
ref|ZP_02366152.1|  ATP-dependent Clp protease, ATP-binding su...   166    1e-39 
ref|ZP_02451997.1|  ATP-dependent Clp protease, ATP-binding su...   166    1e-39 
ref|ZP_02486158.1|  ATP-dependent Clp protease, ATP-binding su...   166    1e-39 
ref|NP_735439.1|  hypothetical protein gbs0991 [Streptococcus ...   166    1e-39  
gb|AAH06257.1|  CLPB protein [Homo sapiens]                         166    2e-39  
ref|NP_797771.1|  putative ClpA/B-type protease [Vibrio paraha...   166    2e-39  
ref|YP_001274573.1|  ATPase AAA-2 domain protein [Roseiflexus ...   166    2e-39  
gb|ABD77362.1|  caseinolytic protease C [Plasmodium chabaudi c...   166    2e-39 
ref|NP_001015625.1|  caseinolytic peptidase B [Bos taurus] >sp...   166    2e-39  
ref|ZP_00368422.1|  ATP-dependent C1p protease (clpA) [Campylo...   166    2e-39 
ref|ZP_02360890.1|  ATP-dependent Clp protease, ATP-binding su...   165    2e-39 
ref|XP_001369464.1|  PREDICTED: hypothetical protein [Monodelp...   165    3e-39  
ref|ZP_02466814.1|  Clp-type ATPase chaperone protein [Burkhol...   165    3e-39 
ref|ZP_01064231.1|  ATP-dependent Clp protease ATP-binding sub...   165    3e-39 
ref|NP_586448.1|  HSP 101 RELATED PROTEIN [Encephalitozoon cun...   165    3e-39  
ref|ZP_01911032.1|  ClpA/B family protein [Plesiocystis pacifi...   165    4e-39 
ref|ZP_01985767.1|  AAA ATPase, central region:Clp, N :Clp, N ...   165    4e-39 
ref|XP_001511439.1|  PREDICTED: hypothetical protein, partial ...   164    4e-39  
ref|ZP_01867183.1|  ATPase with chaperone activity, ATP-bindin...   164    4e-39 
gb|ABD77356.1|  caseinolytic protease C [Plasmodium atheruri]       164    5e-39 
ref|XP_698885.2|  PREDICTED: similar to SKD3, partial [Danio r...   164    6e-39  
gb|ABD77371.1|  caseinolytic protease C [Plasmodium yoelii kil...   164    6e-39 
gb|EAY58810.1|  endopeptidase ATP binding protein (chain B) cl...   164    7e-39 
ref|ZP_00880219.1|  COG0542: ATPases with chaperone activity, ...   164    8e-39 
gb|ABD77359.1|  caseinolytic protease C [Plasmodium chabaudi a...   164    8e-39 
gb|ABD77361.1|  caseinolytic protease C [Plasmodium chabaudi c...   164    8e-39 
ref|YP_001434394.1|  ATPase AAA-2 domain protein [Roseiflexus ...   164    9e-39  
ref|ZP_02736100.1|  ATPase with chaperone activity, ATP-bindin...   163    9e-39 
gb|EDL16520.1|  ClpB caseinolytic peptidase B homolog (E. coli...   163    9e-39  
ref|ZP_02289173.1|  ATP-dependent Clp protease, ATP-binding su...   163    9e-39 
emb|CAD39142.1|  hypothetical protein [Homo sapiens]                163    9e-39  
ref|XP_861395.1|  PREDICTED: similar to suppressor of potassiu...   163    1e-38  
ref|ZP_01911035.1|  ClpA/B family protein [Plesiocystis pacifi...   163    1e-38 
ref|ZP_00391506.1|  COG0542: ATPases with chaperone activity, ...   163    1e-38 
gb|ABD77358.1|  caseinolytic protease C [Plasmodium berghei]        163    1e-38 
ref|YP_299450.1|  AAA ATPase, central region:Clp, N terminal:P...   163    1e-38  
gb|ABD77364.1|  caseinolytic protease C [Plasmodium vinckei vi...   163    1e-38 
dbj|BAE28128.1|  unnamed protein product [Mus musculus]             163    1e-38  
dbj|BAE01124.1|  unnamed protein product [Macaca fascicularis]      163    1e-38 
ref|XP_850367.1|  PREDICTED: similar to suppressor of potassiu...   163    1e-38  
ref|XP_001174706.1|  PREDICTED: hypothetical protein isoform 2...   163    1e-38  
ref|ZP_01286945.1|  AAA ATPase, central region:Clp, N terminal...   163    1e-38 
dbj|BAE01446.1|  unnamed protein product [Macaca fascicularis]      163    1e-38 
ref|YP_358225.1|  heat shock protein ClpB-like [Pelobacter car...   163    1e-38  
ref|NP_075236.1|  suppressor of K+ transport defect 3 [Rattus ...   163    1e-38  
ref|XP_001114846.1|  PREDICTED: similar to suppressor of potas...   163    1e-38  
gb|EDL16517.1|  ClpB caseinolytic peptidase B homolog (E. coli...   163    1e-38  
gb|ABD77369.1|  caseinolytic protease C [Plasmodium vinckei pe...   163    1e-38 
ref|XP_001114862.1|  PREDICTED: similar to suppressor of potas...   162    1e-38  
gb|EDM18275.1|  rCG39494, isoform CRA_b [Rattus norvegicus] >g...   162    1e-38 
ref|XP_001174710.1|  PREDICTED: hypothetical protein isoform 3...   162    2e-38  
gb|ABD77368.1|  caseinolytic protease C [Plasmodium vinckei pe...   162    2e-38 
dbj|BAB14467.1|  unnamed protein product [Homo sapiens] >gb|EA...   162    2e-38  
ref|NP_033217.1|  suppressor of K+ transport defect 3 [Mus mus...   162    2e-38  
ref|XP_001174704.1|  PREDICTED: hypothetical protein isoform 1...   162    2e-38  
dbj|BAE32689.1|  unnamed protein product [Mus musculus]             162    2e-38  
emb|CAH89378.1|  hypothetical protein [Pongo pygmaeus]              162    2e-38 
dbj|BAE34982.1|  unnamed protein product [Mus musculus]             162    2e-38  
gb|AAH70917.1|  ClpB caseinolytic peptidase B homolog (E. coli...   162    2e-38  
ref|NP_110440.1|  caseinolytic peptidase B [Homo sapiens] >sp|...   162    2e-38  
ref|ZP_02136824.1|  putative ClpA/B-type protease [Vibrio fisc...   162    2e-38 
dbj|BAC27861.1|  unnamed protein product [Mus musculus]             162    2e-38  
pir||D71409  probable endopeptidase Clp ATP-binding chain - Ar...   162    2e-38 
ref|ZP_01075642.1|  ATP-dependent Clp protease ATP-binding sub...   162    3e-38 
gb|ABD77367.1|  caseinolytic protease C [Plasmodium vinckei le...   162    3e-38 
ref|YP_505053.1|  ATP-dependent Clp protease, ATP-binding subu...   161    4e-38  
ref|ZP_00823861.1|  COG0542: ATPases with chaperone activity, ...   161    4e-38 
ref|ZP_01330168.1|  hypothetical protein BpseS_03001638 [Burkh...   161    4e-38 
ref|YP_001615632.1|  endopeptidase Clp [Sorangium cellulosum '...   161    4e-38  
ref|ZP_00832945.1|  COG0542: ATPases with chaperone activity, ...   161    4e-38 
ref|YP_335699.1|  ATP-dependent Clp protease, ATP-binding subu...   161    5e-38  
ref|XP_001607140.1|  PREDICTED: hypothetical protein [Nasonia ...   161    5e-38  
ref|ZP_01768729.1|  ATP-dependent Clp protease, ATP-binding su...   161    5e-38 
ref|YP_111509.1|  Clp-type ATPase chaperone protein [Burkholde...   161    5e-38  
ref|ZP_01333308.1|  hypothetical protein Bpse4_03004207 [Burkh...   160    6e-38 
ref|YP_001076064.1|  ATP-dependent Clp protease, ATP-binding s...   160    6e-38  
ref|ZP_01346542.1|  hypothetical protein Bmal10_03000607 [Burk...   160    7e-38 
ref|ZP_01341950.1|  hypothetical protein Bmal2_03000391 [Burkh...   160    7e-38 
ref|YP_990218.1|  ATP-dependent Clp protease, ATP-binding subu...   160    7e-38  
ref|YP_001078862.1|  ATP-dependent Clp protease, ATP-binding s...   160    7e-38  
ref|YP_001024536.1|  ATP-dependent Clp protease, ATP-binding s...   160    7e-38  
ref|YP_105467.1|  ATP-dependent Clp protease, ATP-binding subu...   160    7e-38  
ref|YP_001063123.1|  ATP-dependent Clp protease, ATP-binding s...   160    7e-38  
ref|ZP_01318453.1|  hypothetical protein Bpse1_03002158 [Burkh...   160    8e-38 
ref|ZP_01321933.1|  hypothetical protein BpseP_03004305 [Burkh...   160    8e-38 
ref|ZP_00823089.1|  COG0542: ATPases with chaperone activity, ...   160    8e-38 
ref|YP_001571726.1|  hypothetical protein SARI_02728 [Salmonel...   160    9e-38  
ref|ZP_02269801.1|  ATP-dependent Clp protease, ATP-binding su...   160    1e-37 
ref|ZP_01844514.1|  ATPase AAA-2 domain protein [Shewanella ba...   159    1e-37 
ref|ZP_01692656.1|  chaperone ClpB, putative [Microscilla mari...   159    2e-37 
gb|AAI61411.1|  Unknown (protein for IMAGE:7695342) [Xenopus t...   159    2e-37 
ref|YP_001440530.1|  hypothetical protein ESA_pESA3p05497 [Ent...   159    2e-37  
gb|ABD77374.1|  caseinolytic protease C [Plasmodium yoelii yoe...   159    2e-37 
ref|ZP_02930155.1|  ATPase with chaperone activity, ATP-bindin...   159    2e-37 
ref|YP_001478020.1|  ATPase AAA-2 domain protein [Serratia pro...   159    3e-37  
pir||H35905  hypothetical protein 1 (Sm1) - Streptococcus muta...   158    3e-37 
ref|YP_439061.1|  ATP-dependent Clp protease, ATP-binding subu...   158    5e-37  
ref|YP_589789.1|  ATPase AAA-2 [Acidobacteria bacterium Ellin3...   157    5e-37  
ref|ZP_02384264.1|  ATP-dependent Clp protease, ATP-binding su...   157    6e-37 
ref|ZP_00823879.1|  COG0542: ATPases with chaperone activity, ...   157    7e-37 
gb|EAW74860.1|  ClpB caseinolytic peptidase B homolog (E. coli...   157    8e-37  
ref|ZP_02370355.1|  ATP-dependent Clp protease, ATP-binding su...   157    9e-37 
emb|CAJ27310.1|  conserved hypothetical protein [Enterobacter ...   157    9e-37 
gb|ABD77357.1|  caseinolytic protease C [Plasmodium berghei]        157    9e-37 
ref|YP_973613.1|  ATPase AAA-2 domain protein [Polaromonas nap...   157    9e-37  
ref|YP_001334990.1|  putative protease [Klebsiella pneumoniae ...   157    1e-36  
ref|YP_001199935.1|  ATPases with chaperone activity, ATP-bind...   156    1e-36  
ref|ZP_00828330.1|  COG0542: ATPases with chaperone activity, ...   155    2e-36 
ref|YP_663908.1|  ATP-dependent Clp protease, ATP-binding subu...   155    2e-36  
ref|YP_001571626.1|  hypothetical protein SARI_02627 [Salmonel...   155    3e-36  
ref|XP_786389.1|  PREDICTED: hypothetical protein [Strongyloce...   155    3e-36  
ref|YP_246166.1|  ClpB protein [Rickettsia felis URRWXCal2] >g...   155    4e-36  
ref|NP_931404.1|  hypothetical protein plu4223 [Photorhabdus l...   155    4e-36  
ref|ZP_02930156.1|  ClpA/B family protein [Verrucomicrobium sp...   154    4e-36 
ref|ZP_02179412.1|  ATP-dependent Clp protease regulatory subu...   154    6e-36 
ref|YP_128896.1|  putative ATPase with chaperone activity [Pho...   154    6e-36  
ref|ZP_01748642.1|  ATP-dependent Clp protease ATP-binding sub...   154    7e-36 
ref|XP_001744067.1|  predicted protein [Monosiga brevicollis M...   154    8e-36  
ref|NP_356311.2|  ATP-dependent Clp protease, ATP-binding subu...   154    8e-36  
ref|YP_582773.1|  ATPase AAA-2 [Ralstonia metallidurans CH34] ...   153    1e-35  
ref|ZP_00984575.1|  COG0542: ATPases with chaperone activity, ...   153    1e-35 
ref|YP_506203.1|  ATP-dependent Clp protease, ATP-binding subu...   153    1e-35  
gb|ABD77370.1|  caseinolytic protease C [Plasmodium yoelii] >g...   153    1e-35 
ref|YP_632984.1|  ClpB family protein [Myxococcus xanthus DK 1...   153    1e-35  
ref|ZP_01262200.1|  ATP-dependent Clp protease, ATP-binding su...   152    2e-35 
ref|YP_051526.1|  putative chaperone [Erwinia carotovora subsp...   152    2e-35  
ref|ZP_02736101.1|  ATPase with chaperone activity, ATP-bindin...   152    2e-35 
ref|ZP_02380531.1|  ATPase AAA-2 [Burkholderia ubonensis Bu]        152    3e-35 
ref|YP_001546360.1|  ATPase AAA-2 domain protein [Herpetosipho...   151    3e-35  
ref|ZP_02930157.1|  ATPase with chaperone activity, ATP-bindin...   151    4e-35 
gb|ABD77363.1|  caseinolytic protease C [Plasmodium vinckei]        151    4e-35 
ref|ZP_01694627.1|  ATP-dependent Clp protease, ATP-binding su...   151    4e-35 
ref|ZP_02947675.1|  type VI secretion ATPase, ClpV1 family [Me...   151    4e-35 
gb|ABD77373.1|  caseinolytic protease C [Plasmodium yoelii yoe...   151    5e-35 
gb|AAX27762.2|  SJCHGC04151 protein [Schistosoma japonicum]         151    5e-35 
ref|YP_001631062.1|  probable ClpA/B-type protease [Bordetella...   151    5e-35  
ref|YP_001610972.1|  ATPase with chaperone activity, two ATP-b...   151    6e-35  
gb|ABD77365.1|  caseinolytic protease C [Plasmodium vinckei br...   150    6e-35 
ref|ZP_01899555.1|  putative ATPase with chaperone activity [M...   150    6e-35 
emb|CAJ74764.1|  unknown protein [Candidatus Kuenenia stuttgar...   150    7e-35 
ref|YP_001142248.1|  type VI secretion system clpB chaperone [...   150    8e-35  
ref|XP_534019.2|  PREDICTED: similar to suppressor of potassiu...   150    8e-35  
ref|ZP_01365012.1|  hypothetical protein PaerPA_01002125 [Pseu...   150    9e-35 
ref|NP_250353.1|  probable ClpA/B-type protease [Pseudomonas a...   150    9e-35  
ref|ZP_00969981.1|  COG0542: ATPases with chaperone activity, ...   150    1e-34 
ref|NP_251415.1|  probable chaperone [Pseudomonas aeruginosa P...   150    1e-34  
ref|YP_791584.1|  putative ClpA/B-type protease [Pseudomonas a...   150    1e-34  
ref|ZP_00975993.1|  COG0542: ATPases with chaperone activity, ...   150    1e-34 
ref|YP_001347894.1|  probable chaperone [Pseudomonas aeruginos...   150    1e-34  
gb|EAZ58591.1|  hypothetical protein PA2G_01839 [Pseudomonas a...   150    1e-34 
ref|ZP_00975079.1|  COG0542: ATPases with chaperone activity, ...   150    1e-34 
ref|ZP_00969070.1|  COG0542: ATPases with chaperone activity, ...   150    1e-34 
ref|YP_790468.1|  putative chaperone [Pseudomonas aeruginosa U...   150    1e-34  
ref|ZP_01366166.1|  hypothetical protein PaerPA_01003300 [Pseu...   150    1e-34 
gb|EAZ53146.1|  hypothetical protein PACG_01640 [Pseudomonas a...   149    1e-34 
ref|YP_856375.1|  ClpA/ClpB family protein [Aeromonas hydrophi...   149    1e-34  
gb|ACA48522.1|  caseinolytic protease C [Leucocytozoon sp. 2208]    149    2e-34 
ref|XP_001641860.1|  predicted protein [Nematostella vectensis...   149    2e-34  
ref|ZP_00972753.1|  COG0542: ATPases with chaperone activity, ...   149    2e-34 
ref|ZP_00966783.1|  COG0542: ATPases with chaperone activity, ...   149    2e-34 
ref|YP_788247.1|  putative ClpA/B-type chaperone [Pseudomonas ...   149    2e-34  
ref|ZP_01363000.1|  hypothetical protein PaerPA_01000091 [Pseu...   149    2e-34 
ref|ZP_01546323.1|  ATP-dependent Clp protease ATP-binding sub...   149    2e-34 
ref|NP_248780.1|  probable ClpA/B-type chaperone [Pseudomonas ...   149    3e-34  
ref|YP_001760892.1|  type VI secretion ATPase, ClpV1 family [S...   149    3e-34  
ref|ZP_02117428.1|  ATP-dependent Clp protease ATP-binding sub...   148    3e-34 
gb|ACA48566.1|  caseinolytic protease C [Haemoproteus sp. 2176]     148    3e-34 
ref|NP_103703.1|  probable ClpA/B-type protease [Mesorhizobium...   148    3e-34  
ref|YP_001345558.1|  type VI secretion ATPase, ClpV1 family [P...   148    3e-34  
ref|XP_001608638.1|  clpC [Babesia bovis T2Bo] >gb|EDO05070.1|...   148    4e-34  
ref|ZP_01216435.1|  clpB protein [Psychromonas sp. CNPT3] >gb|...   148    4e-34 
ref|YP_001340069.1|  ATPase AAA-2 domain protein [Marinomonas ...   148    4e-34  
ref|YP_606291.1|  ClpA/B-type protease [Pseudomonas entomophil...   148    4e-34  
ref|ZP_01516738.1|  ATPase AAA-2 [Chloroflexus aggregans DSM 9...   148    5e-34 
gb|AAD23010.2|  HSP100/ClpB, putative [Arabidopsis thaliana]        148    5e-34 
ref|YP_001185603.1|  ATPase AAA-2 domain protein [Pseudomonas ...   147    5e-34  
ref|YP_001774666.1|  ATPase AAA-2 domain protein [Burkholderia...   147    5e-34  
ref|YP_960980.1|  ATPase AAA-2 domain protein [Marinobacter aq...   147    6e-34  
ref|YP_351312.1|  ClpB protein, putative [Pseudomonas fluoresc...   147    6e-34  
ref|YP_436586.1|  ATPase with chaperone activity, ATP-binding ...   147    7e-34  
gb|EAY70566.1|  ATPase with chaperone activity ATP-binding sub...   147    8e-34 
ref|YP_621297.1|  ATPase AAA-2 [Burkholderia cenocepacia AU 10...   147    8e-34  
ref|ZP_02405880.1|  putative ATP-dependent Clp protease, ATP-b...   147    9e-34 
ref|ZP_02736099.1|  ATPase with chaperone activity, ATP-bindin...   147    9e-34 
ref|YP_823981.1|  ATPase AAA-2 domain protein [Solibacter usit...   147    9e-34  
ref|ZP_02233148.1|  heat shock protein [Yersinia pestis biovar...   147    9e-34 
ref|YP_354978.1|  hypothetical protein RSP_3474 [Rhodobacter s...   147    9e-34  
ref|YP_777579.1|  ATPase AAA-2 domain protein [Burkholderia am...   147    1e-33  
ref|ZP_01233724.1|  clpB protein [Vibrio angustum S14] >gb|EAS...   147    1e-33 
gb|ACA48559.1|  caseinolytic protease C [Haemoproteus coatneyi]     146    1e-33 
ref|ZP_01158809.1|  clpB protein [Photobacterium sp. SKA34] >g...   146    1e-33 
ref|NP_222751.1|  ATP-DEPENDENT PROTEASE,ATP-BINDING SUBUNIT [...   146    1e-33  
ref|ZP_02450485.1|  putative ATP-dependent Clp protease, ATP-b...   146    1e-33 
gb|ACA48573.1|  caseinolytic protease C [Haemoproteus sp. 384]      146    1e-33 
ref|ZP_02474184.1|  putative ATP-dependent Clp protease, ATP-b...   146    1e-33 
ref|YP_001637051.1|  ATPase AAA-2 domain protein [Chloroflexus...   146    1e-33  
ref|ZP_02269355.1|  putative ATP-dependent Clp protease, ATP-b...   146    1e-33 
ref|ZP_01896058.1|  clpB protein [Marinobacter algicola DG893]...   146    2e-33 
ref|ZP_02458649.1|  putative ATP-dependent Clp protease, ATP-b...   146    2e-33 
ref|ZP_02414386.1|  putative ATP-dependent Clp protease, ATP-b...   146    2e-33 
ref|YP_261253.1|  ATP-dependent Clp protease regulatory subuni...   146    2e-33  
ref|NP_795152.1|  clpB protein, putative [Pseudomonas syringae...   145    2e-33  
ref|YP_386253.1|  AAA ATPase [Geobacter metallireducens GS-15]...   145    2e-33  
