ORF QA15980

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01159973.1
Annotathon code: ORF_QA15980
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : annomg
Annotated on : 2008-03-19 18:52:37
  • MACHI Marc
  • ZWOJSCZYKI Gael

Synopsis

Genomic Sequence

>AACY01159973.1 ORF_QA15980 genomic DNA
GGCAAGTTCTTCAAGGATCTTTGAAGGAAAAAGGGTTTGATAAAGATAAATTGTGGAGTGACGCAGTCTCTAACAGAGGCACTGCAAGGCAAGCATGTAT
GCAAATTTGGCTAAAAGACTATTGTAACTTTGATGCTTCGAAATTAAAGCCCACAGAAGTTATGCAAAAATGTTTATCTGTTTCTAGAGAAAATAACTTG
TCTGCTCCTATATTTGGAAAACAAAAGGTAATCGATGGATCTACTGGTATTCCTTTTGATCAGCCAATAACTGTTGGTAATGTATACATGCTTAAATTAA
TACACTTAGTTGAAGATAAAATACATGCTAGGTCAACTGGACCTTACTCATTAATTACCCAACAGCCATTAGGTGGTAAGGCACAGTTTGGAGGCCAAAG
ATTTGGAGAAATGGAAGTATGGGCACTTGAAGCTTATTCTGCTGCATATACTTTACAAGAAATGTTGACAGTTAAGTCAGATGATGTAATAGGTAGGGTA
AAGGCTTATGAGGCTATCGTAAAGGGTGAAGAAATAATTCAGCCTGGGTTACCAGAATCTTTTCATGTTTTGCTCAAGGAATTGCAAGGTTTAGGGCTAT
CAGTTGAGCTGCTAAATGAAGATATTGATAAATATGCGGAGATTGAAAAAGTTGACCAAGATGAATCAATTTCAACATCTATCGGTTGGGATGATATCAG
TGAAGAGCCTTTAGAATTACTTGAAATTGAAGAATTGAATCTTAATGATGATTCAAATTTAATAGTTGAAGAAGAAGAATCTGAAGAATCCAAAGAAATA
GAAA

Translation

[3 - 803/804]   direct strand
>ORF_QA15980 Translation [3-803   direct strand]
QVLQGSLKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSVSRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLI
HLVEDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLS
VELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEPLELLEIEELNLNDDSNLIVEEEESEESKEIE

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

(((GramBact:0.37957,EUBact:0.34233):0.11073,(((CFBbact:0.48818,
ORFxxx0:0.59422):0.03547,GSBact:0.49013):0.11479,GNSBact:0.56696):0.02849):0.03824,
(((ProteoBact:0.00000,CyanoBact:0.00000):0.48425,Enterobact:0.53795):0.06119,
Mycoplasma:0.70531):0.03042,EUCARYOTE:0.65878);

Annotator commentaries

L'étude initiale de l'ORF montre une séquence dont il nous manque la partie initiale (la méthionine) et le codon STOP. Nous pouvons donc conclure sur ceci en disant que nous n'avons qu'une partie du gène. Ceci étant, le poids moléculaire définit ci dessus est donc tronqué les parties initiales et terminales de la protéine étant manquantes.

Durant l'étude de notre séquence d'ADN notamment lors de la recherche d'homologue (grâce au BLAST) nous avons remarqué que la plupart des séquences homologues correspondes à des (sous unités) ARN Polymérases ADN dépendante. On peut donc émettre l'hypothèse que notre séquence codante pourrait coder pour une ARN Polymérase ADN dépendante. Lorsqu'on fait un BLASTp ( en sélectionnant la base de donnée "nr" ) on obtient beaucoup de résultats .Cela n'est pas étonnant , la "ARN Polymérase ADN dépendante" est une protéine qui , nous pensons , être retrouvé chez tous les organismes car celle ci participe à la transcription de l'information génétique , qui est à notre sens à la base de toute forme de vie .

L'ARN polymérase catalyse la polymérisation (ADN dépendante) d'un ARN. Cette molécule intervient dans l'élongation du complexe transcriptionnel . Rpb2 est une des grosse sous unité de l'ARN polymérase et la région C-terminale de cette sous unité (Rpb2) possède une région d’attachement, qui contient un motif "ZINC" actif. Ce site de liaison permet l'attachement à deux autres molécules qui sont Rpb1 et Rpb3.

La transcription utilise les propriétés de complémentarité des bases azotées. Pour synthétiser un brin d’ARN, un seul brin d'ADN est nécessaire (le brin transcrit). L'ARN Polymérase permet la synthèse de l'ARN .Elle ajoute, un à un, les nucléotides du brin d'ARN en formation. L'ARN polymérase catalyse la réaction suivante : Nucleoside triphosphate + A.R.N. (n) _

diphosphate + A.R.N. (n+1). 

La transcription permet ainsi la synthèse d'une molécule d'ARN simple brin, complémentaire du brin transcrit de l’ADN. Cette ARN porte donc l'information génétique, toujours sous la forme d'une séquence nucléotidique.

De plus, d’après l’analyse phylogénétique on peux dire que notre ORF est très proche de la séquence ( RNA polymérase DNA dépendante )de la CFBbactérie(Psychroflexus torquis ATCC 700755) et d'une manière générale notre ORF est plus similaire aux séquences (RNA polymérase DNA dépendante) de bactérie que celles des eucaryotes. On peut émettre l'hypothèse que l'ORF étudié pourrait provenir d'une bactérie.

En regardant bien le BLASTp on remarque qu'il y a un symbole gène qui revient souvent , il s'agit du symbole "RpoB" . Nous avons vérifié la signification de ce symbole sur SWISSPROT et on constate que ce dernier correspond à une "DNA-directed RNA polymerase subunit B'". Comme notre ORF code probablement pour une "DNA-directed RNA polymerase subunit B'" (selon le BLASTp)nous avons pensé à attribuer le même symbole gène à notre ORF .