gb|ABG57144.1|  ClpB protein [Aeromonas hydrophila]                 145    2e-33 
emb|CAK99827.1|  putative atpase with chaperone activity, clp ...   145    2e-33 
ref|ZP_02188007.1|  AAA ATPase [alpha proteobacterium BAL199] ...   145    2e-33 
ref|XP_001608639.1|  clpC [Babesia bovis T2Bo] >gb|EDO05071.1|...   145    2e-33  
ref|YP_001750112.1|  type VI secretion ATPase, ClpV1 family [P...   145    3e-33  
ref|YP_001236176.1|  ATPase AAA-2 domain protein [Acidiphilium...   145    3e-33  
ref|YP_001401473.1|  ATPase, AAA family [Yersinia pseudotuberc...   145    3e-33  
ref|YP_711107.1|  ATP-dependent CLP protease [Frankia alni ACN...   145    3e-33  
ref|XP_001734991.1|  chaperone Clpb, putative [Entamoeba dispa...   145    3e-33  
ref|ZP_02358129.1|  ATP-dependent Clp protease, ATP-binding su...   145    3e-33 
gb|ACA48567.1|  caseinolytic protease C [Haemoproteus sp. B60]      144    5e-33 
ref|YP_632986.1|  ClpA/B family protein [Myxococcus xanthus DK...   144    5e-33  
ref|YP_001044990.1|  ATPase AAA-2 domain protein [Rhodobacter ...   144    5e-33  
ref|ZP_02465775.1|  ATP-dependent Clp protease, ATP-binding su...   144    6e-33 
gb|ACA48532.1|  caseinolytic protease C [Plasmodium sp. circ]       144    6e-33 
ref|ZP_00053096.2|  COG0542: ATPases with chaperone activity, ...   144    6e-33 
ref|XP_762693.1|  molecular chaperone [Theileria parva strain ...   144    7e-33  
ref|ZP_02501021.1|  putative ATP-dependent Clp protease, ATP-b...   144    8e-33 
ref|YP_001061794.1|  putative ATP-dependent Clp protease, ATP-...   144    8e-33  
ref|YP_337231.1|  ATP-dependent Clp protease ATP-binding subun...   144    8e-33  
ref|YP_110543.1|  ATPase [Burkholderia pseudomallei K96243] >r...   144    8e-33  
ref|ZP_02508939.1|  putative ATP-dependent Clp protease, ATP-b...   144    8e-33 
ref|ZP_01331074.1|  hypothetical protein BpseS_03000918 [Burkh...   144    8e-33 
ref|ZP_02365190.1|  ATP-dependent Clp protease, ATP-binding su...   144    8e-33 
ref|ZP_00441391.1|  COG0542: ATPases with chaperone activity, ...   144    8e-33 
ref|NP_792358.1|  clpB protein, putative [Pseudomonas syringae...   144    8e-33  
ref|NP_405059.1|  putative ATPase subunit of ATP-dependent pro...   144    9e-33  
ref|YP_001719558.1|  type VI secretion ATPase, ClpV1 family [Y...   144    9e-33  
ref|NP_670001.1|  heat shock protein [Yersinia pestis KIM] >re...   144    9e-33  
ref|YP_001348964.1|  type VI secretion ATPase, ClpV1 family [P...   143    1e-32  
gb|AAT90781.1|  putative ATP-dependent protease ATPase subunit...   143    1e-32 
gb|ACA48564.1|  caseinolytic protease C [Haemoproteus passeris]     143    1e-32 
ref|ZP_02192056.1|  AAA ATPase [alpha proteobacterium BAL199] ...   143    1e-32 
gb|ACA48555.1|  caseinolytic protease C [Haemoproteus turtur]       143    1e-32 
ref|ZP_01114689.1|  putative ATPase subunit of ATP-dependent p...   143    1e-32 
ref|ZP_02368851.1|  ATP-dependent Clp protease, subunit C [Bor...   143    2e-32 
ref|YP_722754.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   142    2e-32  
gb|ACA48547.1|  caseinolytic protease C [Plasmodium sp. myna]       142    2e-32 
ref|ZP_02224348.1|  chaperone ClpB [Yersinia pestis biovar Ori...   142    2e-32 
ref|ZP_02273344.1|  ATPase AAA-2 domain protein [Fusobacterium...   142    2e-32 
ref|YP_440089.1|  ATP-dependent Clp protease, ATP-binding subu...   142    2e-32  
gb|AAS58126.4|  EvpH [Edwardsiella tarda]                           142    2e-32 
gb|ACA48560.1|  caseinolytic protease C [Haemoproteus sp. 579]      142    3e-32 
ref|YP_626772.1|  ATP-dependent C1p protease [Helicobacter pyl...   142    3e-32  
gb|ACA48556.1|  caseinolytic protease C [Plasmodium sp. P134]       142    3e-32 
gb|ACA48552.1|  caseinolytic protease C [Plasmodium sp. Inca]       142    3e-32 
ref|XP_001348236.1|  ATP-dependent Clp protease, putative [Pla...   142    3e-32  
ref|ZP_02371525.1|  ATP-dependent Clp protease, ATP-binding su...   142    3e-32 
gb|ACA48561.1|  caseinolytic protease C [Haemoproteus picae]        141    4e-32 
ref|YP_001034167.1|  ATPase with chaperone activity, ATP-bindi...   141    4e-32  
ref|ZP_01089482.1|  AAA ATPase, central region:Clp, N terminal...   141    4e-32 
ref|ZP_01739772.1|  probable chaperone [Marinobacter sp. ELB17...   141    4e-32 
ref|YP_527010.1|  Fibronectin, type III [Saccharophagus degrad...   141    4e-32  
ref|YP_542177.1|  ClpB protein [Escherichia coli UTI89] >ref|Y...   141    5e-32  
ref|ZP_00713877.1|  COG0542: ATPases with chaperone activity, ...   141    5e-32 
ref|ZP_00728435.1|  COG0542: ATPases with chaperone activity, ...   140    6e-32 
ref|YP_001546751.1|  ATPase AAA-2 domain protein [Herpetosipho...   140    6e-32  
ref|XP_792170.2|  PREDICTED: hypothetical protein, partial [St...   140    6e-32  
gb|ACA48551.1|  caseinolytic protease C [Plasmodium sp. P164]       140    7e-32 
ref|XP_001192771.1|  PREDICTED: hypothetical protein, partial ...   140    7e-32  
ref|NP_212968.1|  ATP-dependent Clp protease, subunit C (clpC)...   140    7e-32  
gb|ACA48554.1|  caseinolytic protease C [Haemoproteus syrnii]       140    8e-32 
ref|XP_861363.1|  PREDICTED: similar to suppressor of potassiu...   140    9e-32  
ref|YP_001464144.1|  ClpA/ClpB family protein [Escherichia col...   140    9e-32  
ref|NP_206835.1|  ATP-dependent C1p protease (clpA) [Helicobac...   140    1e-31  
gb|ACA48521.1|  caseinolytic protease C [Leucocytozoon sp. P157]    140    1e-31 
ref|ZP_02316918.1|  ATPase, AAA family [Yersinia pestis biovar...   140    1e-31 
ref|NP_994748.1|  Clp ATPase [Yersinia pestis biovar Microtus ...   140    1e-31  
ref|NP_404589.1|  Clp ATPase [Yersinia pestis CO92] >ref|NP_67...   140    1e-31  
ref|YP_001604798.1|  ATPase, AAA family [Yersinia pestis Angol...   140    1e-31  
ref|YP_650204.1|  Clp ATPase [Yersinia pestis Antiqua] >gb|ABG...   139    1e-31  
ref|ZP_00999576.1|  probable ClpA/B-type chaperone [Oceanicola...   139    1e-31 
gb|AAA68910.1|  Clp-like ATP-dependent protease binding subunit     139    2e-31  
ref|YP_001399721.1|  type VI secretion ATPase, ClpV1 family [Y...   139    2e-31  
gb|ACA48557.1|  caseinolytic protease C [Haemoproteus columbae...   139    2e-31 
ref|ZP_01911033.1|  ClpA/B family protein [Plesiocystis pacifi...   139    2e-31 
gb|ACA48571.1|  caseinolytic protease C [Haemoproteus sp. 1774]     139    2e-31 
ref|YP_821537.1|  ATPase AAA-2 domain protein [Solibacter usit...   139    2e-31  
ref|ZP_02464946.1|  protease associated ATPase ClpB [Burkholde...   139    2e-31 
gb|ACA48550.1|  caseinolytic protease C [Plasmodium sp. 1937]       139    2e-31 
ref|ZP_02530040.1|  ATP-dependent Clp protease, subunit C [Bor...   139    2e-31 
ref|YP_436585.1|  ATPase with chaperone activity, ATP-binding ...   139    2e-31  
ref|YP_071741.1|  Clp ATPase [Yersinia pseudotuberculosis IP 3...   139    2e-31  
gb|ACA48542.1|  caseinolytic protease C [Plasmodium sp. 513]        139    2e-31 
gb|ACA48544.1|  caseinolytic protease C [Plasmodium relictum]       139    3e-31 
ref|ZP_02887543.1|  type VI secretion ATPase, ClpV1 family [Bu...   139    3e-31 
ref|NP_755267.1|  ClpB protein [Escherichia coli CFT073] >gb|A...   139    3e-31  
gb|ACA48549.1|  caseinolytic protease C [Plasmodium sp. 1271]       139    3e-31 
gb|ACA48572.1|  caseinolytic protease C [Haemoproteus sp. 2104]     139    3e-31 
ref|YP_001617811.1|  ATP-dependent Clp protease, ATP-binding s...   139    3e-31  
ref|YP_070017.1|  Clp ATPase [Yersinia pseudotuberculosis IP 3...   138    3e-31  
ref|YP_969847.1|  ATPase AAA-2 domain protein [Acidovorax aven...   138    3e-31  
ref|ZP_02521007.1|  ATP-dependent Clp protease, subunit C (clp...   138    3e-31 
gb|ACA48562.1|  caseinolytic protease C [Haemoproteus sanguinis]    138    3e-31 
ref|ZP_02719933.1|  ATP-dependent Clp protease, subunit C (clp...   138    3e-31 
gb|ACA48558.1|  caseinolytic protease C [Haemoproteus magnus]       138    3e-31 
ref|ZP_00725608.1|  COG0542: ATPases with chaperone activity, ...   138    3e-31 
ref|ZP_00712584.1|  COG0542: ATPases with chaperone activity, ...   138    4e-31 
gb|ACA48548.1|  caseinolytic protease C [Plasmodium sp. 2375]       138    4e-31 
gb|ACA48538.1|  caseinolytic protease C [Plasmodium relictum]       138    4e-31 
gb|ACA48545.1|  caseinolytic protease C [Plasmodium sp. P166]       138    5e-31 
ref|ZP_02531418.1|  ATP-dependent Clp protease, subunit C (clp...   138    5e-31 
ref|YP_710287.1|  ATP-dependent Clp protease, subunit C [Borre...   138    5e-31  
ref|YP_073273.1|  ATP-dependent Clp protease, subunit C [Borre...   138    5e-31  
gb|ACA48540.1|  caseinolytic protease C [Plasmodium sp. 182]        137    5e-31 
gb|ACA48568.1|  caseinolytic protease C [Haemoproteus belopols...   137    5e-31 
ref|ZP_02519259.1|  ATP-dependent Clp protease, subunit C (clp...   137    6e-31 
gb|ACA48546.1|  caseinolytic protease C [Plasmodium sp. P159]       137    6e-31 
gb|ACA48533.1|  caseinolytic protease C [Plasmodium azurophilum]    137    6e-31 
ref|ZP_02413190.1|  protease associated ATPase ClpB [Burkholde...   137    7e-31 
gb|ACA48535.1|  caseinolytic protease C [Plasmodium giganteum]      137    8e-31 
ref|ZP_01466062.1|  ATP-dependent Clp protease regulatory subu...   137    9e-31 
gb|ACA48570.1|  caseinolytic protease C [Haemoproteus sp. 1000]     137    1e-30 
ref|NP_903635.1|  probable ClpA/B-type chaperone [Chromobacter...   137    1e-30  
gb|ACA48569.1|  caseinolytic protease C [Haemoproteus fringillae]   137    1e-30 
ref|ZP_01735542.1|  clpB protein [Marinobacter sp. ELB17] >gb|...   137    1e-30 
ref|ZP_02907702.1|  type VI secretion ATPase, ClpV1 family [Bu...   136    1e-30 
ref|XP_001616883.1|  ATP-dependent Clp protease, putative [Pla...   136    1e-30  
ref|YP_789787.1|  putative ATPases with chaperone activity, AT...   136    1e-30  
gb|ACA48526.1|  caseinolytic protease C [Plasmodium atheruri]       136    2e-30 
gb|ABY70712.1|  ClpC [Plasmodium streptopelia]                      136    2e-30 
gb|ACA48543.1|  caseinolytic protease C [Plasmodium sp. 594]        136    2e-30 
ref|ZP_02364316.1|  ClpA/B type protease [Burkholderia oklahom...   135    2e-30 
gb|ACA48553.1|  caseinolytic protease C [Haemoproteus columbae]     135    2e-30 
ref|ZP_02357210.1|  ClpA/B type protease [Burkholderia oklahom...   135    2e-30 
ref|YP_001347148.1|  probable chaperone [Pseudomonas aeruginos...   135    2e-30  
ref|ZP_01756828.1|  probable ClpA/B-type chaperone [Roseobacte...   135    2e-30 
ref|ZP_01624983.1|  probable ClpA/B-type chaperone [marine gam...   135    2e-30 
ref|YP_622503.1|  ATPase AAA-2 [Burkholderia cenocepacia AU 10...   135    2e-30  
ref|ZP_02889973.1|  type VI secretion ATPase, ClpV1 family [Bu...   135    2e-30 
ref|YP_001668999.1|  type VI secretion ATPase, ClpV1 family [P...   135    2e-30  
gb|ACA48530.1|  caseinolytic protease C [Plasmodium mexicanum]      135    3e-30 
gb|ACA48523.1|  caseinolytic protease C [Plasmodium yoelii]         135    3e-30 
ref|ZP_01440628.1|  probable chaperone [Fulvimarina pelagi HTC...   135    3e-30 
ref|YP_436584.1|  ATPase with chaperone activity, ATP-binding ...   135    4e-30  
gb|ACA48539.1|  caseinolytic protease C [Plasmodium sp. P121]       135    4e-30 
ref|YP_204382.1|  ATP-dependent protease subunit [Vibrio fisch...   135    4e-30  
ref|NP_252055.1|  probable chaperone [Pseudomonas aeruginosa P...   134    4e-30  
ref|ZP_00974049.1|  COG0542: ATPases with chaperone activity, ...   134    4e-30 
ref|ZP_01511998.1|  ATPase AAA-2 [Burkholderia phytofirmans Ps...   134    5e-30 
emb|CAA54405.1|  amiB [Pseudomonas aeruginosa]                      134    5e-30 
gb|ACA48534.1|  caseinolytic protease C [Plasmodium azurophilum]    134    5e-30 
ref|ZP_00968335.1|  COG0542: ATPases with chaperone activity, ...   134    5e-30 
gb|EAZ59493.1|  hypothetical protein PA2G_02778 [Pseudomonas a...   134    5e-30 
ref|YP_443465.1|  ClpA/B type protease [Burkholderia thailande...   134    5e-30  
gb|ACA48565.1|  caseinolytic protease C [Haemoproteus sp. 2223]     134    5e-30 
ref|ZP_02375886.1|  ClpA/B type protease [Burkholderia thailan...   134    5e-30 
gb|EAZ53768.1|  hypothetical protein PACG_02298 [Pseudomonas a...   134    6e-30 
gb|ACA48537.1|  caseinolytic protease C [Plasmodium relictum]       134    6e-30 
ref|YP_825509.1|  ATPase AAA-2 domain protein [Solibacter usit...   134    7e-30  
gb|ACA48528.1|  caseinolytic protease C [Hepatocystis sp. MB6]      134    8e-30 
ref|ZP_01896679.1|  protease associated ATPase ClpB [Moritella...   134    8e-30 
gb|ACA48541.1|  caseinolytic protease C [Plasmodium sp. 318]        134    9e-30 
ref|ZP_01984818.1|  ATPase with chaperone activity, ATP-bindin...   134    9e-30 
ref|YP_001581105.1|  type VI secretion ATPase, ClpV1 family [B...   134    9e-30  
ref|YP_574322.1|  ATPase AAA-2 [Chromohalobacter salexigens DS...   133    1e-29  
ref|YP_751045.1|  ATPase AAA-2 domain protein [Shewanella frig...   133    1e-29  
ref|YP_001118313.1|  ATPase AAA-2 domain protein [Burkholderia...   133    1e-29  
ref|ZP_01056639.1|  probable ClpA/B-type chaperone [Roseobacte...   133    1e-29 
gb|ACA48529.1|  caseinolytic protease C [Hepatocystis sp. MB3]      133    1e-29 
ref|YP_335003.1|  protease associated ATPase ClpB [Burkholderi...   133    1e-29  
ref|ZP_02010065.1|  ATPase AAA-2 domain protein [Ralstonia pic...   133    2e-29 
ref|YP_001267945.1|  ATPase AAA-2 domain protein [Pseudomonas ...   132    2e-29  
ref|NP_668858.1|  Clp ATPase [Yersinia pestis KIM] >ref|NP_993...   132    2e-29  
ref|YP_001607096.1|  type VI secretion ATPase ClpV1 [Yersinia ...   132    2e-29  
ref|NP_406442.1|  Clp ATPase [Yersinia pestis CO92] >ref|YP_65...   132    2e-29  
ref|YP_272439.1|  ATP-dependent Clp protease ATP-binding subun...   132    2e-29  
ref|NP_951492.1|  clpB protein, putative [Geobacter sulfurredu...   132    2e-29  
ref|YP_001749374.1|  type VI secretion ATPase, ClpV1 family [P...   132    2e-29  
ref|YP_238023.1|  AAA ATPase, central region:Clp, N terminal:C...   132    2e-29  
ref|ZP_02908161.1|  type VI secretion ATPase, ClpV1 family [Bu...   132    3e-29 
ref|ZP_02507810.1|  protease associated ATPase ClpB [Burkholde...   132    3e-29 
ref|YP_104343.1|  ClpA/B type protease [Burkholderia mallei AT...   132    3e-29  
ref|ZP_02483511.1|  protease associated ATPase ClpB [Burkholde...   132    3e-29 
ref|YP_109696.1|  protease associated ATPase ClpB [Burkholderi...   132    3e-29  
ref|ZP_01322523.1|  hypothetical protein BpseP_03003668 [Burkh...   132    3e-29 
ref|ZP_00990457.1|  Chaperonin clpA/B/, ATPase [Vibrio splendi...   132    3e-29 
ref|ZP_01767551.1|  Chaperone clpB [Burkholderia pseudomallei ...   132    4e-29 
ref|YP_047269.1|  putative ClpA/B-type chaperone [Acinetobacte...   132    4e-29  
ref|YP_001006887.1|  Clp ATPase [Yersinia enterocolitica subsp...   132    4e-29  
ref|NP_762394.1|  ATPase with chaperone activity, ATP-binding ...   131    4e-29  
ref|YP_367810.1|  Chaperonin clpA/B/, ATPase [Burkholderia sp....   131    4e-29  
sp|Q01357|ADPR_RHOER  ATP-dependent protease ATP-binding subun...   131    4e-29 
ref|NP_937036.1|  ATPase with chaperone activity, ATP-binding ...   131    4e-29  
ref|ZP_01880197.1|  probable chaperone [Roseovarius sp. TM1035...   131    5e-29 
ref|YP_834120.1|  ATPase AAA-2 domain protein [Burkholderia ce...   131    5e-29  
ref|YP_202114.1|  ClpB [Xanthomonas oryzae pv. oryzae KACC1033...   131    5e-29  
ref|ZP_00441293.1|  COG0542: ATPases with chaperone activity, ...   131    5e-29 
ref|ZP_01344308.1|  hypothetical protein Bmal10_03002883 [Burk...   131    5e-29 
ref|ZP_00981389.1|  COG0542: ATPases with chaperone activity, ...   131    5e-29 
ref|NP_644439.1|  ClpB [Xanthomonas axonopodis pv. citri str. ...   131    5e-29  
ref|ZP_01341511.1|  hypothetical protein Bmal2_03000658 [Burkh...   131    5e-29 
ref|ZP_02905791.1|  type VI secretion ATPase, ClpV1 family [Bu...   131    6e-29 
ref|ZP_01035616.1|  probable ClpA/B-type chaperone [Roseovariu...   131    6e-29 
gb|ACA48525.1|  caseinolytic protease C [Plasmodium chabaudi]       130    7e-29 
ref|ZP_02888875.1|  type VI secretion ATPase, ClpV1 family [Bu...   130    7e-29 
ref|ZP_01612633.1|  putative ATPase subunit of ATP-dependent p...   130    7e-29 
ref|ZP_01318001.1|  hypothetical protein Bpse1_03002672 [Burkh...   130    7e-29 
ref|ZP_02872643.1|  ATPase AAA-2 [candidate division TM7 singl...   130    7e-29 
ref|ZP_02458154.1|  SciG protein [Burkholderia pseudomallei 9]      130    7e-29 
ref|ZP_02366805.1|  ClpA/B type protease [Burkholderia oklahom...   130    7e-29 
ref|ZP_02359779.1|  ClpA/B type protease [Burkholderia oklahom...   130    7e-29 
ref|YP_110137.1|  chaperone-related protein [Burkholderia pseu...   130    7e-29  