Multiple Alignement

ALIGNEMENT MULTIPLE : En utilisant le logiciel "CLUSTAL W"

Format CLUSTALw :

                     10        20        30        40        50        60
                      |         |         |         |         |         |
Mycoplasma   --MAYKIRKINRNVERRDYTKVSMNLSLPNLIGIQTETFEWFKT----------------
EUCARYOTE    ------------MTQLTDTSLIPF-----DLLEIQKASFKWFFE----------------
EUBact       ---MVGHKTVELS------PDSQKFWELAQLVKIPTNSELWFLD----------------
GramBact     ---MAASRSSSRISF----AKIIEPLEVPDLLALQTQSFDWLIGSDAWAERVQEAIDSGR
ProteoBact   ---MVQQTFTGRKRVRKFFGHIREVAAMPNLIEVQKASYDQFLMVDE---------PEGG
CyanoBact    ---MVQQTFTGRKRVRKFFGHIREVAAMPNLIEVQKASYDQFLMVDE---------PEGG
Enterobact   ---MVVYSSTEKKRIRKDFGKRPKVLDIPYLLSIQLNSFQKFIKHD----------PNG-
GSBact       ---MADKTQKKCIA----FSKIQSIVNPPDLLQVQLDSFKRFIQDSVP--------LAKR
CFBbact      ----MLAIHNERIS----FSSVQNKPDYPDFLDIQVKSFQDFFQLETK--------PEER
ORFxxx0      ------------------------------------------------------------
GNSBact      MVSMLPKADAATGITRKSYAQLPEVVNVPNLIEMQLQSFVWFQE----------------
                                                                         
Prim.cons.   MV2MVQ2T2TER2RVRKDF2KI2EVL43P2LLEIQ3ASFDWF23VDE3AERVQEAIPEGR

                     70        80        90       100       110       120
                      |         |         |         |         |         |
Mycoplasma   ------KGIQEVLDEFFPILSFDG--SSVLTLENWGFKEPRLSVRQAREESKIYDAPIYA
EUCARYOTE    ------EGLIEEIENFSPVIDLRGNFEVHFYLKNYELEAPTFTLEEAKQRDLTYAAQLYI
EUBact       ------EGLREMFRDISPIQDFTG--NLILEFIDYSLGEPKYSVEECKERDVTFAAPLRV
GramBact     DDVPITSGLEEVFEEISPIEDFSG--SMSLSFRDHRFEPPKYSVEECKDKDMTFSAPLFV
ProteoBact   R---LDEGLQAVFKSVFPINDFSG--TSQLEFVRYEFEAPKYDVDECRQRGMTYAAPLKV
CyanoBact    R---LDEGLQAVFKSVFPINDFSG--TSQLEFVRYEFEAPKYDVDECRQRGMTYAAPLKV
Enterobact   ----I-HGLESAFRSIFPIRSYNG--NSELQYINYKLGQPIFNVKECQTRGMTYSSPLRV
GSBact       K----DQGLEKVLRSAFPITDTRG--LYLLEYISYTFDKPKYTVEECIERGLTYDVSLKV
CFBbact      S----NEGLYNTFKENFPITDTRN--QFVLEFLDYFVDPPRYSIQECIERGLTYSVPLKA
ORFxxx0      ------------------------------------------------------------
GNSBact      ------EGLRELIEEISPIKDFVG-NRLELEFIGYEFREPRLSEYECTQRDQTYSVPLYV
                                                                         
Prim.cons.   RDVP2DEGL2EVF32IFPI2DF2GN23S3LEFI2YEFE2PKYSVEEC22RGMTY2APLKV

                    130       140       150       160       170       180
                      |         |         |         |         |         |
Mycoplasma   NLKLSVNKTEEIQKEFDGVDQEDTLKVLTHWLEEKTGNGNITFKQQSQNSYFFEITIKKS
EUCARYOTE    PVELR---------------------------DLETG-----------------------
EUBact       KVRLINK-----------------------------------------------------
GramBact     TAEFTNN-----------------------------------------------------
ProteoBact   TLRLIVFDI-----------------------DEETG-----------------------
CyanoBact    TLRLIVFDI-----------------------DEETG-----------------------
Enterobact   KLRLVIY-------------------------EKETL-----------------------
GSBact       KLKLSYKDE-----------------------PD--------------------------
CFBbact      RLKLYCTDP---------------------------------------------------
ORFxxx0      ------------------------------------------------------------
GNSBact      KARLIVKT----------------------------------------------------
                                                                         
Prim.cons.   KLRLIVKDIEEIQKEFDGVDQEDTLKVLTHWLDEETGNGNITFKQQSQNSYFFEITIKKS

                    190       200       210       220       230       240
                      |         |         |         |         |         |
Mycoplasma   EKPDLIQIDIIEDKKTSLICNVSIYKSGEVFLGDFPLMTEAGTFIINGSQKVIVSQLVRS
EUCARYOTE    -----------------------IVKQDRIFFGEIPLMTDRCTFLINGVERVIINQIIRS
EUBact       --------------------ETGEVKEQEVFMGDFPLMTEKGTFIINGAERVIVSQLVRS
GramBact     --------------------TTGEIKSQTVFMGDFPLMTPKGTFVINGTERVVVSQLVRS
ProteoBact   AK------------------SVKDIKEQDVYMGDIPLMTMNGTFVVNGTERVIVSQMHRS
CyanoBact    AK------------------SVKDIKEQDVYMGDIPLMTMNGTFVVNGTERVIVSQMHRS
Enterobact   DI------------------TVKDIKEQEVYMGEIPLMTTNGTFIINGTERVVVSQLHRS
GSBact       EQ------------------DWKETIQQEVYLGRIPYMTDRGTFIVNGAERVVVAQLHRS
CFBbact      EH------------------EDFETIVQDVYLGTIPYMTPSGTFVINGAERVVVSQLHRS
ORFxxx0      ------------------------------------------------------------
GNSBact      --------------------TGEIKEPFDLFFGDIPLMTALGTFITSGTERVVVSQLLRS
                                                                         