ref|ZP_02381650.1|  Chaperonin clpA/B/, ATPase [Burkholderia u...   130    8e-29 
ref|ZP_02135470.1|  ATP-dependent protease subunit [Vibrio fis...   130    8e-29 
ref|ZP_00978763.1|  COG0542: ATPases with chaperone activity, ...   130    8e-29 
ref|YP_536709.1|  ATP-dependent Clp protease [Lactobacillus sa...   130    8e-29  
ref|ZP_02458063.1|  SciG protein [Burkholderia pseudomallei 9]...   130    8e-29 
ref|ZP_02449978.1|  SciG protein [Burkholderia pseudomallei 91]     130    8e-29 
ref|YP_772280.1|  ATPase AAA-2 domain protein [Burkholderia am...   130    8e-29  
ref|YP_722256.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   130    9e-29  
ref|YP_725167.1|  ATP-dependent protease Clp, ATPase subunit [...   130    9e-29  
ref|YP_071181.1|  Clp ATPase [Yersinia pseudotuberculosis IP 3...   130    9e-29  
ref|YP_001807121.1|  type VI secretion ATPase, ClpV1 family [B...   130    9e-29  
ref|YP_775361.1|  ATPase AAA-2 domain protein [Burkholderia am...   130    9e-29  
ref|YP_001400341.1|  Clp protease-associated protein ClpB [Yer...   130    9e-29  
ref|YP_001060634.1|  ClpA/B type protease [Burkholderia pseudo...   130    1e-28  
ref|ZP_02500534.1|  chaperone [Burkholderia pseudomallei 112]       130    1e-28 
ref|ZP_00985252.1|  COG0542: ATPases with chaperone activity, ...   130    1e-28 
ref|ZP_01459651.1|  chaperone ClpB [Stigmatella aurantiaca DW4...   130    1e-28 
ref|ZP_01126750.1|  probable ClpA/B-type chaperone [Nitrococcu...   130    1e-28 
ref|NP_745239.1|  chaperone-associated ATPase, putative [Pseud...   130    1e-28  
ref|ZP_01509804.1|  ATPase AAA-2 [Burkholderia phytofirmans Ps...   129    2e-28 
ref|YP_363858.1|  ATP-dependent Clp protease subunit [Xanthomo...   129    2e-28  
ref|ZP_02905218.1|  type VI secretion ATPase, ClpV1 family [Bu...   129    2e-28 
ref|ZP_02242346.1|  ClpB [Xanthomonas oryzae pv. oryzicola BLS...   129    2e-28 
ref|YP_001061184.1|  Chaperone clpB [Burkholderia pseudomallei...   129    2e-28  
ref|ZP_01443033.1|  probable ClpA/B-type chaperone [Roseovariu...   129    2e-28 
ref|ZP_00987835.1|  COG0542: ATPases with chaperone activity, ...   129    2e-28 
gb|ACA48531.1|  caseinolytic protease C [Plasmodium floridense]     129    2e-28 
gb|ACA48524.1|  caseinolytic protease C [Plasmodium vinckei]        129    2e-28 
ref|YP_001439943.1|  hypothetical protein ESA_03921 [Enterobac...   129    2e-28  
ref|ZP_01475499.1|  hypothetical protein VEx2w_02001942 [Vibri...   129    2e-28 
ref|YP_001479242.1|  ATPase AAA-2 domain protein [Serratia pro...   129    3e-28  
gb|ACA48536.1|  caseinolytic protease C [Plasmodium gallinaceum]    129    3e-28 
gb|EDS84840.1|  chaperone clpB [Burkholderia pseudomallei S13]      128    3e-28 
gb|EDO92968.1|  chaperone ClpB [Burkholderia pseudomallei Past...   128    3e-28 
ref|YP_336782.1|  SciG protein [Burkholderia pseudomallei 1710...   128    3e-28  
ref|ZP_00417634.1|  AAA ATPase, central region:Clp, N terminal...   128    3e-28 
ref|ZP_02492233.1|  SciG protein [Burkholderia pseudomallei NC...   128    3e-28 
ref|ZP_01325037.1|  hypothetical protein BpseP_03001019 [Burkh...   128    3e-28 
ref|ZP_02413795.1|  Chaperone clpB [Burkholderia pseudomallei 14]   128    3e-28 
ref|YP_001074199.1|  Chaperone clpB [Burkholderia pseudomallei...   128    3e-28  
ref|YP_001197757.1|  ATPases with chaperone activity, ATP-bind...   128    4e-28  
ref|ZP_02409103.1|  SciG protein [Burkholderia pseudomallei DM98]   128    4e-28 
ref|ZP_01335532.1|  hypothetical protein Bpse4_03002025 [Burkh...   128    4e-28 
ref|YP_001810327.1|  type VI secretion ATPase, ClpV1 family [B...   128    4e-28  
ref|ZP_02104603.1|  Chaperone clpB [Burkholderia pseudomallei ...   128    4e-28 
ref|YP_001812346.1|  type VI secretion ATPase, ClpV1 family [B...   128    4e-28  
ref|ZP_01329962.1|  hypothetical protein BpseS_03001897 [Burkh...   128    4e-28 
ref|ZP_02413886.1|  Chaperone clpB [Burkholderia pseudomallei 14]   128    5e-28 
ref|YP_110195.1|  chaperone [Burkholderia pseudomallei K96243]...   128    5e-28  
ref|ZP_01325092.1|  hypothetical protein BpseP_03001076 [Burkh...   128    5e-28 
ref|ZP_01334534.1|  hypothetical protein Bpse4_03002970 [Burkh...   128    5e-28 
ref|ZP_02473708.1|  Chaperone clpB [Burkholderia pseudomallei ...   128    5e-28 
ref|ZP_02383570.1|  ClpA/B type protease [Burkholderia thailan...   127    5e-28 
ref|ZP_01767701.1|  Chaperone clpB [Burkholderia pseudomallei ...   127    5e-28 
ref|YP_336853.1|  SciG protein [Burkholderia pseudomallei 1710...   127    5e-28  
ref|ZP_01318724.1|  hypothetical protein Bpse1_03001886 [Burkh...   127    5e-28 
ref|YP_001061341.1|  Chaperone clpB [Burkholderia pseudomallei...   127    6e-28  
ref|ZP_02508472.1|  Chaperone clpB [Burkholderia pseudomallei ...   127    6e-28 
ref|NP_929544.1|  hypothetical protein plu2287 [Photorhabdus l...   127    6e-28  
ref|ZP_02492344.1|  Chaperone clpB [Burkholderia pseudomallei ...   127    6e-28 
ref|ZP_02884398.1|  type VI secretion ATPase, ClpV1 family [Bu...   127    6e-28 
ref|ZP_01502303.1|  ATPase AAA-2 [Burkholderia phymatum STM815...   127    7e-28 
ref|ZP_02243432.1|  ClpB [Xanthomonas oryzae pv. oryzicola BLS...   127    7e-28 
ref|YP_001707525.1|  putative ClpA/B-type chaperone [Acinetoba...   127    7e-28  
ref|YP_451928.1|  ClpB [Xanthomonas oryzae pv. oryzae MAFF 311...   127    7e-28  
ref|YP_001525503.1|  ATPase [Azorhizobium caulinodans ORS 571]...   127    8e-28  
ref|YP_285380.1|  AAA ATPase, central region:Clp, N terminal [...   127    8e-28  
ref|YP_001187821.1|  ATPase AAA-2 domain protein [Pseudomonas ...   127    8e-28  
ref|YP_001809700.1|  type VI secretion ATPase, ClpV1 family [B...   127    9e-28  
ref|YP_309261.1|  putative ATP-dependent Clp proteinase ATP-bi...   127    9e-28  
emb|CAJ47876.1|  putative ATPase with chaperone activity [Bord...   127    9e-28 
ref|ZP_01259844.1|  putative ClpA/B-type chaperone [Vibrio alg...   127    9e-28 
ref|ZP_02461033.1|  SciG protein [Burkholderia pseudomallei 9]      127    9e-28 
ref|YP_629741.1|  ClpA/B family protein [Myxococcus xanthus DK...   127    9e-28  
ref|ZP_02452896.1|  SciG protein [Burkholderia pseudomallei 91]     127    1e-27 
ref|ZP_02408328.1|  putative ATP-dependent Clp protease, ATP-b...   127    1e-27 
ref|ZP_02476550.1|  putative ATP-dependent Clp protease, ATP-b...   127    1e-27 
ref|ZP_02416794.1|  putative ATP-dependent Clp protease, ATP-b...   127    1e-27 
ref|ZP_02495188.1|  putative ATP-dependent Clp protease, ATP-b...   127    1e-27 
ref|ZP_02511275.1|  putative ATP-dependent Clp protease, ATP-b...   127    1e-27 
ref|ZP_02487074.1|  putative ATP-dependent Clp protease, ATP-b...   127    1e-27 
ref|ZP_02367249.1|  Putative ClpA/B-type chaperone, ATPase sub...   126    1e-27 
ref|ZP_02360805.1|  ATPase AAA-2 domain protein [Burkholderia ...   126    1e-27 
ref|YP_001461390.1|  ATP-dependent chaperone protein ClpB [Esc...   126    1e-27  
ref|YP_001457003.1|  type VI secretion ATPase, ClpV1 family [E...   126    1e-27  
ref|ZP_00736038.1|  COG0542: ATPases with chaperone activity, ...   126    1e-27 
ref|ZP_00716327.1|  COG0542: ATPases with chaperone activity, ...   126    1e-27 
ref|YP_001714236.1|  putative ClpA/B-type chaperone [Acinetoba...   126    1e-27  
ref|YP_371737.1|  AAA ATPase, Clp [Burkholderia sp. 383] >gb|A...   126    2e-27  
ref|ZP_00730182.1|  COG0542: ATPases with chaperone activity, ...   126    2e-27 
ref|YP_001084337.1|  putative ClpA/B-type chaperone [Acinetoba...   126    2e-27  
ref|YP_435385.1|  ATPase with chaperone activity, ATP-binding ...   125    2e-27  
emb|CAA37573.1|  unnamed protein product [Mycobacterium leprae]     125    2e-27 
ref|NP_927718.1|  hypothetical protein plu0363 [Photorhabdus l...   125    2e-27  
ref|ZP_02574377.1|  putative chaperone ATPase [Salmonella ente...   125    2e-27 
ref|ZP_02814678.1|  putative ATP-dependent Clp proteinase ATP-...   125    3e-27 
ref|ZP_02740232.1|  putative ATP-dependent Clp proteinase ATP-...   125    3e-27 
ref|YP_007231.1|  putative endopeptidase Clp ATP-binding chain...   125    3e-27  
ref|NP_285915.1|  putative protease [Escherichia coli O157:H7 ...   125    3e-27  
ref|ZP_01074865.1|  clpB protein [Marinomonas sp. MED121] >gb|...   125    3e-27 
ref|YP_365967.1|  ClpB protein [Xanthomonas campestris pv. ves...   125    3e-27  
ref|ZP_02467437.1|  ClpA/B type protease [Burkholderia thailan...   125    3e-27 
ref|ZP_00419344.1|  AAA ATPase, central region:Clp, N terminal...   125    3e-27 
ref|YP_001793101.1|  type VI secretion ATPase, ClpV1 family [L...   125    3e-27  
ref|ZP_02465459.1|  SciG protein [Burkholderia thailandensis M...   125    3e-27 
ref|ZP_02369482.1|  ClpA/B type protease [Burkholderia thailan...   125    3e-27 
ref|YP_828436.1|  ATPase AAA-2 domain protein [Solibacter usit...   125    4e-27  
ref|YP_961116.1|  ATPase AAA-2 domain protein [Marinobacter aq...   125    4e-27  
ref|YP_295936.1|  AAA ATPase, central region:Clp, N terminal [...   124    5e-27  
emb|CAB46061.1|  heat shock protein like [Arabidopsis thaliana...   124    5e-27 
ref|ZP_01444199.1|  probable ClpA/B-type protease [Roseovarius...   124    6e-27 
ref|ZP_02376118.1|  SciG protein [Burkholderia ubonensis Bu]        124    6e-27 
ref|ZP_02369638.1|  ClpA/B type protease [Burkholderia thailan...   124    7e-27 
ref|YP_438342.1|  ClpA/B type protease [Burkholderia thailande...   124    7e-27  
ref|YP_263151.1|  ClpB [Pseudomonas fluorescens Pf-5] >gb|AAY9...   124    8e-27  
ref|ZP_00632702.1|  AAA ATPase, central region:Clp, N terminal...   124    9e-27  
gb|AAZ67679.1|  chaperone putative [Haemophilus parasuis]           124    1e-26 
ref|ZP_00945141.1|  ClpB protein [Ralstonia solanacearum UW551...   124    1e-26 
ref|ZP_02383420.1|  ClpA/B type protease [Burkholderia thailan...   123    1e-26 
ref|ZP_01989903.1|  ATPase with chaperone activity, ATP-bindin...   123    1e-26 
ref|ZP_01306060.1|  ATPase with chaperone activity, ATP-bindin...   123    1e-26 
ref|NP_522310.1|  PUTATIVE CLPA/B-TYPE CHAPERONE PROTEIN [Rals...   123    1e-26  
ref|ZP_00823047.1|  COG0542: ATPases with chaperone activity, ...   123    1e-26 
ref|YP_438466.1|  ClpA/B type protease [Burkholderia thailande...   123    1e-26  
ref|YP_001610971.1|  ATP-dependent Clp protease, ATP-binding s...   123    1e-26  
ref|NP_800538.1|  putative ClpA/B-type chaperone [Vibrio parah...   123    1e-26  
ref|ZP_01813493.1|  Chaperonin clpA/B/, ATPase [Vibrionales ba...   122    2e-26 
ref|ZP_00711334.1|  COG0542: ATPases with chaperone activity, ...   122    2e-26 
ref|ZP_02427384.1|  hypothetical protein CLORAM_00762 [Clostri...   122    2e-26 
ref|YP_693699.1|  chaperone-associated ATPase, putative [Alcan...   122    2e-26  
gb|ACA48527.1|  caseinolytic protease C [Hepatocystis sp. LDFB]     122    2e-26 
ref|YP_510965.1|  ATPase AAA-2 [Jannaschia sp. CCS1] >gb|ABD55...   122    2e-26  
ref|YP_001719153.1|  type VI secretion ATPase, ClpV1 family [Y...   122    2e-26  
ref|YP_001632723.1|  putative ATPase with chaperone activity [...   122    3e-26  
ref|NP_407054.1|  Clp ATPase [Yersinia pestis CO92] >ref|NP_66...   122    3e-26  
ref|YP_001583881.1|  type VI secretion ATPase, ClpV1 family [B...   122    3e-26  
ref|YP_201684.1|  ClpB [Xanthomonas oryzae pv. oryzae KACC1033...   122    3e-26  
ref|YP_112093.1|  Clp protease ATPase [Burkholderia pseudomall...   122    3e-26  
ref|YP_841940.1|  ATP-dependent protease Clp, ATPase subunit [...   122    3e-26  
ref|ZP_00441357.1|  COG0542: ATPases with chaperone activity, ...   122    3e-26 
ref|ZP_01330764.1|  hypothetical protein BpseS_03001211 [Burkh...   122    3e-26 
ref|YP_001063945.1|  putative ATP-dependent Clp protease, ATP-...   122    3e-26  
ref|ZP_01317821.1|  hypothetical protein Bpse1_03002808 [Burkh...   122    3e-26 
ref|ZP_01342145.1|  hypothetical protein Bmal2_03000183 [Burkh...   122    4e-26 
ref|YP_001076858.1|  putative ATP-dependent Clp protease, ATP-...   122    4e-26  
ref|ZP_01333450.1|  hypothetical protein Bpse4_03004069 [Burkh...   122    4e-26 
gb|EDO88649.1|  putative ATP-dependent Clp protease, ATP-bindi...   121    4e-26 
ref|ZP_01765325.1|  putative ATP-dependent Clp protease, ATP-b...   121    4e-26 
ref|YP_001077661.1|  putative ATP-dependent Clp protease, ATP-...   121    4e-26  
ref|YP_105198.1|  putative ATP-dependent Clp protease, ATP-bin...   121    4e-26  
ref|YP_001025587.1|  putative ATP-dependent Clp protease, ATP-...   121    4e-26  
ref|YP_558924.1|  Putative ClpA/B-type chaperone, ATPase subun...   121    5e-26  
ref|ZP_02699209.1|  ClpB-like protein [Salmonella enterica sub...   121    5e-26 
ref|ZP_01913835.1|  probable ClpA/B-type chaperone [Limnobacte...   121    6e-26 
ref|YP_372340.1|  AAA ATPase, Clp [Burkholderia sp. 383] >gb|A...   121    6e-26  
ref|ZP_02676305.1|  putative chaperone ATPase [Salmonella ente...   121    6e-26 
ref|ZP_02559194.1|  putative chaperone ATPase [Salmonella ente...   121    6e-26 
ref|ZP_01948480.1|  clpB protein [Vibrio cholerae 1587] >gb|EA...   120    7e-26 
ref|XP_001736409.1|  hypothetical protein, conserved [Entamoeb...   120    7e-26  
ref|NP_454876.1|  ClpB-like protein [Salmonella enterica subsp...   120    7e-26  
ref|ZP_01503113.1|  ATPase AAA-2 [Burkholderia phymatum STM815...   120    7e-26 
ref|ZP_01893472.1|  chaperone-associated ATPase, putative [Mar...   120    8e-26 
ref|YP_151684.1|  ClpB-like protein [Salmonella enterica subsp...   120    9e-26  
ref|ZP_02339789.1|  putative chaperone ATPase [Salmonella ente...   120    9e-26 
ref|ZP_02353046.1|  putative chaperone ATPase [Salmonella ente...   120    9e-26 
ref|ZP_02831155.1|  putative chaperone ATPase [Salmonella ente...   120    1e-25 
ref|YP_001564880.1|  type VI secretion ATPase, ClpV1 family [D...   120    1e-25  
ref|NP_459269.1|  putative chaperone ATPase [Salmonella typhim...   120    1e-25  
ref|ZP_02663698.1|  ClpB-like protein [Salmonella enterica sub...   120    1e-25 
ref|ZP_02683302.1|  putative chaperone ATPase [Salmonella ente...   120    1e-25 
ref|YP_349141.1|  probable ClpA/B-type protease [Pseudomonas f...   120    1e-25  
ref|ZP_01999819.1|  ClpA/B-type protease [Beggiatoa sp. PS] >g...   120    1e-25 
ref|ZP_02664938.1|  putative chaperone ATPase [Salmonella ente...   119    2e-25 
ref|YP_001601616.1|  putative chaperone clpB [Gluconacetobacte...   119    2e-25  
ref|YP_935405.1|  putative ATP-dependent Clp protease, ATP-bin...   119    2e-25  
ref|ZP_00725555.1|  COG0542: ATPases with chaperone activity, ...   119    2e-25 
ref|YP_668165.1|  Clp ATPase [Escherichia coli 536] >gb|ABG682...   119    2e-25  
ref|YP_539276.1|  hypothetical protein UTI89_C0242 [Escherichi...   119    2e-25  
ref|NP_232517.1|  clpB protein [Vibrio cholerae O1 biovar elto...   119    2e-25  
ref|ZP_02648633.1|  putative ATP-dependent Clp proteinase ATP-...   119    2e-25 
gb|EDN17400.1|  clpB protein [Vibrio cholerae AM-19226]             119    2e-25 
ref|ZP_01483670.1|  hypothetical protein VchoR_02000373 [Vibri...   119    2e-25 
ref|ZP_01680163.1|  clpB protein [Vibrio cholerae V52] >gb|EAX...   119    2e-25 
ref|ZP_00722902.1|  COG0542: ATPases with chaperone activity, ...   119    2e-25 
ref|ZP_01981678.1|  clpB protein [Vibrio cholerae 623-39] >gb|...   119    3e-25 
ref|ZP_02833727.1|  putative ATP-dependent Clp proteinase ATP-...   119    3e-25 
ref|ZP_01486337.1|  hypothetical protein VchoV5_02001035 [Vibr...   118    4e-25 
ref|XP_762692.1|  molecular chaperone [Theileria parva strain ...   118    4e-25  
dbj|BAA97091.1|  ATP-dependent CLPB protein-like [Arabidopsis ...   118    5e-25 
ref|ZP_02346887.1|  ClpB-like protein [Salmonella enterica sub...   118    5e-25 
ref|ZP_02350234.1|  putative ATP-dependent Clp proteinase ATP-...   117    6e-25 
gb|AAC70950.1|  ATP-dependent Clp protease ATP-binding subunit...   117    7e-25 
ref|YP_001161597.1|  Clp ATPase [Yersinia pestis Pestoides F] ...   117    8e-25  
ref|NP_883062.1|  putative ATPase with chaperone activity [Bor...   116    1e-24  
ref|NP_887359.1|  putative ATPase with chaperone activity [Bor...   116    1e-24  
ref|ZP_00975173.1|  COG0542: ATPases with chaperone activity, ...   116    2e-24 
ref|YP_790872.1|  probable ClpA/B-type protease [Pseudomonas a...   116    2e-24  
ref|NP_251061.1|  probable ClpA/B-type protease [Pseudomonas a...   116    2e-24  
ref|ZP_00969315.1|  COG0542: ATPases with chaperone activity, ...   115    2e-24 
ref|ZP_02408725.1|  hypothetical protein BpseD_41106 [Burkhold...   115    3e-24 
gb|AAQ07074.1|AF496387_1  ATP-dependent clp protease ATP-bindi...   115    3e-24 
ref|YP_001348250.1|  type VI secretion ATPase, ClpV1 family [P...   114    5e-24  
gb|ACA48520.1|  truncated caseinolytic protease C [Leucocytozo...   114    5e-24 
ref|ZP_02868603.1|  hypothetical protein CLOSPI_02446 [Clostri...   114    8e-24 
ref|YP_818584.1|  ATP-binding subunit of Clp protease and DnaK...   113    1e-23  
ref|XP_001539219.1|  hypothetical protein HCAG_06824 [Ajellomy...   113    1e-23  
ref|ZP_02544015.1|  ATP-dependent endopeptidase clp ATP-bindin...   113    2e-23 
ref|YP_001818095.1|  ATPase AAA-2 domain protein [Opitutus ter...   113    2e-23  
emb|CAG13880.1|  unnamed protein product [Tetraodon nigroviridis]   112    3e-23 
gb|EAZ18048.1|  hypothetical protein OsJ_032257 [Oryza sativa ...   112    3e-23 
ref|ZP_00050835.1|  COG0542: ATPases with chaperone activity, ...   109    2e-22 
ref|YP_001267465.1|  ATPase AAA-2 domain protein [Pseudomonas ...   108    3e-22  
ref|NP_404149.1|  putative Clp ATPase [Yersinia pestis CO92] >...   107    7e-22  
ref|YP_653497.1|  putative Clp ATPase [Yersinia pestis Antiqua...   107    8e-22  
ref|YP_116964.1|  putative ATP-dependent protease [Nocardia fa...   106    2e-21  
ref|ZP_00827256.1|  COG0542: ATPases with chaperone activity, ...   106    2e-21 
gb|AAC61748.1|  heat shock protein hsp104 [Plasmodium falciparum]   106    2e-21 
ref|YP_001821367.1|  ATPase AAA-2 domain protein [Opitutus ter...   105    2e-21  
ref|XP_670066.1|  hypothetical protein PB301184.00.0 [Plasmodi...   103    2e-20  
gb|AAN17424.1|  HSP100/ClpB, putative [Arabidopsis thaliana] >...   102    2e-20 
ref|XP_001701975.1|  ClpB chaperone, Hsp100 family [Chlamydomo...   102    3e-20  
ref|NP_760982.1|  ATP-dependent Clp protease [Vibrio vulnificu...   102    3e-20  
ref|YP_191974.1|  ATP-dependent Clp protease ATP-binding subun...   102    4e-20  
ref|ZP_02889004.1|  ATPase AAA-2 domain protein [Burkholderia ...   100    1e-19 
ref|ZP_02004209.1|  ATP-dependent clp protease ATP-binding [Be...  99.4    2e-19 
gb|AAX39446.1|  unknown [Erwinia amylovora]                        99.4    2e-19 
ref|ZP_00054374.1|  COG0542: ATPases with chaperone activity, ...  96.3    2e-18 
ref|XP_001741456.1|  heat shock protein, putative [Entamoeba d...  93.2    1e-17  
ref|ZP_01922361.1|  ATPase AAA-2 domain protein [Victivallis v...  92.4    3e-17 
ref|YP_781558.1|  ATPase AAA-2 domain protein [Rhodopseudomona...  92.4    3e-17  
gb|AAQ06695.1|AF496038_1  ATP-dependent clp-like protease ATP-...  92.0    4e-17 
ref|NP_600993.1|  ATPase with chaperone activity, ATP-binding ...  91.3    7e-17  
emb|CAA23639.1|  unnamed protein product [Escherichia coli]        90.9    8e-17 
ref|XP_001544739.1|  predicted protein [Ajellomyces capsulatus...  90.9    9e-17  
gb|AAA88583.1|  unknown protein                                    90.5    1e-16 
ref|XP_734361.1|  hypothetical protein PC300656.00.0 [Plasmodi...  90.1    1e-16  
gb|AAR25794.1|  ATP-dependent CLP protease [Solanum tuberosum]     88.6    4e-16 
ref|ZP_01679069.1|  chaperone ClpB [Vibrio cholerae 2740-80] >...  88.6    4e-16 
gb|AAC41451.1|  ATP-dependent protease [Lactococcus lactis sub...  86.3    2e-15 
ref|YP_246165.1|  ClpB protein [Rickettsia felis URRWXCal2] >g...  85.1    4e-15  
gb|EDT88360.1|  clpB protein [Vibrio cholerae MZO-3]               85.1    5e-15 
ref|ZP_01446846.1|  ATP-dependent Clp protease, ATP-binding su...  84.7    6e-15 
ref|ZP_02281574.1|  endopeptidase Clp ATP-binding chain C [Lis...  83.2    2e-14 
gb|AAC08399.1|  ATP-dependent protease [Mesembryanthemum cryst...  83.2    2e-14 
ref|XP_001386083.2|  hypothetical protein PICST_33333 [Pichia ...  81.6    5e-14  
gb|AAP84128.1|  ClpB [Pseudomonas aeruginosa]                      81.3    7e-14 
ref|XP_001608822.1|  chaperone clpB, putative [Babesia bovis T...  79.7    2e-13  
ref|ZP_01998390.1|  ATP-dependent Clp protease, ATP-binding su...  79.3    3e-13 
ref|YP_818549.1|  ATP-binding subunit of Clp protease and DnaK...  79.3    3e-13  
ref|ZP_02538161.1|  ATPase with chaperon activity, two ATP-bin...  78.2    5e-13 
gb|ACA23193.1|  Clp proteinase [Bifidobacterium bifidum]           78.2    6e-13 
emb|CAJ74763.1|  unknown protein [Candidatus Kuenenia stuttgar...  77.4    9e-13 
gb|EDS88717.1|  heat shock protein 101, putative [Entamoeba hi...  77.0    1e-12 
emb|CAA66164.1|  heat shock protein 104 [Saccharomyces cerevis...  76.6    1e-12 
gb|ABG77144.1|  ATP-dependent Clp protease subunit [Endoriftia...  76.6    2e-12 
ref|YP_878928.1|  ATP-dependent Clp protease, ATPase subunit, ...  76.6    2e-12  
ref|ZP_02012431.1|  ATP-dependent Clp protease subunit, heat s...  76.3    2e-12 
sp|O15885|CLP_TRYCR  Heat shock protein 100 (Protein CLP) >emb...  75.9    3e-12 
ref|NP_925429.1|  ATP-dependent protease ATP-binding subunit [...  75.1    5e-12  
gb|AAU07695.1|  plastid clpB [Helicosporidium sp. ex Simulium ...  73.6    1e-11 
ref|NP_600966.1|  ATPase with chaperone activity, ATP-binding ...  73.2    2e-11  
ref|ZP_02207757.1|  hypothetical protein COPEUT_02580 [Coproco...  73.2    2e-11 
ref|ZP_01217518.1|  negative regulator of genetic competence c...  72.0    4e-11 
ref|YP_001330705.1|  ATPase AAA-2 domain protein [Methanococcu...  70.5    1e-10  
ref|YP_268526.1|  ATP-dependent peptidase, M41 family [Colwell...  69.7    2e-10  
ref|ZP_02081730.1|  hypothetical protein CLOLEP_03214 [Clostri...  69.3    3e-10 
gb|AAA26880.1|  Exp4                                               69.3    3e-10 
gb|EAY85463.1|  hypothetical protein OsI_006696 [Oryza sativa ...  66.6    2e-09 
ref|XP_671840.1|  hypothetical protein PB300616.00.0 [Plasmodi...  64.7    6e-09  
ref|YP_001355665.1|  hypothetical protein NIS_0194 [Nitratirup...  64.7    7e-09  
ref|ZP_02870797.1|  clpB protein [candidate division TM7 singl...  63.9    1e-08 
ref|XP_001566803.1|  hypothetical protein LbrM30_V2.1740 [Leis...  63.2    2e-08  
ref|XP_001617858.1|  hypothetical protein NEMVEDRAFT_v1g78370 ...  62.4    3e-08  
ref|YP_502955.1|  ATPase AAA-2 [Methanospirillum hungatei JF-1...  61.6    5e-08  
gb|AAQ06899.1|AF496233_1  ATP-dependent protease ATP-binding s...  61.6    5e-08 
ref|XP_001765651.1|  predicted protein [Physcomitrella patens ...  61.6    6e-08  
ref|YP_268529.1|  ATP-dependent peptidase, M41 family [Colwell...  61.2    7e-08  
gb|EAZ27397.1|  hypothetical protein OsJ_010880 [Oryza sativa ...  61.2    8e-08 
ref|ZP_00827255.1|  COG0542: ATPases with chaperone activity, ...  60.1    1e-07 
ref|YP_001197758.1|  ATPases with chaperone activity, ATP-bind...  58.9    3e-07  
ref|ZP_02368092.1|  ATP-dependent Clp protease, subunit A (clp...  58.5    5e-07 
ref|XP_001684774.1|  hypothetical protein, conserved [Leishman...  58.2    6e-07  
ref|ZP_02518722.1|  ATP-dependent Clp protease, subunit A (clp...  57.8    8e-07 
ref|ZP_02719610.1|  ATP-dependent Clp protease, subunit A (clp...  57.4    1e-06 
ref|ZP_02520422.1|  ATP-dependent Clp protease, subunit A (clp...  57.4    1e-06 
ref|NP_212503.1|  ATP-dependent Clp protease, subunit A (clpA)...  57.4    1e-06  
ref|ZP_02723407.1|  ATP-dependent Clp protease, subunit A (clp...  57.0    1e-06 
gb|ABU55349.1|  ATP-dependent Clp protease ATP-binding subunit...  57.0    1e-06 
ref|ZP_02724797.1|  ATP-dependent Clp protease, subunit A (clp...  56.6    2e-06 
ref|ZP_01446847.1|  Chaperone ClpB [alpha proteobacterium HTCC...  56.2    2e-06 
ref|XP_001467016.1|  hypothetical protein LinJ30.2040 [Leishma...  54.7    6e-06  
ref|NP_567437.1|  heat shock protein 101, putative / HSP101, p...  54.3    9e-06  
ref|NP_760981.1|  ATP-dependent Clp protease [Vibrio vulnificu...  53.1    2e-05  
gb|AAX96463.1|  hypothetical protein LOC_Os11g16670 [Oryza sat...  52.0    4e-05 
ref|YP_072813.1|  ATP-dependent Clp protease, subunit A [Borre...  51.2    7e-05  
ref|NP_001061376.1|  Os08g0250900 [Oryza sativa (japonica cult...  50.8    9e-05  
dbj|BAD05509.1|  101 kDa heat shock protein; HSP101-like prote...  50.8    1e-04 
ref|ZP_02529773.1|  ATP-dependent Clp protease, subunit A [Bor...  50.4    1e-04 
ref|YP_709810.1|  ATP-dependent Clp protease, subunit A [Borre...  50.4    1e-04  
gb|EAZ06221.1|  hypothetical protein OsI_027453 [Oryza sativa ...  50.1    2e-04 
gb|EAZ42061.1|  hypothetical protein OsJ_025544 [Oryza sativa ...  50.1    2e-04 
gb|EAY57228.1|  ATPase with chaperone activity, ATP-binding su...  49.3    3e-04 
ref|ZP_02004210.1|  hypothetical protein BGP_4585 [Beggiatoa s...  49.3    3e-04 
ref|XP_818512.1|  hypothetical protein Tc00.1047053511751.144 ...  48.9    4e-04  
ref|ZP_01825518.1|  ATP-dependent Clp protease, ATP-binding su...  48.9    4e-04 
ref|XP_001832913.1|  predicted protein [Coprinopsis cinerea ok...  48.5    4e-04  
ref|NP_194764.1|  heat shock protein-related [Arabidopsis thal...  47.4    0.001  
emb|CAO66544.1|  unnamed protein product [Vitis vinifera]          47.0    0.001 
ref|XP_845424.1|  hypothetical protein, conserved [Trypanosoma...  47.0    0.001  
ref|YP_706635.1|  possible ClpA [Rhodococcus sp. RHA1] >gb|ABG...  46.6    0.002  
ref|YP_001356537.1|  hypothetical protein NIS_1070 [Nitratirup...  46.6    0.002  
ref|XP_819667.1|  hypothetical protein Tc00.1047053507023.90 [...  46.6    0.002  
ref|XP_806725.1|  heat shock protein 100 (clp protein), putati...  46.2    0.002  
ref|XP_001331996.1|  PREDICTED: hypothetical protein isoform 2...  46.2    0.002  
ref|NP_200579.1|  heat shock protein-related [Arabidopsis thal...  46.2    0.003  
emb|CAA83813.1|  CLPA/CLPB family [Mycoplasma capricolum subsp...  45.4    0.004 
ref|YP_187014.1|  ClpA-related protein [Staphylococcus aureus ...  45.1    0.005  
emb|CAC67526.1|  putative ATP/GTP-binding protein [Streptococc...  44.7    0.007 
ref|XP_001757909.1|  predicted protein [Physcomitrella patens ...  44.3    0.009  
emb|CAG07987.1|  unnamed protein product [Tetraodon nigroviridis]  44.3    0.009 
ref|YP_644837.1|  ATPases with chaperone activity ATP-binding ...  44.3    0.010  
emb|CAA50682.1|  unnamed protein product [Streptococcus thermo...  43.9    0.012 
ref|XP_001331907.1|  PREDICTED: hypothetical protein isoform 1...  43.1    0.018  
gb|AAD25929.1|AF085279_2  hypothetical protein [Arabidopsis th...  43.1    0.018 
gb|AAF18727.1|AC018721_2  hypothetical protein [Arabidopsis th...  43.1    0.019 
ref|NP_973646.1|  heat shock protein-related [Arabidopsis thal...  43.1    0.020  
ref|ZP_01844515.1|  ATP-dependent Clp protease, ATP-binding su...  42.7    0.024 
ref|NP_172200.2|  ATP-dependent Clp protease ClpB protein-rela...  42.7    0.029  
ref|ZP_02437663.1|  hypothetical protein CLOSS21_00093 [Clostr...  42.4    0.031 
ref|NP_001077474.1|  ATP-dependent Clp protease ClpB protein-r...  42.4    0.032  
ref|YP_474271.1|  ATP-dependent protease ATP-binding subunit [...  42.4    0.036  
ref|XP_001863125.1|  torsin a [Culex pipiens quinquefasciatus]...  41.6    0.055  
ref|ZP_02532795.1|  chaperone endopeptidase Clp ATP-binding ch...  40.8    0.090 
ref|ZP_00051159.2|  COG0542: ATPases with chaperone activity, ...  40.4    0.12  
ref|YP_477572.1|  ATP-dependent protease ATP-binding subunit [...  40.4    0.13   
ref|XP_001861953.1|  polyserase-2 [Culex pipiens quinquefascia...  39.7    0.24   
emb|CAN66169.1|  hypothetical protein [Vitis vinifera]             39.3    0.31  
ref|NP_013207.1|  Huge dynein-related AAA-type ATPase (midasin...  39.3    0.32   
gb|EDN59651.1|  midasin [Saccharomyces cerevisiae YJM789]          39.3    0.32  
ref|ZP_02203618.1|  ATPase associated with various cellular ac...  38.5    0.51  
ref|NP_001090443.1|  hypothetical protein LOC779355 [Xenopus l...  38.1    0.57   
ref|XP_310142.4|  AGAP009547-PA [Anopheles gambiae str. PEST] ...  38.1    0.61   
ref|NP_681300.1|  ATP-dependent protease ATP-binding subunit [...  38.1    0.69   
ref|ZP_02205578.1|  hypothetical protein COPEUT_00340 [Coproco...  37.7    0.74  
ref|ZP_02011242.1|  ATPase with chaperone activity ATP-binding...  37.7    0.75  
ref|YP_867532.1|  ATP-dependent protease ATP-binding subunit [...  37.7    0.81   
emb|CAO69572.1|  unnamed protein product [Vitis vinifera]          37.4    0.97  
ref|YP_001303504.1|  hypothetical protein BDI_2151 [Parabacter...  37.4    0.97   
ref|XP_001539397.1|  conserved hypothetical protein [Ajellomyc...  37.4    1.0    
gb|AAR90874.1|  membrane-associated ATP-dependent Clp protease...  37.4    1.1   
ref|YP_860284.1|  ATP-dependent protease ATP-binding subunit [...  37.4    1.2    
ref|YP_847164.1|  ATPase AAA-2 domain protein [Syntrophobacter...  37.0    1.3    
ref|XP_829351.1|  hypothetical protein Tb11.52.0010 [Trypanoso...  37.0    1.5    
ref|YP_135872.1|  methanol dehydrogenase regulatory protein [H...  37.0    1.6    
ref|ZP_01858080.1|  hypothetical protein PM8797T_16847 [Planct...  37.0    1.6   
ref|ZP_02424617.1|  hypothetical protein ALIPUT_00741 [Alistip...  36.6    1.7   
ref|YP_001141971.1|  EAL domain protein [Aeromonas salmonicida...  36.6    1.7    
ref|YP_001234056.1|  ATP-dependent protease ATP-binding subuni...  36.6    1.9    
gb|AAY29673.1|  predicted ATP-dependent specificity component ...  36.6    2.1   
ref|YP_480336.1|  AAA_5 ATPase associated with various cellula...  36.2    2.2    
ref|XP_001384347.2|  hypothetical protein PICST_71553 [Pichia ...  36.2    2.4    
ref|YP_001491089.1|  ankyrin repeat protein [Arcobacter butzle...  35.8    2.7    
ref|XP_001649118.1|  torsin a [Aedes aegypti] >gb|EAT44169.1| ...  35.8    2.9    
emb|CAO21445.1|  unnamed protein product [Vitis vinifera]          35.8    3.0   
emb|CAN78044.1|  hypothetical protein [Vitis vinifera]             35.8    3.1   
ref|NP_588370.1|  midasin (predicted) [Schizosaccharomyces pom...  35.8    3.5    
ref|YP_712164.1|  hypothetical protein FRAAL1932 [Frankia alni...  35.4    3.6    
gb|AAK64026.1|  unknown protein [Arabidopsis thaliana]             35.4    3.6   
ref|XP_001233248.1|  PREDICTED: similar to Solute carrier fami...  35.4    3.7    
ref|NP_565689.1|  heat shock protein-related [Arabidopsis thal...  35.4    3.8    
ref|ZP_02325807.1|  ATPase AAA-2 domain protein [Anaeromyxobac...  35.4    4.1   
ref|YP_001509519.1|  ATPase associated with various cellular a...  35.4    4.6    
ref|XP_679277.1|  hypothetical protein PB001444.02.0 [Plasmodi...  35.0    4.7    
ref|YP_263704.1|  B12-dependent methionine synthase [Psychroba...  35.0    4.8    
ref|YP_579716.1|  B12-dependent methionine synthase [Psychroba...  35.0    4.8    
ref|YP_921523.1|  ATPase associated with various cellular acti...  35.0    5.0    
ref|NP_216942.1|  hypothetical protein Rv2426c [Mycobacterium ...  35.0    5.2    
ref|YP_954815.1|  oxidoreductase alpha (molybdopterin) subunit...  35.0    5.2    
ref|NP_001011348.2|  solute carrier family 27 (fatty acid tran...  35.0    5.5    
ref|NP_856099.1|  hypothetical protein Mb2450c [Mycobacterium ...  35.0    5.5    
gb|AAH88505.1|  Solute carrier family 27 (fatty acid transport...  35.0    5.7    
ref|ZP_01189365.1|  AAA ATPase, central region:Peptidase S16, ...  34.7    6.3   
ref|ZP_02954839.1|  rubrerythrin [Clostridium perfringens D st...  34.7    6.5   
ref|XP_684868.2|  PREDICTED: hypothetical protein [Danio rerio]    34.7    6.7    
ref|YP_954716.1|  ATPase associated with various cellular acti...  34.7    6.8    
ref|YP_001546593.1|  ATP-dependent Clp protease, ATP-binding s...  34.7    7.0    
ref|XP_001339998.1|  PREDICTED: hypothetical protein [Danio re...  34.7    7.1    
gb|AAI17651.1|  LOC100004228 protein [Danio rerio] >gb|AAI3985...  34.7    7.3    
ref|XP_001336957.1|  PREDICTED: hypothetical protein [Danio re...  34.7    7.3    
ref|YP_001133910.1|  ATPase associated with various cellular a...  34.7    7.3    
ref|YP_698702.1|  ATP-dependent protease LonB [Clostridium per...  34.7    7.8    
ref|XP_613495.3|  PREDICTED: similar to FKSG18 [Bos taurus]        34.3    8.3    
ref|NP_562307.1|  Lon-like ATP-dependent protease [Clostridium...  34.3    8.3    
ref|YP_696086.1|  ATP-dependent protease LonB [Clostridium per...  34.3    8.4    
ref|ZP_02643447.1|  ATP-dependent protease LonB [Clostridium p...  34.3    8.5   
ref|XP_625995.1|  hypothetical protein cgd5_330 [Cryptosporidi...  34.3    8.5    
ref|ZP_02863365.1|  ATP-dependent protease LonB [Clostridium p...  34.3    8.6   
ref|YP_856667.1|  sensory box/GGDEF family protein [Aeromonas ...  34.3    8.6    
ref|ZP_02076033.1|  hypothetical protein CLOL250_02821 [Clostr...  34.3    8.8   
gb|AAX92943.1|  transposon protein, putative, mutator sub-clas...  34.3    9.0   
ref|ZP_01961739.1|  hypothetical protein BACCAC_03379 [Bactero...  34.3    9.1   
ref|XP_001498638.1|  PREDICTED: similar to lymphoid-restricted...  34.3    9.2    
dbj|BAA31533.1|  A2-5a orf5; hypothetical protein [Bacillus sp.]   34.3    9.2   
sp|P81671.1|CLPA_PINPS  ATP-dependent Clp protease ATP-binding...  34.3    9.3   
ref|YP_001211356.1|  predicted ATP-dependent protease [Pelotom...  34.3    9.5    