Prim.cons.   EKPDLIQIDIIEDKKTSLICTVKEIKEQ2V2MGDIPLMT4NGTFIINGTERV2VSQLHRS

                    250       260       270       280       290       300
                      |         |         |         |         |         |
Mycoplasma   PGAYFNKELNR--KTGEMIYFADIIPSRGTWLEYETDSKKIGSDAINPLYVKIDKSRKTT
EUCARYOTE    PGIYYSVNTD---EQGTRTYDVTIISNRGAWLKFEVDKD-------DLIWMRIDKTHRLP
EUBact       PGVYFNETTDP--TSGKKVYGATMIPNRGAWLEFESDAN-------DNVYVRIDRTRKLP
GramBact     PGVYFERSLDK--ASDKDLYSCKVIPSRGAWLEFEIDKR-------DTVGVRIDRKRRQS
ProteoBact   PGVFFDHDKGKTHSSGKLLFAARVIPYRGSWLDIEFDAK-------DIVFARIDRRRKIP
CyanoBact    PGVFFDHDKGKTHSSGKLLFAARVIPYRGSWLDIEFDAK-------DIVFARIDRRRKIP
Enterobact   PGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPK-------DNLFFRIDRRRKLP
GSBact       PGVVFSEAIHP---NGKKMYSAKIVPTRGSWIEFQTDIN-------NQIYVYIDQKKNFL
CFBbact      PGVFFGQSFHA---NGTKLYSARVIPFKGSWIEFATDIN-------SVMYAYIDRKKKLP
ORFxxx0      ------------------------------------------------------------
GNSBact      PGVYFTISDDP--ATGRPLCHTNLIPSRGAWLEFETSNR-------DVISVKIDGRRKIP
                                                                         
Prim.cons.   PGVYFD22KDKTHSSGKKLYSAR2IP2RGSWLEFETDAKKIGSDAID3VYVRIDRRRKLP

                    310       320       330       340       350       360
                      |         |         |         |         |         |
Mycoplasma   ATSLLLAFGIS-------------------------------------------------
EUCARYOTE    CHIFLKALNLS-------------------------------------------------
EUBact       ATVLIRALGYSN------------------------------------------------
GramBact     VTVLLKALGWD-------------------------------------------------
ProteoBact   VTSLMFALGLDSEEILSTFYKKIVYKRAKSGGHSDGWRVPYDPVRFRGYSTLNDLIDADT
CyanoBact    VTSLMFALGLDSEEILSTFYKKIVYKRAKSGGHSDGWRVPYDPVRFRGYSTLNDLIDADT
Enterobact   ISIILKALNYNTEQILDTFFKKNIFKFTEN-----SILMKLVPHRLRGETASFDICIDN-
GSBact       VSALLRAIGFTKDEDILSLFDLIEEVPVKAN-----------------------------
CFBbact      VTTLFRAIGFERDKDILEIFDLAEEVKVSKT-----------------------------
ORFxxx0      ------------------------------------------------------------
GNSBact      VSTLLRAIGYS----------------------------------------------D--
                                                                         
Prim.cons.   VTSLLRALG2SSEEIL2TFFKKI22KR2KSGGHSDGWRVPYDPVRFRGYSTLNDLID2DT

                    370       380       390       400       410       420
                      |         |         |         |         |         |
Mycoplasma   -----------------------------------------------------------K
EUCARYOTE    -----------------------------------------------------------E
EUBact       -----------------------------------------------------------N
GramBact     -----------------------------------------------------------E
ProteoBact   GKVVLEAGKKLTVRAARQLQEKGLKALRMSDEELVGMYLAEDLVNPKTGEIYAEAGEEIT
CyanoBact    GKVVLEAGKKLTVRAARQLQEKGLKALRMSDEELVGMYLAEDLVNPKTGEIYAEAGEEIT
Enterobact   -KTYIKKGQRITARHINILKEKKIHTIKVPTEYLIGKISAKNYFNKKTNEIIVSANTELN
GSBact       -KKEYLIGKNLAS-----------DIIDMQTGEVVSAR------------------TAIT
CFBbact      -GLKKYLGRKLAARVLNTWYE---DFVDEDTGEVVSIER---------NEIVLDRDTVLE
ORFxxx0      ------------------------------------------------------------
GNSBact      -----------------------------------------------------------D
                                                                         
Prim.cons.   GKVVLEAGKKLT2RAA2QLQEKGL2A22MSTEELVGMYLAEDLVNPKT2EIYAEAGTEI2

                    430       440       450       460       470       480
                      |         |         |         |         |         |
Mycoplasma   DDILNIFDNDEV----L----------VETLQQDSIIGDFKIDWSN-QVQEIYKKIRQGE
EUCARYOTE    SEILSALTHPEF----L----------QKTIYEH---GDCTEEEA---LIEFHRQLRPGE
EUBact       VQVHELFD--GD-----------------ERIRITLERDNTENTEE-ALVEIYKRLRPGE
GramBact     ARILERFG--DF-----------------PSMRITLEKDHTASQDD-ALLDIYRKLRPGE
ProteoBact   EKSLKALNEEGYKELPLLDIDHVNVG---PYIRNTLAADKNMTRED-ALFDIYRVMRPGE
CyanoBact    EKSLKALNEEGYKELPLLDIDHVNVG---PYIRNTLAADKNMTRED-ALFDIYRVMRPGE
Enterobact   INIIKELKNNEYTNIETIFTNDLDHG---PYISETLNIDPTHDKLS-ALVEIYRMMRPGE
GSBact       EEILDQITAAGSKTVRIMKPGTGEKGLDKSVVTNTILNDSSATEEE-ALEIVYEELRANE
CFBbact      KDHIEEILETGSKTILLHKEENLTG--DYAIIYNTLQKDPTNSEKE-AVEHIYRQLRNAE
ORFxxx0      ------------------------------------------------------------
GNSBact      LDILNLFEVIDND---P------E----RHYIQSSIDRDPLIKDEISALIDIYSRLRPGD
                                                                         