Alignments 2 à 2
     
>ref|YP_001091419.1|  ClpC [Prochlorococcus marinus str. MIT 9301]
 gb|ABO17818.1|  ClpC [Prochlorococcus marinus str. MIT 9301]
Length=841

 GENE ID: 4911696 clpC | ClpC [Prochlorococcus marinus str. MIT 9301]

 Score =  541 bits (1394),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 267/269 (99%), Positives = 269/269 (100%), Gaps = 0/269 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  573  KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  632

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
Sbjct  633  FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  692

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVK+IAEIMLQEVF
Sbjct  693  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKEIAEIMLQEVF  752

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
            IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN
Sbjct  753  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  812

Query  241  ALVDIDDDKKVTINISSEESSQELAGANF  269
            ALVDIDD+KKVTINISSEESSQELAGANF
Sbjct  813  ALVDIDDNKKVTINISSEESSQELAGANF  841


>ref|YP_001484425.1|  ClpC [Prochlorococcus marinus str. MIT 9215]
 gb|ABV50839.1|  ClpC [Prochlorococcus marinus str. MIT 9215]
Length=842

 GENE ID: 5614913 clpC | ClpC [Prochlorococcus marinus str. MIT 9215]

 Score =  537 bits (1384),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 265/269 (98%), Positives = 267/269 (99%), Gaps = 0/269 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  574  KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  633