Prim.cons.   EDIL2A23EEGYK22PLL2IDH22VGLDKPYIRNTL24DPT4TEE2SAL42IYR4LRPGE

                    490       500       510       520       530       540
                      |         |         |         |         |         |
Mycoplasma   TATSEGASKFINSILFDKRKYDLTKAGRFKLKQKLSIKNRILNKVIAEDILDANNNVLIA
EUCARYOTE    PPNSIQGRYLLYSRFFDPKRYDLGFVGRYKLNKKLNLN----------------------
EUBact       PPTVDSARSLLDTLFFDPKRYDLAKVGRYKINKRLGLQ----------------------
GramBact     PPTRESAQTLLENLFFNPKRYDLAKVGRYKVNKKLTLE----------------------
ProteoBact   PPTLESAQNMFQSLFFDAERYDLSAVGRVKMNMRLDLD----------------------
CyanoBact    PPTLESAQNMFQSLFFDAERYDLSAVGRVKMNMRLDLD----------------------
Enterobact   PPTREAAENLFENLFFSEERYDLSSVGRMKFNRSLQKQ----------------------
GSBact       APDIDAARSFLERTFFNQKKYDLGDVGRYRINKKLGKEHEAFKEFLS-------------
CFBbact      PPDEETARGIIDKLFFSDQRYNLGEVGRYRMNKKLGLN----------------------
ORFxxx0      ------------------------------------------------------------
GNSBact      PPNADNARKLINEMFFDPQHYDLGKVGRYKVNRRLELPDR--------------------
                                                                         
Prim.cons.   PPT3ESARNLLESLFFDPKRYDLGKVGRYKMNKKLGL43R2222222EDILDANNNVLIA

                    550       560       570       580       590       600
                      |         |         |         |         |         |
Mycoplasma   KDTEVTKNNIQEISKILDQDVMSIDLKYLSDIPGNRKVQKIRVYKDSELKTDTTCLIGLT
EUCARYOTE    ------------------------------------------------------------
EUBact       ------------------------------------------------------------
GramBact     ------------------------------------------------------------
ProteoBact   ------------------------------------------------------------
CyanoBact    ------------------------------------------------------------
Enterobact   ------------------------------------------------------------
GSBact       ---------------------------------GQPELKALSDSIYEKILQTIQSYSDEP
CFBbact      ------------------------------------------------------------
ORFxxx0      ------------------------------------------------------------
GNSBact      ------------------------------------------------------------
                                                                         
Prim.cons.   KDTEVTKNNIQEISKILDQDVMSIDLKYLSDIPG22222222222222222222222222

                    610       620       630       640       650       660
                      |         |         |         |         |         |
Mycoplasma   NSSNEEFITVADILSTVSYLLNLKYNIG----EIDDIDNLGNRRVRTVGELLQNQFRMGL
EUCARYOTE    VSPNIRILTTQDILEILNYLINLQFGMG----QIDDIDHLGNRRVKAVGELLQSQLRIGL
EUBact       IEKEIRHLTKDDIIATVREMLKLMQGEG----HADDIDHLGNRRLRSVGELLQNQFRIGL
GramBact     IAHDVGVLTEDDIVRTIEYVVKLHAGADPAEYEVDDIDHFGNRRLRTVGELIQNQVRLGL
ProteoBact   APDTYRTLRKEDILAVIKTLVDLRDGKG----EIDDIDHLGNRRVRSVGELMENQYRVGL
CyanoBact    APDTYRTLRKEDILAVIKTLVDLRDGKG----EIDDIDHLGNRRVRSVGELMENQYRVGL
Enterobact   NITERGVLNQSDIISVIKKLIDIRNGHG----EIDDIDHLGNRRVRSVGEMAENQFRIGL
GSBact       ISDDIMVLTHYDIIAVINYLIKLVNGQA----EVDDVDHLANRRVRTVGEQLAAQFVIGL
CFBbact      ISMDSKVLTKLDIITIIKYLIELVNSKA----EVDDIDHLSNRRVRTVGEQLSQQFGVGL
ORFxxx0      ------------------------------------------------------------
GNSBact      EVGDNRALTREDIVAIIKRIIMVNNGQD----TPDDIDHLGNRRIRTVGELVQNQFRIGL
                                                                         
Prim.cons.   ISDDIRVLTKEDI2AVIKYLI2LRNGKGPAEYEIDDIDHLGNRRVRTVGELLQNQFRIGL

                    670       680       690       700       710       720
                      |         |         |         |         |         |
Mycoplasma   NRIDKNVKEKLATSDLYKVKT----STIINAKPLTAIIGEFFNLSQLSQFMDQINPLSEL
EUCARYOTE    NRLERLIHDRLSMLTTKSFKKRKKLTTLINAKPINECLKEFFGSSQLSQFMDQTNPLAEL
EUBact       SRMERVVRERMTIQDVEVITP----QVLINIRPVVAAIKEFFGSSQLSQFMDQTNPLAEL
GramBact     ARMERVVRERMTTQDVEAITP----QTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGL
ProteoBact   LRMERAIKERMSSVDIDTVMP----QDLINAKPAAAAVREFFGSSQLSQFMDQTNPLSEI
CyanoBact    LRMERAIKERMSSVDIDTVMP----QDLINAKPAAAAVREFFGSSQLSQFMDQTNPLSEI
Enterobact   IRVERAVKDRLSLGDLDMLMP----QDMINAKPISAAIKEFFGSSQLSQFMDQNNPLSEI
GSBact       ARMGKNVREKLNSRDTDKIAP----ADLINARTVSSVVSSFFATSQLSQFMDQTNPLAEM
CFBbact      ARMARTIRERMNVRDNEVFTP----IDLINAKTLSSVINSFFGTNQLSQFMDQTNPLAEL
ORFxxx0      ------------------------------------------------------------
GNSBact      VRLERVARERMSIVNLEVVTP----SALVNIRPVVSAVKEFFGGSQLSQFMDQTNPLAEI
                                                                         
Prim.cons.   ARMER2VRERMSSVDL2VVTPRKKLQDLINAKPV2AAIKEFFGSSQLSQFMDQTNPLAEL

                    730       740       750       760       770       780
                      |         |         |         |         |         |
Mycoplasma   TNKRRLTALGPGGLSRDRAGLEVRDVHPSHYGRICPIETPEGPNIGLINNLSTYARVNEY
EUCARYOTE    IHKRRLTILGPGGLSRDRAGCAVRDIHPSHYGRICPIETPEGQNAGLVGSLTTHAHLNQY
EUBact       THKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTFARINEF
GramBact     THKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSTFARVNPF
ProteoBact   THKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLINSLATFARVNKY
CyanoBact    THKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLINSLATFARVNKY
Enterobact   THKRRISALGLGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNSY
GSBact       TNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLISSLSVYAEINDK
CFBbact      TNKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLISSMSVYGKVNSM
ORFxxx0      ------------------------------------------------------------
GNSBact      TNKRRLSAMGPGGLSRERAGFDVRDVHYSHYGRICPIETPEGPNIGLIGSLATYSRINRY
                                                                         
Prim.cons.   THKRRLSALGPGGLSRERAGFEVRDVHP2HYGRICPIETPEGPNIGLI2SLSTYARVN3Y

                    790       800       810       820       830       840
                      |         |         |         |         |         |
Mycoplasma   GFITTPYRKVIN--GIIQNDQ---------------------------------------
EUCARYOTE    GFIETPFYKVEK--GYIQKELG--------------------------------------
EUBact       GFIETPYRKVDKERGAVTEQID--------------------------------------
GramBact     GFVETPYRKVVN--GRVTDQID--------------------------------------
ProteoBact   GFVETPYRKVKD--GRVTDEVV--------------------------------------
CyanoBact    GFVETPYRKVKD--GRVTDEVV--------------------------------------
Enterobact   GFLETPYRKIHN--GKVTNEIK--------------------------------------
GSBact       GFIQAPYRVVEK--GIVTDKVE--------------------------------------
CFBbact      GFIETPYRKVEN--GKIDFKSD--------------------------------------
ORFxxx0      ------------------------------------------------------------
GNSBact      GFVETPYRKVYSKLKNNDKKLVGLKLAAAVSDKDKVLASAGSVVSEENFKLISKLPECDI
                                                                         
Prim.cons.   GFIETPYRKVEN22GRVTDE22GLKLAAAVSDKDKVLASAGSVVSEENFKLISKLPECDI

                    850       860       870       880       890       900
                      |         |         |         |         |         |
Mycoplasma   ---------VEYLTADQEKNFIIAQSNVNQDENGKILDEIIVSR-FNGDDYMAKVEEIHY
EUCARYOTE    ---------IIYLTADEEDQYRIAAADVLINETNKIIGEDISVR-YRQEFITTKIDQIDF
EUBact       ---------Y--LTADEEDKFIVAQANAPLDEEGRFIQKKVNAR-HGHDILVVPMEMVDY
GramBact     ---------Y--LTADEEDRHVKAQANTPLSPDGTFAEDRVLVRRKGGEVEFIPPDEVDY
ProteoBact   ---------Y--LSAMEEGRYHVAQANLPLDNRGRFTEDLVVCR-HAGEVLPVTPDKVDF
CyanoBact    ---------Y--LSAMEEGRYHVAQANLPLDNRGRFTEDLVVCR-HAGEVLPVTPDKVDF
Enterobact   ---------Y--LSAIEEGNFIIAQANTNLDETGAFVEDLITCR-YKGESSLFNKNQINY
GSBact       -----------MLSAEDEENKITVPVSVKFDENRRITTETVQAR-TKGDYPVVDAEQVDY
CFBbact      ---------PLYLSAEEEENKLIAQANIPISEDGAITSERVIAR-MEGDFPVVDPKDVDY
ORFxxx0      ------------------------------------------------------------
GNSBact      QVMPFVSAEVKYMPADEEDRYIIAQANTRLDENGYFLDERIEAR-LAERYVIEPPEKIDY
                                                                         
Prim.cons.   QVMPFVSAEY4YLSADEED2YIIAQAN2PLDENGRFTEE2VVARRHAGEVLVVPP22VDY

                    910       920       930       940       950       960
                      |         |         |         |         |         |
Mycoplasma   IDVSPKQIVSVATSGIPFLENDDANRALMGANMQRQAVPLIKPESPIVATGIEFEAARDS
EUCARYOTE    IAISPLQTFSVSTSLIPFLEHDDANRALMGSNMQRQAVPLLHAEKPLVGTGLEFQVAKDS
EUBact       MDVSPKQVVSIATALIPFLEHDDANRALMGANMQRQAVPLLRTDAPYVGTGMEYKAAKDS
GramBact     MDVSPRQMVSVATAMIPFLEHDDANRALMGSNMQRQSVPLLRSEAPLVGTGMEARAAKDA
ProteoBact   MDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLVRAEAPFVGTGMEGVVARDS
CyanoBact    MDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLVRAEAPFVGTGMEGVVARDS
Enterobact   MDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRSEKPLVGTGMERAVAVDS
GSBact       MDVSPIQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLVADAPLVGTGMEAKVARDS
CFBbact      IDVAPNQISSISASLIPFLEHDDANRALMGSNMMRQALPLLRVDAPIVGTGLERRVAQDS
ORFxxx0      ------------------------------------------------------------
GNSBact      MDVSPKQIFSVAASLIPFLEHDDANRALMGANMQRQAVPLLRAEAPMVATGMEREAARYS
                                                                         