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
Sbjct  634  FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  693

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVK+IAEIMLQEVF
Sbjct  694  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKEIAEIMLQEVF  753

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN
Sbjct  754  ARLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  813

Query  241  ALVDIDDDKKVTINISSEESSQELAGANF  269
            ALVDIDD+KKVTINISSEESSQELA ANF
Sbjct  814  ALVDIDDNKKVTINISSEESSQELASANF  842


>ref|YP_001009585.1|  ClpC [Prochlorococcus marinus str. AS9601]
 gb|ABM70478.1|  ClpC [Prochlorococcus marinus str. AS9601]
Length=842

 GENE ID: 4717908 clpC | ClpC [Prochlorococcus marinus str. AS9601]

 Score =  530 bits (1365),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 262/269 (97%), Positives = 264/269 (98%), Gaps = 0/269 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  574  KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  633

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
Sbjct  634  FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  693

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVK IAEIMLQEVF
Sbjct  694  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKHIAEIMLQEVF  753

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RLQDKGIKL+VTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGD 
Sbjct  754  ARLQDKGIKLDVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDK  813

Query  241  ALVDIDDDKKVTINISSEESSQELAGANF  269
            ALVDIDD+KKV INISSEESSQELA ANF
Sbjct  814  ALVDIDDNKKVIINISSEESSQELASANF  842


>ref|YP_397594.1|  ATPase [Prochlorococcus marinus str. MIT 9312]
 gb|ABB50158.1|  ATPase [Prochlorococcus marinus str. MIT 9312]
Length=842

 GENE ID: 3765903 PMT9312_1099 | ATPase [Prochlorococcus marinus str. MIT 9312]

 Score =  530 bits (1364),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 261/269 (97%), Positives = 266/269 (98%), Gaps = 0/269 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  574  KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  633

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
Sbjct  634  FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  693

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQL+KNEVK+IAEIMLQEVF
Sbjct  694  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLSKNEVKEIAEIMLQEVF  753

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RL+DKGIKL+VTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGD 
Sbjct  754  ARLEDKGIKLSVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDK  813

Query  241  ALVDIDDDKKVTINISSEESSQELAGANF  269
            ALVDIDD+KKVTINISSEESSQELA ANF
Sbjct  814  ALVDIDDNKKVTINISSEESSQELASANF  842


>ref|YP_001011493.1|  ClpC [Prochlorococcus marinus str. MIT 9515]
 gb|ABM72386.1|  ClpC [Prochlorococcus marinus str. MIT 9515]
Length=843

 GENE ID: 4719000 clpC | ClpC [Prochlorococcus marinus str. MIT 9515]

 Score =  522 bits (1344),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 257/269 (95%), Positives = 265/269 (98%), Gaps = 0/269 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  575  KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  634

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
Sbjct  635  FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  694

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVK IAEIML+EVF
Sbjct  695  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKDIAEIMLKEVF  754

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RL +KGIKL+VT+AFKERLVEEGYNP+YGARPLRRAVMRLLEDSLAEEVLSGRIKDGD 
Sbjct  755  SRLNEKGIKLDVTEAFKERLVEEGYNPAYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDK  814

Query  241  ALVDIDDDKKVTINISSEESSQELAGANF  269
            ALVDID++KKVT+NISSEESSQELAGANF
Sbjct  815  ALVDIDENKKVTVNISSEESSQELAGANF  843


>ref|NP_893205.1|  ClpC [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
 emb|CAE19547.1|  ClpC [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
Length=842

 GENE ID: 1726998 clpC | ClpC
[Prochlorococcus marinus subsp. pastoris str. CCMP1986]
(10 or fewer PubMed links)

 Score =  518 bits (1335),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 254/269 (94%), Positives = 264/269 (98%), Gaps = 0/269 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  574  KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  633

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
Sbjct  634  FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  693

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQL+KNEVK IAEIML+EVF
Sbjct  694  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLSKNEVKDIAEIMLKEVF  753

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RL +KGIKL+VTDAFKERLVEEGYNP+YGARPLRRAVMRLLEDSLAEEVLSGRIKDGD 
Sbjct  754  SRLNEKGIKLDVTDAFKERLVEEGYNPAYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDK  813

Query  241  ALVDIDDDKKVTINISSEESSQELAGANF  269
            A+VDID++KKV +NIS+EESSQELAGANF
Sbjct  814  AIVDIDENKKVIVNISTEESSQELAGANF  842


>ref|NP_894892.1|  ClpC [Prochlorococcus marinus str. MIT 9313]
 emb|CAE21236.1|  ClpC [Prochlorococcus marinus str. MIT 9313]
Length=859

 GENE ID: 1727955 clpC | ClpC [Prochlorococcus marinus str. MIT 9313]
(10 or fewer PubMed links)

 Score =  486 bits (1252),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 233/268 (86%), Positives = 256/268 (95%), Gaps = 1/268 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+YFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  590  KALATYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  649

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTL+IMTSNIGSKVIEKGGGGLGFE
Sbjct  650  FDEIEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLIIMTSNIGSKVIEKGGGGLGFE  709

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSG++ EDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQL++NEVK+IAEIMLQEVF
Sbjct  710  FSGENAEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLSRNEVKEIAEIMLQEVF  769

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             R+QDKGI L V+DAFKERLVEEGYNPSYGARPLRRAVMRL+EDSLAEEVL+GRIKDGD 
Sbjct  770  SRMQDKGITLTVSDAFKERLVEEGYNPSYGARPLRRAVMRLMEDSLAEEVLTGRIKDGDA  829

Query  241  ALVDIDDDKKVTI-NISSEESSQELAGA  267
            A +D+DD+K++ + ++S   ++ ELAGA
Sbjct  830  AEMDVDDNKQIVVRHVSKTTATPELAGA  857


>ref|YP_001017005.1|  ClpC [Prochlorococcus marinus str. MIT 9303]
 gb|ABM77740.1|  ClpC [Prochlorococcus marinus str. MIT 9303]
Length=859

 GENE ID: 4775964 clpC | ClpC [Prochlorococcus marinus str. MIT 9303]

 Score =  481 bits (1238),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 230/268 (85%), Positives = 256/268 (95%), Gaps = 1/268 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+YFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  590  KALATYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  649

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTL+IMTSNIGSKVIEKGGGGLGFE
Sbjct  650  FDEIEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLIIMTSNIGSKVIEKGGGGLGFE  709

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSG++ E+SQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQL+++EVK+IAEIML+EVF
Sbjct  710  FSGENAEESQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLSRDEVKEIAEIMLKEVF  769

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             R+QDKGI L V+DAFKERLVEEGYNPSYGARPLRRAVMRL+EDSLAEEVL+GRIKDGD 
Sbjct  770  SRMQDKGITLTVSDAFKERLVEEGYNPSYGARPLRRAVMRLMEDSLAEEVLTGRIKDGDA  829

Query  241  ALVDIDDDKKVTI-NISSEESSQELAGA  267
            A +D+DD+K++ + ++S   ++ ELAGA
Sbjct  830  AEMDVDDNKQIVVRHVSKTTATPELAGA  857


>ref|YP_001550983.1|  ClpC [Prochlorococcus marinus str. MIT 9211]
 gb|ABX09029.1|  ClpC [Prochlorococcus marinus str. MIT 9211]
Length=859

 GENE ID: 5731065 clpC | ClpC [Prochlorococcus marinus str. MIT 9211]

 Score =  481 bits (1237),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 257/268 (95%), Gaps = 1/268 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+YFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  590  KALAAYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  649

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EK+HPDVFNLLLQLLE+GRLTDSKGRTVDFKNTL+IMTSNIGSKVIEKGGGGLGFE
Sbjct  650  FDEIEKSHPDVFNLLLQLLEEGRLTDSKGRTVDFKNTLIIMTSNIGSKVIEKGGGGLGFE  709

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSG+S+EDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQL+++EVK IAEIML EVF
Sbjct  710  FSGESIEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLSRDEVKDIAEIMLNEVF  769

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
            +R++DKGI L+VT+AFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGD 
Sbjct  770  LRIKDKGITLSVTEAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDK  829

Query  241  ALVDIDDDKKVTI-NISSEESSQELAGA  267
            A VDID++KKV + +I+   ++ ELAGA
Sbjct  830  AEVDIDENKKVVVKHINKGATNLELAGA  857


>ref|ZP_01086208.1|  endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
 gb|EAQ74030.1|  endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score =  478 bits (1230),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 230/268 (85%), Positives = 256/268 (95%), Gaps = 0/268 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+YFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
Sbjct  588  KALAAYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  647

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTL+IMTSNIGSKVIEKGGGGLGFE
Sbjct  648  FDEIEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLIIMTSNIGSKVIEKGGGGLGFE  707

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
            FSG +VE++QYNRI+SLVNEELKQYFRPEFLNRLDEIIVFRQL+++EVK+IAEIML+EVF
Sbjct  708  FSGAAVEETQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLSRDEVKEIAEIMLREVF  767

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             R+Q+KGI L+VT+AFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEE LSGR+KDGD+
Sbjct  768  GRMQEKGIGLSVTEAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEFLSGRLKDGDS  827

Query  241  ALVDIDDDKKVTINISSEESSQELAGAN  268
            ALVD++D+K+V I   +  +  ELAGA+
Sbjct  828  ALVDVNDEKQVVIRHQTVVAEPELAGAS  855




_________________________________________________________________________________________________


PROTOCOLE
Outil: BlastP/Database:Swissprot/Max target sequences:5000/Expect threshold:10/worlds size:3/Matrix:Blosum62
/Gaps coast: existance:11 extension 1