Prim.cons.   MDVSPKQIVSVAA2LIPFLEHDDANRALMG2NMQRQAVPLLRAEAPLVGTGMER4VARDS

                    970       980       990      1000      1010      1020
                      |         |         |         |         |         |
Mycoplasma   GEAIVAKEDAIVKYVDSKTIITDGESGIRT---------------YILSDYERSNNGTSL
EUCARYOTE    RRVLINKSEGLVKRVTGDHICIQTDTGKEIN--------------YTLIKYQRSNQDTCI
EUBact       GVVAIAKKPGVIERVSGDEIIIRSD------------DGTL--EQHKLLKFLRSNQGTCI
GramBact     GDVVVCVQAGVVEDLSADYITVMHD------------DGTR--RTYRLAKFRRSNQGTCI
ProteoBact   GAAIAARRSGVIDQIDATRVVIRAT-EDLD-------PTKSGVDIYRLMKYQRSNQSTCI
CyanoBact    GAAIAARRSGVIDQIDATRVVIRAT-EDLD-------PTKSGVDIYRLMKYQRSNQSTCI
Enterobact   GVTIIAKRGGIVQYVDASRIIIKVKKNEIN-------SEEAGIDIYNLKKYTRSNQNTCI
GSBact       RAVVLAEGDGVIESVTAESIRVRYDMHEDEDDRMIMLDPDEGVKTYNLIKFKRSNQDTCI
CFBbact      RVLINAEGEGRVQYVDARKIIIDYDRTENE--RLVSFDEDH--KTYNLIKFRKTNQGSTI
ORFxxx0      ------------------------------------------------------------
GNSBact      GQVIFAKRAGVAASVTSEKIIIRTAEGQDD---------E-----YLLKKFVRTNQGTCI
                                                                         
Prim.cons.   G2VIIAKR4GVVEYVDADRIIIR3D6GE2D2DR2222D34SGVD2Y2LIK2QRSNQGTCI

                   1030      1040      1050      1060      1070      1080
                      |         |         |         |         |         |
Mycoplasma   TQSPIVKVGDVVKKGEIIADGPSMDQGELAIGQNVVVAFSTYNGYNFEDAIVMSERIVID
EUCARYOTE    TQRPIVFEGERVKKGQILADDTATDKGELALGQNLLVAYMPWEGYNYEDAILINERLVYE
EUBact       NQKPICHKGQRVEAGDIIADGPSTDQGELALGRNVLVAFMTWEGYNYEDAILVNEKLVRE
GramBact     NQKPIVFEGDRVEAGQVIADGPCTDNGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQD
ProteoBact   NQRPLVKVGDTVRKGDIIADGPSTDLGELALGRNVLVAFMPWNGYNFEDSILLSERIVKE
CyanoBact    NQRPLVKVGDTVRKGDIIADGPSTDLGELALGRNVLVAFMPWNGYNFEDSILLSERIVKE
Enterobact   NQIPCISLGENVEKGNVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILISEKVVQE
GSBact       SQKPVVRTGQKLEKGDVLADGPSTENGELALGKNVLVAFMPWRGYNFEDAIVLSERLVYD
CFBbact      NLKPIVRVGDRVTKGQVLCEGYATDNGELALGRNMKVAFMPWKGYNFEDAIVISERVVKD
ORFxxx0      ------------------------------------------------------------
GNSBact      NQHAVINKGQKIEAGQVLADSSATENGELALGQNCVVAFMSWQGFNYEDAIILSERLVRE
                                                                         
Prim.cons.   NQKPIVKVGDRVEKG222ADGPSTDNGELALG2NVLVAFMPWNGYNFEDAILLSERLVKE

                   1090      1100      1110      1120      1130      1140
                      |         |         |         |         |         |
Mycoplasma   DRFTSIHIDEYTLEVRNTKQGQEEVTREIPNMSEQAKRHLDAEGIVAIGTEVKVGDVLVG
EUCARYOTE    DVYTSIHIEKYETETRQTKLGIEEITREIPNVNEYSLRNLDEKGIVSVGSWIKGGDILVG
EUBact       DYFTSIHIEEYECDSRDTKLGPEEITRDIPNVGEEVLKDLDDRGIIRVGAEVRPGDILVG
GramBact     DVLSSIHIEEHEVDARDTKLGPEEITRDIPNVAEEVLADLDERGIIRIGAEVSPGDVLVG
ProteoBact   DVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEALKNLDEAGIVYIGAEVRAGDILVG
CyanoBact    DVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEALKNLDEAGIVYIGAEVRAGDILVG
Enterobact   DRFTTIHIQELACISRDTKLGSEEITSDIPNVGEAALSKLDESGIVYIGAEVNGGDILVG
GSBact       DVFTSIHIHEFEANVRDTKRGEEQFTRDIYNVSEDALRNLDENGIIRIGAEVKERDILVG
CFBbact      DILTSVHIDEYSLEVRDTKLGNEELTSDIPNVSEEATKDLDEHGMIRIGAEIKPGDILIG
ORFxxx0      ------------------------------------------------------------
GNSBact      DAFTSIHITKHELEAHDTKLGGEEITRDIPNVGEESLRELDEDGIIRIGAEVGPDDILVG
                                                                         
Prim.cons.   DVFTSIHIEEYE2EARDTKLGPEEITRDIPNVSEEAL2NLDE2GI2RIGAEVKPGDILVG

                   1150      1160      1170      1180      1190      1200
                      |         |         |         |         |         |
Mycoplasma   KVTPKGQVQLSPEDKLLHAIFGEKSRNVKDNSLRVPNGGEGIVQSIKRFKAKS-------
EUCARYOTE    KVAPKAESDQPPEGKLLKAIFGEKNRDVRDTSLRMPSGEKGRIVDVRIFIREFG------
EUBact       KVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEAGKIVDVKVFS----------
GramBact     KVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFS----------
ProteoBact   KITPKGESPMTPEEKLLRAIFGEKASDVRDTSLRVPPGVQGTIVEVRVFNR-------HG
CyanoBact    KITPKGESPMTPEEKLLRAIFGEKASDVRDTSLRVPPGVQGTIVEVRVFNR-------HG
Enterobact   KVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVLGTVIDVQIFTR-------DG
GSBact       KITPKGESDPTPEEKLLRAIFGDKSSDVKDASMHVPAGMKGIVIKTKLFSR----KKKVG
CFBbact      KITPKGESDPTPEEKLLRAIFGDKAGDVKDASLKASPSLNGVVIDKKLFTRAVKDKRKRA
ORFxxx0      ------------------------------------------------------------
GNSBact      KITPKGETELSAEEKLLRAIFGEKAREVKDTSLRMPHGEWGKVINVRVFSR---------
                                                                         
Prim.cons.   K2TPKGES2LTPEEKLLRAIFGEKARDV2DTSLRVP2GE2G2VIDVRVFSR332DK2KHG

                   1210      1220      1230      1240      1250      1260
                      |         |         |         |         |         |
Mycoplasma   ------------------------------------------------------------
EUCARYOTE    --------------------------------------E---------------------
EUBact       ----------------R---------------------E---------------------
GramBact     ----------------R---------------------E---------------------
ProteoBact   VDKDERALAIEREEIERLAKDRDDEQAILDRNVYGRLADLLENRQGIAGPKGFKKDTKIT
CyanoBact    VDKDERALAIEREEIERLAKDRDDEQAILDRNVYGRLADLLENRQGIAGPKGFKKDTKIT
Enterobact   VKKDKRALEIEEMQLKQAKKDLTEEQKVFELGLFTQIKSTLIN-------------SGMN
GSBact       LDIRERQEAIDALFERRTADLRSRFNTWMNQLFEGKKSTGIYNLKGKEIVPAGSVLDAET
CFBbact      QDKQE-IDALEGNFQIKFEDLRNRLIDKLFGIVGGKTAQGVQNDLGEDTLPKGKKYTLKM
ORFxxx0      ------------------------------------------------------------
GNSBact      ------------------------------------------------------------
                                                                         
Prim.cons.   VDKDERALAIERE2IERLAKDRD2EQAILDRNVYG2LAE2LENRQGIAGP2G2KKDTKIT

                   1270      1280      1290      1300      1310      1320
                      |         |         |         |         |         |
Mycoplasma   ---------------------------------------------------ALNPDGIEL
EUCARYOTE    ---------------------------------------------------MLYPG----
EUBact       -------------------------------------------------------NGDEL
GramBact     -------------------------------------------------------DGDEL
ProteoBact   RSVLEEYPKSQWWLFAS---PNDKLMAEIEAMRKQYDESKKGLEQRFLDKVEKLQRGDEL
CyanoBact    RSVLEEYPKSQWWLFAS---PNDKLMAEIEAMRKQYDESKKGLEQRFLDKVEKLQRGDEL
Enterobact   IDQLNKIPKSELFKVKV---TNNLYQKKIHKLFLKYEELKKCFNKKLETTRNKITQGDDL
GSBact       LGKFAGPGFLESVDLSKGIVKDAKANATLLRLCREYRLMLKDMEDERENEKYKLNIGDEL
CFBbact      LNSVEDFSHLTKGTWTT----DKGTNALVADLLHNYKIKQNDLQGNLRREKFTITVGDEL
ORFxxx0      ------------------------------------------------------------
GNSBact      ------------------------------------------------------ENGDDL
                                                                         
Prim.cons.   2SVLEEYPKS2WWLFASGIVPNDKL2AEIEALRKQYDESKK2LEQR22D22EKL33GDEL

                   1330      1340      1350      1360      1370      1380
                      |         |         |         |         |         |
Mycoplasma   PADIIEVIKVYVVQKRKIQEGDKMSGRHGNKGIISRILPIEDMPHLEDGTPVDIILNPQG
EUCARYOTE    ANTANTIVRIYIAQKRKIQVGDKMAGRHGNKGIISKILPRQDMPYLPDGTPIDIILNPLG
EUBact       APGVNQLVRCYIAQKRKISQGDKMAGRHGNKGVISRIMAEAEMPYLPDGTPVEIVLNPLG
GramBact     PPGVNELVRVYVAQKRKITDGDKLAGRHGNKGVIAKILPQEDMPFLEDGTPVDIVLNPHG
ProteoBact   PPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSKIVPIEDMPFLEDGTHADIVLNPLG
CyanoBact    PPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSKIVPIEDMPFLEDGTHADIVLNPLG
Enterobact   APGVLKIVKVYLAVKRHIQPGDKMAGRHGNKGVISKINPIEDMPYDQNGLPVDVVLNPLG
GSBact       PPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKILPIEDLPFMGDGTPVDIVLNPLG
CFBbact      PSGILKLAKIYVAKKRKLKVGDKMAGRHGNKGIVAKIVREEDMPFLDDGTPVDIVLNPLG
ORFxxx0      ------------------------------------------------------------
GNSBact      PARVNKWVQVWVAQKRKVSVGDKLAGRHGNKGVISIIAPVEDMPYLPDGTPVDVVLNPIG
                                                                         