sp|Q1XDF4|CLPC_PORYE  ATP-dependent Clp protease ATP-binding s...   429    6e-120 
sp|Q9TM05|CLPC_CYACA  ATP-dependent Clp protease ATP-binding s...   429    7e-120 
sp|P51332|CLPC_PORPU  ATP-dependent Clp protease ATP-binding s...   426    6e-119 
sp|P31541|CLPAA_LYCES  ATP-dependent Clp protease ATP-binding ...   418    2e-116
sp|P35100|CLPC_PEA  ATP-dependent Clp protease ATP-binding sub...   413    5e-115
sp|P31542|CLPAB_LYCES  ATP-dependent Clp protease ATP-binding ...   412    9e-115
sp|O78410|CLPC_GUITH  ATP-dependent Clp protease ATP-binding s...   407    4e-113 
sp|P46523|CLPA_BRANA  ATP-dependent Clp protease ATP-binding s...   399    9e-111
sp|P42762|ERD1_ARATH  ERD1 protein, chloroplast precursor           320    4e-87  
sp|P49574|CLPC_ODOSI  ATP-dependent Clp protease ATP-binding s...   313    5e-85  
sp|Q9RA63.2|CLPB_THET8  Chaperone protein clpB                      302    1e-81  
sp|Q72IK9.1|CLPB_THET2  Chaperone protein clpB                      301    1e-81  
sp|P53533.3|CLPB1_SYNP7  Chaperone protein clpB 1                   291    2e-78 
sp|Q5HRM8|CLPC_STAEQ  ATP-dependent Clp protease ATP-binding s...   288    2e-77  
sp|Q8YM56.2|CLPB2_ANASP  Chaperone protein clpB 2                   288    2e-77 
sp|Q81GM5.1|CLPB_BACCR  Chaperone protein clpB                      288    3e-77  
sp|Q4L3I4|CLPC_STAHJ  ATP-dependent Clp protease ATP-binding s...   287    3e-77  
sp|P37571|CLPC_BACSU  Negative regulator of genetic competence...   286    5e-77 
sp|Q49V34|CLPC_STAS1  ATP-dependent Clp protease ATP-binding s...   286    8e-77  
sp|Q8DJ40.1|CLPB1_SYNEL  Chaperone protein clpB 1                   285    1e-76 
sp|Q9RVI3.2|CLPB_DEIRA  Chaperone protein clpB                      285    2e-76 
sp|Q81TT4.1|CLPB_BACAN  Chaperone protein clpB                      285    2e-76 
sp|Q2YSD6|CLPC_STAAB  ATP-dependent Clp protease ATP-binding s...   285    2e-76  
sp|Q6GBW3|CLPC_STAAS  ATP-dependent Clp protease ATP-binding s...   285    2e-76  
sp|Q73BY1.1|CLPB_BACC1  Chaperone protein clpB                      284    3e-76  
sp|Q74FF1.1|CLPB_GEOSL  Chaperone protein clpB                      283    7e-76 
sp|Q7U637.2|CLPB1_SYNPX  Chaperone protein clpB 1                   283    8e-76 
sp|O87444.2|CLPB_PLEBO  Chaperone protein clpB                      282    9e-76 
sp|Q8PHQ4.2|CLPB_XANAC  Chaperone protein clpB                      281    2e-75 
sp|Q8EU05.1|CLPB_OCEIH  Chaperone protein clpB                      280    4e-75 
sp|Q8NXY8|CLPC_STAAW  ATP-dependent Clp protease ATP-binding s...   280    5e-75  
sp|Q7AMH5.1|CLPB_SALTI  Chaperone protein clpB >sp|Q7CQ01.1|CL...   280    5e-75 
sp|Q7NFE9.1|CLPB_GLOVI  Chaperone protein clpB                      280    7e-75 
sp|Q89UL2.1|CLPB_BRAJA  Chaperone protein clpB                      279    1e-74 
sp|Q7UBW5|CLPB_SHIFL  Chaperone protein clpB                        278    2e-74 
sp|P63284.1|CLPB_ECOLI  Chaperone protein clpB (Heat shock pro...   278    2e-74 
sp|Q8XKG8.1|CLPB_CLOPE  Chaperone protein clpB                      277    3e-74 
sp|Q7V8B1.1|CLPB_PROMM  Chaperone protein clpB                      277    3e-74  
sp|Q8P6A0.1|CLPB_XANCP  Chaperone protein clpB                      276    5e-74 
sp|Q6LMY0.2|CLPB_PHOPR  Chaperone protein clpB                      276    5e-74 
sp|Q8YUL9.1|CLPB1_ANASP  Chaperone protein clpB 1                   276    8e-74  
sp|O83110.1|CLPB_TREPA  Chaperone protein clpB                      276    9e-74 
sp|O67588.1|CLPB_AQUAE  Chaperone protein clpB                      275    1e-73 
sp|Q74X11.2|CLPB_YERPE  Chaperone protein clpB                      275    2e-73 
sp|P44403.1|CLPB_HAEIN  Chaperone protein clpB                      275    2e-73 
sp|P74361.1|CLPB2_SYNY3  Chaperone protein clpB 2                   274    3e-73  
sp|Q7CU92.2|CLPB_AGRT5  Chaperone protein clpB                      274    4e-73  
sp|Q6N1H2.1|CLPB_RHOPA  Chaperone protein clpB                      274    4e-73 
sp|P74459.1|CLPB1_SYNY3  Chaperone protein clpB 1                   273    7e-73  
sp|Q8DG71.1|CLPB2_SYNEL  Chaperone protein clpB 2                   272    1e-72 
sp|O34209.1|CLPB2_SYNP7  Chaperone protein clpB 2                   271    2e-72  
sp|Q87S63.1|CLPB_VIBPA  Chaperone protein clpB                      271    3e-72 
sp|Q8XZR0.1|CLPB_RALSO  Chaperone protein clpB                      270    4e-72 
sp|Q7X2S8.1|CLPB_MEIRU  Chaperone protein clpB                      270    4e-72 
sp|Q7N788.1|CLPB_PHOLL  Chaperone protein clpB                      270    4e-72 
sp|Q8FM94.1|CLPB_COREF  Chaperone protein clpB                      270    4e-72 
sp|Q9CKC0.1|CLPB_PASMU  Chaperone protein clpB                      270    4e-72 
sp|P0A522|CLPC_MYCTU  Probable ATP-dependent Clp protease ATP-...   270    5e-72 
sp|Q9PGC1.1|CLPB_XYLFA  Chaperone protein clpB                      270    5e-72 
sp|Q82SD8.1|CLPB_NITEU  Chaperone protein clpB                      270    7e-72 
sp|Q87AX8.1|CLPB_XYLFT  Chaperone protein clpB                      270    7e-72  
sp|Q73K92.1|CLPB_TREDE  Chaperone protein clpB                      268    2e-71 
sp|Q7M9X4.1|CLPB_WOLSU  Chaperone protein clpB                      268    2e-71 
sp|Q8G4X4.1|CLPB_BIFLO  Chaperone protein clpB                      268    3e-71 
sp|Q82EU9.1|CLPB1_STRAW  Chaperone protein clpB 1                   268    3e-71 
sp|Q7MNK1.1|CLPB_VIBVY  Chaperone protein clpB                      266    6e-71  
sp|Q7VNH1.1|CLPB_HAEDU  Chaperone protein clpB                      266    7e-71 
sp|Q7W9E6.1|CLPB_BORPA  Chaperone protein clpB                      266    8e-71 
sp|Q9HVN5.1|CLPB_PSEAE  Chaperone protein clpB                      266    1e-70 
sp|Q7UM33.2|CLPB_RHOBA  Chaperone protein clpB                      266    1e-70 
sp|Q83F55.1|CLPB_COXBU  Chaperone protein clpB                      266    1e-70 
sp|Q7WHB6.1|CLPB_BORBR  Chaperone protein clpB                      266    1e-70 
sp|Q7VYV6.1|CLPB_BORPE  Chaperone protein clpB                      265    1e-70 
sp|Q826F2.1|CLPB2_STRAW  Chaperone protein clpB 2                   265    2e-70 
sp|P53532.1|CLPB_CORGL  Chaperone protein clpB                      265    2e-70 
sp|Q929G7.1|CLPB_LISIN  Chaperone protein clpB                      265    2e-70 
sp|Q92MK7.1|CLPB_RHIME  Chaperone protein clpB                      264    3e-70 
sp|Q8DEV2.1|CLPB_VIBVU  Chaperone protein clpB                      264    3e-70 
sp|Q9PI02.1|CLPB_CAMJE  Chaperone protein clpB                      264    4e-70 
sp|P24428|CLPC_MYCLE  Probable ATP-dependent Clp protease ATP-...   263    4e-70 
sp|Q71XF9.1|CLPB_LISMF  Chaperone protein clpB                      263    5e-70  
sp|Q8CJV9.1|CLPB_STRCO  Chaperone protein clpB                      263    5e-70 
sp|Q6MIV0.1|CLPB_BDEBA  Chaperone protein clpB                      263    6e-70 
sp|Q8EBE6.1|CLPB_SHEON  Chaperone protein clpB                      263    6e-70 
sp|Q9JYQ8.1|CLPB_NEIMB  Chaperone protein clpB                      263    6e-70 
sp|Q898C7.1|CLPB_CLOTE  Chaperone protein clpB                      263    7e-70 
sp|Q8Y570.1|CLPB_LISMO  Chaperone protein clpB                      263    7e-70 
sp|Q831Y7.1|CLPB_ENTFA  Chaperone protein clpB                      263    7e-70 
sp|Q9JTP9.1|CLPB_NEIMA  Chaperone protein clpB                      262    1e-69 
sp|Q98G96.1|CLPB_RHILO  Chaperone protein clpB                      262    2e-69 
sp|Q9A9T4.1|CLPB_CAUCR  Chaperone protein clpB                      261    2e-69 
sp|Q5HQI5.1|CLPB_STAEQ  Chaperone protein clpB                      261    2e-69  
sp|Q8CPT5.1|CLPB_STAES  Chaperone protein clpB                      261    3e-69  
sp|Q7CEG6.1|CLPB_BRUSU  Chaperone protein clpB                      261    3e-69 
sp|Q9KU18.1|CLPB_VIBCH  Chaperone protein clpB                      259    9e-69 
sp|Q72AW6.1|CLPB_DESVH  Chaperone protein clpB                      259    1e-68  
sp|Q8YJ91.2|CLPB_BRUME  Chaperone protein clpB                      259    1e-68 
sp|Q6NF05.1|CLPB_CORDI  Chaperone protein clpB                      258    2e-68 
sp|Q9Z6E4.1|CLPB_STRAL  Chaperone protein clpB                      258    2e-68 
sp|Q7VBL0.1|CLPB_PROMA  Chaperone protein clpB                      258    2e-68 
sp|Q88VX7.1|CLPB_LACPL  Chaperone protein clpB                      257    4e-68 
sp|Q889C2.1|CLPB_PSESM  Chaperone protein clpB                      257    4e-68 
sp|Q97KG0.1|CLPB_CLOAB  Chaperone protein clpB                      257    5e-68 
sp|Q7NWN7.1|CLPB_CHRVO  Chaperone protein clpB                      256    1e-67 
sp|Q96UX5|HSP78_CANAL  Heat shock protein 78, mitochondrial pr...   255    1e-67 
sp|Q8NXE7.1|CLPB_STAAW  Chaperone protein clpB                      255    1e-67  
sp|Q6GAV1.1|CLPB_STAAS  Chaperone protein clpB >sp|Q5HHB0.1|CL...   255    1e-67  
sp|Q6GIB2.1|CLPB_STAAR  Chaperone protein clpB                      255    2e-67  
sp|P17422.2|CLPB_DICNO  Chaperone protein clpB                      255    2e-67 
sp|Q7A6G6.1|CLPB_STAAN  Chaperone protein clpB >sp|Q99VB5.1|CL...   254    2e-67  
sp|Q8RHQ8.2|CLPB_FUSNN  Chaperone protein clpB                      254    2e-67 
sp|Q9CFF3.1|CLPB_LACLA  Chaperone protein clpB                      254    3e-67 
sp|Q8KG79.1|CLPB1_CHLTE  Probable chaperone protein clpB 1          254    4e-67 
sp|Q7VJY3.1|CLPB_HELHP  Chaperone protein clpB                      253    7e-67 
sp|Q89YY3.1|CLPB_BACTN  Chaperone protein clpB                      253    8e-67 
sp|Q7U3T3.1|CLPB2_SYNPX  Chaperone protein clpB 2                   253    1e-66  
sp|Q73T66.1|CLPB_MYCPA  Chaperone protein clpB                      252    2e-66 
sp|Q88Q71.1|CLPB_PSEPK  Chaperone protein clpB                      251    2e-66  
sp|P63287.1|CLPB_MYCBO  Chaperone protein clpB >sp|P63288.1|CL...   251    3e-66 
sp|Q4UN57.2|CLPB_RICFE  Chaperone protein clpB                      251    4e-66 
sp|Q92JK8.1|CLPB_RICCN  Chaperone protein clpB                      250    4e-66 
sp|Q73IE4.1|CLPB_WOLPM  Chaperone protein clpB                      249    1e-65 
sp|Q8F509.1|CLPB_LEPIN  Chaperone protein clpB                      248    2e-65 
sp|Q72QU2.1|CLPB_LEPIC  Chaperone protein clpB                      248    3e-65 
sp|Q9ZMH1.1|CLPB_HELPJ  Chaperone protein clpB                      247    4e-65  
sp|P42730|HS101_ARATH  Heat shock protein 101                       247    5e-65  
sp|Q7VQF3.1|CLPB_BLOFL  Chaperone protein clpB                      246    1e-64  
sp|Q6MD97.1|CLPB_PARUW  Chaperone protein clpB                      245    2e-64  
sp|O68185.3|CLPB_LACLM  Chaperone protein clpB                      245    2e-64  
sp|Q1RGR1.1|CLPB_RICBR  Chaperone protein clpB                      244    4e-64  
sp|Q8DTC7.1|CLPB_STRMU  Chaperone protein clpB                      243    9e-64 
sp|Q9CI09|CLPE_LACLA  ATP-dependent Clp protease ATP-binding s...   243    9e-64 
sp|Q83N78.1|CLPB_TROW8  Chaperone protein clpB                      242    1e-63  
sp|Q83FI1.1|CLPB_TROWT  Chaperone protein clpB                      242    1e-63  
sp|Q9S5Z2|CLPE_LACLM  ATP-dependent Clp protease ATP-binding s...   242    1e-63  
sp|P71404.2|CLPB_HELPY  Chaperone protein clpB                      242    1e-63 
sp|Q54316|HLYB_TREHY  Hemolysin B                                   241    3e-63 
sp|Q6F2Y7|HS101_ORYSJ  Heat shock protein 101                       241    3e-63  
sp|Q9CB26.1|CLPB_MYCLE  Chaperone protein clpB                      240    5e-63 
sp|Q68XR2.1|CLPB_RICTY  Chaperone protein clpB                      239    8e-63 
sp|Q9PKA8|CLPC_CHLMU  Probable ATP-dependent Clp protease ATP-...   238    2e-62 
sp|P35594|CLPE_STRPN  ATP-dependent Clp protease ATP-binding s...   238    2e-62 
sp|Q9ZEA9.1|CLPB_RICPR  Chaperone protein clpB                      238    3e-62 
sp|O84288|CLPC_CHLTR  Probable ATP-dependent Clp protease ATP-...   237    6e-62 
sp|P33416|HSP78_YEAST  Heat shock protein 78, mitochondrial pr...   236    9e-62  
sp|Q7V2A3.1|CLPB_PROMP  Chaperone protein clpB                      235    1e-61  
sp|Q7MVE7.1|CLPB_PORGI  Chaperone protein clpB                      234    2e-61 
sp|Q9Z8A6|CLPC_CHLPN  Probable ATP-dependent Clp protease ATP-...   233    6e-61 
sp|P31540|HSP98_NEUCR  Heat shock protein HSP98                     231    3e-60 
sp|P31543|CLP_TRYBB  Heat shock protein 100 (Protein CLP)           228    2e-59 
sp|Q9PKS5.1|CLPB_CHLMU  Chaperone protein clpB                      228    3e-59 
sp|O84115.1|CLPB_CHLTR  Chaperone protein clpB                      227    5e-59 
sp|Q822Q4.1|CLPB_CHLCV  Chaperone protein clpB                      223    9e-58 
sp|P47597.1|CLPB_MYCGE  Chaperone protein clpB                      221    2e-57 
sp|Q7NAZ3.1|CLPB_MYCGA  Chaperone protein clpB                      219    8e-57 
sp|Q7AJA9.1|CLPB_CHLPN  Chaperone protein clpB                      218    2e-56 
sp|P75247.1|CLPB_MYCPN  Chaperone protein clpB                      216    6e-56 
sp|Q8EW28.1|CLPB_MYCPE  Chaperone protein clpB                      216    9e-56 
sp|P0ABH9.1|CLPA_ECOLI  ATP-dependent Clp protease ATP-binding...   216    1e-55 
sp|P31539|HS104_YEAST  Heat shock protein 104                       203    6e-52  
sp|Q06716|CLPL_LACLA  ATP-dependent Clp protease ATP-binding s...   199    8e-51 
sp|P05444|CLPA_RHOBL  ClpA homolog protein                          198    2e-50 
sp|Q2YWB1|CLPL_STAAB  ATP-dependent Clp protease ATP-binding s...   197    4e-50  
sp|Q5XCL7|CLPC_STRP6  Probable ATP-dependent Clp protease ATP-...   197    5e-50 
sp|Q6GDQ0|CLPL_STAAR  ATP-dependent Clp protease ATP-binding s...   194    5e-49  
sp|Q5HD02|CLPL_STAAC  ATP-dependent Clp protease ATP-binding s...   192    1e-48  
sp|Q6G6C6|CLPL_STAAS  ATP-dependent Clp protease ATP-binding s...   192    1e-48  
sp|Q2FDV8|CLPL_STAA3  ATP-dependent Clp protease ATP-binding s...   192    1e-48  
sp|Q7A3F4|CLPL_STAAN  ATP-dependent Clp protease ATP-binding s...   192    1e-48  
sp|Q7WSY8.1|CLPB_PROFR  Chaperone protein clpB                      182    1e-45 
sp|Q5E9N5|CLPB_BOVIN  Caseinolytic peptidase B protein homolog...   166    1e-40  
sp|Q9WTT2|CLPB_RAT  Caseinolytic peptidase B protein homolog (...   163    9e-40  
sp|Q60649|CLPB_MOUSE  Caseinolytic peptidase B protein homolog...   162    1e-39  
sp|Q9H078|CLPB_HUMAN  Caseinolytic peptidase B protein homolog...   162    1e-39  
sp|Q9I742|CLPV1_PSEAE  Protein clpV1                                149    2e-35 
sp|Q51416|AMIB_PSEAE  ATP-dependent protease ATP-binding subun...   134    3e-31 
sp|Q9F746.1|CLPB_YEREN  Chaperone protein clpB                      132    3e-30 
sp|Q01357|ADPR_RHOER  ATP-dependent protease ATP-binding subun...   131    3e-30 
sp|O15885|CLP_TRYCR  Heat shock protein 100 (Protein CLP)          75.9    2e-13 
sp|Q2JW64.1|CLPX_SYNJA  ATP-dependent Clp protease ATP-binding...  42.4    0.003 
sp|Q2JLU2.1|CLPX_SYNJB  ATP-dependent Clp protease ATP-binding...  40.4    0.009 
sp|Q12019|MDN1_YEAST  Midasin (MIDAS-containing protein)           39.3    0.022  
sp|Q8DLI1|CLPX_SYNEL  ATP-dependent Clp protease ATP-binding s...  38.1    0.048 
sp|A0LDT3.1|CLPX_MAGSM  ATP-dependent Clp protease ATP-binding...  37.7    0.056 
sp|P81671.1|CLPA_PINPS  ATP-dependent Clp protease ATP-binding...  34.3    0.65  
sp|Q8YQX7|CLPX_ANASP  ATP-dependent Clp protease ATP-binding s...  34.3    0.72   
sp|Q8A128|CLPX_BACTN  ATP-dependent Clp protease ATP-binding s...  33.9    0.72  
sp|Q3M727.1|CLPX_ANAVT  ATP-dependent Clp protease ATP-binding...  33.9    0.76  
sp|Q47XL9.1|CLPX_COLP3  ATP-dependent Clp protease ATP-binding...  33.5    1.1   
sp|O14657|TOR1B_HUMAN  Torsin-1B precursor (Torsin family 1 me...  33.5    1.1    
sp|Q9X5N1|CLPX_MYXXA  ATP-dependent Clp protease ATP-binding s...  32.7    2.1   
sp|Q4G005.1|ERCC3_RAT  TFIIH basal transcription factor comple...  32.3    2.1    
sp|P19447|ERCC3_HUMAN  TFIIH basal transcription factor comple...  32.3    2.3    
sp|A0R196.1|CLPX_MYCS2  ATP-dependent Clp protease ATP-binding...  32.3    2.4   
sp|Q5RA62.1|ERCC3_PONPY  TFIIH basal transcription factor comp...  32.3    2.4   
sp|A7I4X4.1|EF2_METB6  Elongation factor 2 (EF-2)                  32.3    2.7   
sp|P49135|ERCC3_MOUSE  TFIIH basal transcription factor comple...  32.0    3.5    
sp|P75242|RUVB_MYCPN  Holliday junction ATP-dependent DNA heli...  31.6    3.9   
sp|Q60HG1.1|ERCC3_MACFA  TFIIH basal transcription factor comp...  31.6    4.0   
sp|O14656|TOR1A_HUMAN  Torsin-1A precursor (Torsin family 1 me...  31.6    4.2    
sp|Q3B0U2.1|CLPX_SYNS9  ATP-dependent Clp protease ATP-binding...  31.6    4.4   
sp|Q5ZKK7.1|ERCC3_CHICK  TFIIH basal transcription factor comp...  31.6    4.4    
sp|Q60HG2|TOR1A_MACFA  Torsin-1A precursor (Torsin family 1 me...  31.6    4.7   
sp|Q5L8L7.1|CLPX_BACFN  ATP-dependent Clp protease ATP-binding...  31.2    4.7    
sp|Q8CXH1|HSLU_OCEIH  ATP-dependent hsl protease ATP-binding s...  31.2    4.7   
sp|Q1RMT1.1|ERCC3_BOVIN  TFIIH basal transcription factor comp...  31.2    4.7    
sp|Q03LN0.1|CLPX_STRTD  ATP-dependent Clp protease ATP-binding...  31.2    5.0   
sp|Q5M0S4.1|CLPX_STRT1  ATP-dependent Clp protease ATP-binding...  31.2    5.1   
sp|Q8G5R1|CLPX_BIFLO  ATP-dependent Clp protease ATP-binding s...  31.2    5.3   
sp|O16299.1|FIGL1_CAEEL  Fidgetin-like protein 1 (Fidgetin hom...  31.2    5.6    
sp|O67356|CLPX_AQUAE  ATP-dependent Clp protease ATP-binding s...  31.2    5.6   
sp|Q5M936|TOR3A_RAT  Torsin-3A precursor (Torsin family 3 memb...  31.2    5.7    
sp|A1TCB3.1|CLPX_MYCVP  ATP-dependent Clp protease ATP-binding...  31.2    5.8   
sp|Q9ER41|TOR1B_MOUSE  Torsin-1B precursor (Torsin family 1 me...  31.2    6.0    
sp|A1KLF3.1|CLPX_MYCBP  ATP-dependent Clp protease ATP-binding...  31.2    6.1   
sp|A5U5F3.1|CLPX_MYCTA  ATP-dependent Clp protease ATP-binding...  30.8    6.3   
sp|Q7UZK6|CLPX_PROMP  ATP-dependent Clp protease ATP-binding s...  30.8    7.1    
sp|A2BZ43.1|CLPX_PROM5  ATP-dependent Clp protease ATP-binding...  30.8    7.4   
sp|P42425|LON2_BACSU  ATP-dependent protease La homolog            30.8    7.6   
sp|Q3J1G7.1|CLPX_RHOS4  ATP-dependent Clp protease ATP-binding...  30.8    7.8   
sp|Q6L200|EF2_PICTO  Elongation factor 2 (EF-2)                    30.4    8.4   
sp|P47253|Y007_MYCGE  Uncharacterized protein MG007                30.4    8.8   
sp|P52669|TTUA4_AGRVI  HTH-type transcriptional regulator ttuA...  30.4    9.4   
sp|Q6AK60|CLPX_DESPS  ATP-dependent Clp protease ATP-binding s...  30.4    9.5   
sp|P33683|CLPX_AZOVI  ATP-dependent Clp protease ATP-binding s...  30.4    9.5   
sp|Q9Y2P4|S27A6_HUMAN  Long-chain fatty acid transport protein...  30.4    9.7    


ALIGNEMENTS 2 à 2
     
>sp|Q1XDF4|CLPC_PORYE  ATP-dependent Clp protease ATP-binding subunit clpA homolog
Length=821

 GENE ID: 3978846 clpC | Clp protease ATP binding subunit [Porphyra yezoensis]

 Score =  429 bits (1103),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LASYFFGSE +MIRLDMSE+MERHTVSKLIGSPPGYVG++EGG LTEAVR++PYTV+L
Sbjct  560  KALASYFFGSEASMIRLDMSEYMERHTVSKLIGSPPGYVGYSEGGYLTEAVRKKPYTVIL  619

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPD+FNLLLQ+LEDGRLTD+KGRT+DFKNTLLIMTSNIGSKVIEKGGG LGFE
Sbjct  620  FDEIEKAHPDIFNLLLQILEDGRLTDAKGRTIDFKNTLLIMTSNIGSKVIEKGGGSLGFE  679

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
             S D  E SQY R++SLVNEELKQYFRPEFLNRLDEIIVFRQLTK+EV++IAE+ML EVF
Sbjct  680  LSEDQTE-SQYTRVRSLVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVREIAELMLNEVF  738

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             R++ + I+LNVT+ FK+RLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSG+IK GD+
Sbjct  739  ARIKQQDIQLNVTERFKQRLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGKIKAGDS  798

Query  241  ALVDIDDDKKVTI  253
            A+VD+ ++ +VT+
Sbjct  799  AVVDVTNEGEVTV  811


>sp|Q9TM05|CLPC_CYACA  ATP-dependent Clp protease ATP-binding subunit clpA homolog
Length=854

 GENE ID: 800182 clpC | Clp protease ATP binding subunit [Cyanidium caldarium]
(10 or fewer PubMed links)

 Score =  429 bits (1103),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 238/253 (94%), Gaps = 1/253 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K++ASYFFGSEEAM+RLDMSE+MERHTVSKLIGSPPGYVG+NEGGQLTEAVR+RPYTVVL
Sbjct  590  KAMASYFFGSEEAMVRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRKRPYTVVL  649

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFNLLLQ+LEDGRLTDSKGRT+DFKNTLLIMTSNIGSKVIEK GGGLGFE
Sbjct  650  FDEIEKAHPDVFNLLLQILEDGRLTDSKGRTIDFKNTLLIMTSNIGSKVIEKKGGGLGFE  709

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
               +++E+ QY+R+++LVNEELKQYFRPEFLNR+DEIIVFRQLTK+EV+ IA IML+E+F
Sbjct  710  LE-ENIEELQYSRMRNLVNEELKQYFRPEFLNRVDEIIVFRQLTKDEVRDIAHIMLREIF  768

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             R++ +GI L VT+ FK  L+EEGYNPSYGARPLRRA++RLLEDSLAEEVLSG+IK+GDN
Sbjct  769  ERVKQQGISLQVTERFKNLLIEEGYNPSYGARPLRRALVRLLEDSLAEEVLSGKIKEGDN  828

Query  241  ALVDIDDDKKVTI  253
            A++D+D++K+V I
Sbjct  829  AMIDVDENKQVKI  841


>sp|P51332|CLPC_PORPU  ATP-dependent Clp protease ATP-binding subunit clpA homolog
Length=821

 GENE ID: 809966 clpC | Clp protease ATP binding subunit [Porphyra purpurea]

 Score =  426 bits (1095),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 202/253 (79%), Positives = 234/253 (92%), Gaps = 1/253 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LASYFFGSE +MIRLDMSE+MERHTVSKLIGSPPGYVG++EGG LTEAVR++PYTV+L
Sbjct  560  KALASYFFGSEASMIRLDMSEYMERHTVSKLIGSPPGYVGYSEGGYLTEAVRKKPYTVIL  619

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPD+FNLLLQ+LEDGRLTD+KGRT+DFKNTLLIMTSNIGSKVIEKGGG LGFE
Sbjct  620  FDEIEKAHPDIFNLLLQILEDGRLTDAKGRTIDFKNTLLIMTSNIGSKVIEKGGGSLGFE  679

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
             S D  E SQY R++SLVNEELKQYFRPEFLNRLDEIIVFRQLTK+EV++IAE+ML EVF
Sbjct  680  LSEDQTE-SQYTRVRSLVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVREIAELMLNEVF  738

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             R++ + I+LNVT+ FKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSG+IK GD+
Sbjct  739  ARIKQQDIQLNVTERFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGKIKAGDS  798

Query  241  ALVDIDDDKKVTI  253
             +VD+ ++ +V +
Sbjct  799  PVVDVTNEGEVKV  811


>sp|P31541|CLPAA_LYCES  ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, 
chloroplast precursor
Length=926

 Score =  418 bits (1074),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 232/253 (91%), Gaps = 1/253 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            KSLA+Y+FGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVG+ EGGQLTEAVRRRPYTVVL
Sbjct  657  KSLATYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVL  716

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFN++LQ+LEDGRLTDSKGRTVDFKNTLLIMTSN+GS VIEKGG  +GF+
Sbjct  717  FDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFD  776

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
               D  +DS YNRIKSLV EELKQYFRPEFLNRL E+IVFRQLTK EVK+IA+IML+EVF
Sbjct  777  LDFDE-KDSSYNRIKSLVTEELKQYFRPEFLNRLSEMIVFRQLTKLEVKEIADIMLKEVF  835

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
            +RL++K I+L VT+ F++R+V+EGYNPSYGARPLRRA+MRLLEDS+AE++L+G IK+GD+
Sbjct  836  VRLKNKEIELQVTERFRDRVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAGEIKEGDS  895

Query  241  ALVDIDDDKKVTI  253
             +VD+D D  VT+
Sbjct  896  VIVDVDSDGNVTV  908


>sp|P35100|CLPC_PEA  ATP-dependent Clp protease ATP-binding subunit clpC homolog, 
chloroplast precursor
Length=922

 Score =  413 bits (1061),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 200/267 (74%), Positives = 235/267 (88%), Gaps = 1/267 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+Y+FGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVG+ EGGQLTEAVRRRPYTVVL
Sbjct  654  KALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVL  713

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFN++LQ+LEDGRLTDSKGRTVDFKNTLLIMTSN+GS VIEKGG  +GF+
Sbjct  714  FDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFD  773

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
               D  +DS YNRIKSLV EELKQYFRPEFLNRLDE+IVFRQLTK EVK+IA+IML+EVF
Sbjct  774  LDYDE-KDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVF  832

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RL+ K I+L VT+ F++R+V+EGYNPSYGARPLRRA+MRLLEDS+AE++L+  IK+GD+
Sbjct  833  QRLKTKEIELQVTERFRDRVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDS  892

Query  241  ALVDIDDDKKVTINISSEESSQELAGA  267
             +VD+D D KV +   S  + + L  A
Sbjct  893  VIVDVDSDGKVIVLNGSSGTPESLPEA  919


>sp|P31542|CLPAB_LYCES  ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, 
chloroplast precursor
Length=923

 Score =  412 bits (1059),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 197/253 (77%), Positives = 230/253 (90%), Gaps = 1/253 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+Y+FGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVG+ EGGQLTEAVRRRPYTVVL
Sbjct  654  KALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVL  713

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFN++LQ+LEDGRLTDSKGRTVDFKNTLLIMTSN+GS VIEKGG  +GF+
Sbjct  714  FDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFD  773

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
               D  +DS YNRIKSLV EELKQYFRPEFLNRLDE+IVFRQLTK EVK+IA+IML+EVF
Sbjct  774  LDLDE-KDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVF  832

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RL+ K I+L VT+ F++R+V+EGYNPSYGARPLRRA+MRLLEDS+AE++L+  IK+GD+
Sbjct  833  ERLKVKEIELQVTERFRDRVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLANEIKEGDS  892

Query  241  ALVDIDDDKKVTI  253
             +VD+D D  VT+
Sbjct  893  VIVDVDSDGNVTV  905


>sp|O78410|CLPC_GUITH  ATP-dependent Clp protease ATP-binding subunit clpA homolog
Length=819

 GENE ID: 856945 clpC | Clp protease ATP binding subunit [Guillardia theta]
(10 or fewer PubMed links)

 Score =  407 bits (1045),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 218/237 (91%), Gaps = 1/237 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LASYFFGSEEAM+RLDMSE+MERHTVSKLIGSPPGYVG+NEGGQLTE+VRRRPYTVVL
Sbjct  557  KALASYFFGSEEAMVRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTESVRRRPYTVVL  616

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EK HPDVFNLLLQ+LEDGRLTDSKGRTVDFKNTLLI+TSN+GSKVIEKGGGGLGF+
Sbjct  617  FDEIEKGHPDVFNLLLQILEDGRLTDSKGRTVDFKNTLLILTSNVGSKVIEKGGGGLGFD  676

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
             S D  E SQY RIK+LVNEELKQYFRPEFLNRLDEIIVFRQLTK+EV +IAEIML+EVF
Sbjct  677  LSEDQTE-SQYGRIKALVNEELKQYFRPEFLNRLDEIIVFRQLTKDEVGEIAEIMLKEVF  735

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKD  237
             R+ +KGI+L VT  FK  L+ EGYNP YGARPLRRAVMRLLED+L+EE L+ +IK+
Sbjct  736  TRISEKGIQLEVTARFKTHLINEGYNPIYGARPLRRAVMRLLEDTLSEEFLAEKIKE  792


>sp|P46523|CLPA_BRANA  ATP-dependent Clp protease ATP-binding subunit clpA homolog, 
chloroplast precursor
Length=874

 Score =  399 bits (1024),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 227/253 (89%), Gaps = 2/253 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+Y+FG EEAMIRLDMSEFMERHTVSKLIGSPPGYVG+ E  QLTEAVRRRPYTVVL
Sbjct  602  KALAAYYFGCEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEPPQLTEAVRRRPYTVVL  661

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE  120
            FDE+EKAHPDVFN++LQ+LEDGRLT+SKGRTVDFKNTLLIMTSN+GS VIEKGG  +GF+
Sbjct  662  FDEIEKAHPDVFNMMLQILEDGRLTNSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFD  721

Query  121  FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF  180
               D  +DS YNRIKSLV +ELKQYFRPEFLNRLDE+I+FRQLTK EVK+IA+I+LQE+F
Sbjct  722  L--DYEKDSSYNRIKSLVTQELKQYFRPEFLNRLDEMILFRQLTKLEVKEIADILLQELF  779

Query  181  IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN  240
             RL+ K ++L VT+ FKER+V+EGYNPSYGARPLRRA+MRLLEDS+ E++L+  IK+GD+
Sbjct  780  ERLKKKEVELQVTERFKERVVDEGYNPSYGARPLRRAIMRLLEDSMEEKMLAREIKEGDS  839

Query  241  ALVDIDDDKKVTI  253
             +VD+D + KVT+
Sbjct  840  VIVDVDSEGKVTV  852


>sp|P42762|ERD1_ARATH  ERD1 protein, chloroplast precursor
Length=945

 GENE ID: 835180 ERD1 | ERD1 (EARLY RESPONSIVE TO DEHYDRATION 1); ATP binding /
ATPase [Arabidopsis thaliana] (10 or fewer PubMed links)

 Score =  320 bits (820),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/262 (58%), Positives = 198/262 (75%), Gaps = 2/262 (0%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+LA+ +FGSEE+M+RLDMSE+MERHTVSKLIGSPPGYVGF EGG LTEA+RRRP+TVVL
Sbjct  675  KALAANYFGSEESMLRLDMSEYMERHTVSKLIGSPPGYVGFEEGGMLTEAIRRRPFTVVL  734

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKG-GGGLGF  119
            FDE+EKAHPD+FN+LLQL EDG LTDS+GR V FKN L+IMTSN+GS  I KG  G +GF
Sbjct  735  FDEIEKAHPDIFNILLQLFEDGHLTDSQGRRVSFKNALIIMTSNVGSLAIAKGRHGSIGF  794

Query  120  EFSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEV  179
                D  E + Y  +K+LV EELK YFRPE LNR+DEI++FRQL K ++ +I  +MLQ++
Sbjct  795  ILDDDE-EAASYTGMKALVVEELKNYFRPELLNRIDEIVIFRQLEKAQMMEILNLMLQDL  853

Query  180  FIRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGD  239
              RL   G+ L V++  KE + ++GY+P+YGARPLRR V  ++ED L+E  L+G  K GD
Sbjct  854  KSRLVALGVGLEVSEPVKELICKQGYDPAYGARPLRRTVTEIVEDPLSEAFLAGSFKPGD  913

Query  240  NALVDIDDDKKVTINISSEESS  261
             A V +DD    ++    + S+
Sbjct  914  TAFVVLDDTGNPSVRTKPDSST  935


>sp|P49574|CLPC_ODOSI  ATP-dependent Clp protease ATP-binding subunit clpA homolog
Length=885

 GENE ID: 801770 clpC | caseinolytic-like Clp protease [Odontella sinensis]

 Score =  313 bits (802),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 201/257 (78%), Gaps = 19/257 (7%)

Query  1    KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL  60
            K+L+ Y FG+E++MIRLDMSE+ME+HTV+KLIGSPPGYVG+NEGGQLTEAV+ +PY+VVL
Sbjct  571  KALSEYMFGNEDSMIRLDMSEYMEKHTVAKLIGSPPGYVGYNEGGQLTEAVQTKPYSVVL  630

Query  61   FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEK--------  112
             DEVEKAHPDVFNLLLQ+L+DGRLTDSKGRT+DF+NT++IMT+N+G+K+IEK        
Sbjct  631  LDEVEKAHPDVFNLLLQILDDGRLTDSKGRTIDFRNTMIIMTTNLGAKIIEKESGIKPKT  690

Query  113  ----------GGGGLGFEFSGDSVEDSQ-YNRIKSLVNEELKQYFRPEFLNRLDEIIVFR  161
                        G LG+E + + ++DS  + ++  LVNEELK++FRPEFLNR+DEIIVF 
Sbjct  691  KQDKPAFRIDESGCLGWEPTPEPIKDSALFEKVTELVNEELKEFFRPEFLNRIDEIIVFN  750

Query  162  QLTKNEVKQIAEIMLQEVFIRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRL  221
             LTK ++ +I  +M++++  RL++K + L V  + +  L EEGY+P YGARPLRRAVMRL
Sbjct  751  HLTKYDIWEICGLMVKQLQKRLEEKELTLEVDVSVRNLLTEEGYDPVYGARPLRRAVMRL  810

Query  222  LEDSLAEEVLSGRIKDG  238
            LED+LA++ LS  +  G
Sbjct  811  LEDTLAQQCLSKPLYPG  827



  

ORF finding

PROTOCOLE
Outils: SMS ORF Finder/Any codon/1,2,3 phases de lecture/sens direct/Minimun 60 codons/
Code génétique bactérien

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 285 to base 668.
AGTCGGATAAAGACCTCTTGCAACATTATTTCAGCAATTTGTTTAACTTCATTTTTCGTT
AATTGCCTGAATACAATTATTTCATCAAGTCTATTTAAAAATTCAGGCCTAAAGTATTGC
TTAAGTTCTTCATTAACTAGTGATTTAATTCTATTATATTGGCTATCTTCAACTGAATCA
CCTGAGAATTCGAATCCCAGTCCGCCACCACCTTTTTCGATTACTTTTGAACCGATATTA
GAGGTCATTATTAACAATGTATTTTTAAAATCTACAGTTCTACCTTTGGAGTCAGTTAAT
CTTCCGTCTTCAAGTAGTTGCAATAATAAGTTGAAAACATCTGGATGCGCCTTTTCAACT
TCATCAAATAAAACGACTGTATAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
SRIKTSCNIISAICLTSFFVNCLNTIISSSLFKNSGLKYCLSSSLTSDLILLYWLSSTES
PENSNPSPPPPFSITFEPILEVIINNVFLKSTVLPLESVNLPSSSSCNNKLKTSGCAFST
SSNKTTV*


PROTOCOLE
Outils: SMS ORF Finder/Any codon/1,2,3 phases de lecture/sens indirect/Minimun 60 codons/
Code génétique bactérien

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 811.
AAATCATTGGCTTCATATTTCTTCGGTAGTGAAGAAGCAATGATCAGATTAGATATGTCA
GAGTTCATGGAAAGACATACAGTTAGTAAACTTATAGGCTCGCCTCCTGGCTATGTTGGT
TTTAATGAAGGTGGTCAGCTTACTGAAGCTGTTAGAAGACGTCCTTATACAGTCGTTTTA
TTTGATGAAGTTGAAAAGGCGCATCCAGATGTTTTCAACTTATTATTGCAACTACTTGAA
GACGGAAGATTAACTGACTCCAAAGGTAGAACTGTAGATTTTAAAAATACATTGTTAATA
ATGACCTCTAATATCGGTTCAAAAGTAATCGAAAAAGGTGGTGGCGGACTGGGATTCGAA
TTCTCAGGTGATTCAGTTGAAGATAGCCAATATAATAGAATTAAATCACTAGTTAATGAA
GAACTTAAGCAATACTTTAGGCCTGAATTTTTAAATAGACTTGATGAAATAATTGTATTC
AGGCAATTAACGAAAAATGAAGTTAAACAAATTGCTGAAATAATGTTGCAAGAGGTCTTT
ATCCGACTTCAAGATAAAGGTATTAAATTAAATGTCACCGATGCTTTCAAAGAAAGACTT
GTTGAAGAAGGTTACAATCCTTCATACGGAGCGAGACCTTTAAGAAGGGCAGTTATGCGT
TTACTAGAAGATAGTTTGGCTGAAGAAGTTCTTTCTGGCAGAATAAAAGATGGAGATAAT
GCTTTAGTTGATATAGATGATGATAAAAAAGTTACAATAAATATTTCTTCTGAAGAATCT
TCTCAAGAGCTAGCTGGTGCTAATTTCTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
KSLASYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGFNEGGQLTEAVRRRPYTVVL
FDEVEKAHPDVFNLLLQLLEDGRLTDSKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFE
FSGDSVEDSQYNRIKSLVNEELKQYFRPEFLNRLDEIIVFRQLTKNEVKQIAEIMLQEVF
IRLQDKGIKLNVTDAFKERLVEEGYNPSYGARPLRRAVMRLLEDSLAEEVLSGRIKDGDN
ALVDIDDDKKVTINISSEESSQELAGANF*

No ORFs were found in reading frame 3.
Personal tools