Prim.cons.   PPGVNKLVKVYVAQKRKIQVGDKMAGRHGNKGVISKILPIEDMPFLEDGTPVDIVLNPLG

                   1390      1400      1410      1420      1430      1440
                      |         |         |         |         |         |
Mycoplasma   VPSRMNIGQILEIHLGMAAKKLN-------------QKVITPVF----------------
EUCARYOTE    VPSRMNVGQVYECLLGWAAEHLG-------------VRFKLIPF----------------
EUBact       VPSRMNIGQVLECHLGWASKN----IDRG-------LLADGEPS----------------
GramBact     VPRRMNIGQILETHLGWVAKTG-WQVDAGTEDWKERLRGIGADS----------------
ProteoBact   VPSRMNVGQILETHLGWACAGLGRRIGQAVDAYLASTKQETKPL----------------
CyanoBact    VPSRMNVGQILETHLGWACAGLGRRIGQAVDAYLASTKQETKPL----------------
Enterobact   VPSRMNIGQILETHLGLASKGLGNIIDTMLKQQKSILNIRKFIQ----------------
GSBact       VPSRMNIGQLYETSLGWAARALG-------------VQFK--------------------
CFBbact      VPSRMNIGQIYETVLGWAGQKLG-------------KKFA--------------------
ORFxxx0      --------QVLQGSLKEKG-----------FD--KDKLWSDAVS----------------
GNSBact      VPSRMNLGQILETHLGWAGHLLGFRVATPVFDGADDTAIEDALARSWLSAKAGATDMSPE
                     *: :  *                                             
Prim.cons.   VPSRMNIGQILETHLGWAAKGLGRRID22V2DY2A22KFETAPSRSWLSAKAGATDMSPE

                   1450      1460      1470      1480      1490      1500
                      |         |         |         |         |         |
Mycoplasma   EG------------------------------LNE--------KELEEIMAEAGMTN---
EUCARYOTE    DER--------------------------FGKQASRTFIHEKLKEAKELTNKNWLFNS--
EUBact       GER--------------------------GIRVATPVFDGATEEDIYEFLTQAR------
GramBact     STP--------------------------GTNVATPVFDGAREEEITGLLDST-------
ProteoBact   KET------------------------LKKVYGDNETIKSLNDHELVELGRNLSRGVPIA
CyanoBact    KET------------------------LKKVYGDNETIKSLNDHELVELGRNLSRGVPIA
Enterobact   KAFN-----------------------LGNNTRQKTNLNNFSDDEILSLAKNFKNGIPIS
GSBact       ---------------------------------T-PIFDGATYTEVQEQLEKAG------
CFBbact      ---------------------------------T-PIFDGATLDQINELTDEAG------
ORFxxx0      NR-----------------------------GTARQACMQIWLKDYCNFDASKLKPTEVM
GNSBact      NKRPSTDTAKAVEWIKQQGFDGKKVFDERHPGLAKEVSLKLWLKDMG-VDASSLSGAELE
                                                         :      .        
Prim.cons.   KER2STDTAKAVEWIKQQGFDGKKVFDLK2V23A3P2FDGATLKEIVELLA2AGRG2PIA

                   1510      1520      1530      1540      1550      1560
                      |         |         |         |         |         |
Mycoplasma   -------------------------YGKVTLIDGQTGEPFDKPIAVGVMYMLKLSHMVDD
EUCARYOTE    --N-H--------------------PGKIQLFDGRTGESFDNPIMVGKAYMLKLVHLVDD
EUBact       LPELAETAMSDARTEHMREIFPSIPLGKTILFDGRTGEPFDNPITVGYMYVLKLAHLVDD
GramBact     LPNRDGVQLIGS-------S------GKATLFDGRTGEPYPYPVAVGYIYILKLLHLVDD
ProteoBact   TPVFDGAKETDIEQMLELAGMDRS--GQSTVYDGRTGDPFDRKVTVGYIYMLKLHHLVDD
CyanoBact    TPVFDGAKETDIEQMLELAGMDRS--GQSTVYDGRTGDPFDRKVTVGYIYMLKLHHLVDD
Enterobact   TPVFDGAQESEIKALLKLADLPSS--GQITLFDGRTGEKFERPVTVGYMYMLKLNHLVDD
GSBact       LPMHG----------------------KVRLYDGRTGEPFDDEVTVGYIYMLKLSHLVDD
CFBbact      IPRFG----------------------HTYLFDGGTGERFDQPATVGVIYMLKLGHMIED
ORFxxx0      QKCLSVSRENN---------LSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVED
GNSBact      KKAYEVSSQSR---------LPSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVED
                                        :  : ** **  :     **  *:*** *:::*
Prim.cons.   2PVFDGA2ESDIEQMLELAGLPSSI5GKSTLFDGRTGEPFD2PVTVGYIYMLKL3HLVDD

                   1570      1580      1590      1600      1610      1620
                      |         |         |         |         |         |
Mycoplasma   KIHARNVGPYSLITQQPLGGKAQNGGQRFGEMEVWALEAYGAAHTLREILTIKSDDIKGR
EUCARYOTE    KIHARSTGPYSLITQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQEILTIKSDDMLGR
EUBact       KIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGR
GramBact     KIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVVGR
ProteoBact   KIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGR
CyanoBact    KIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGR
Enterobact   KMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGR
GSBact       KIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAANILREMLTVKSDDVVGR
CFBbact      KMHARSIGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGASATLREILTVKSDDVVGR
ORFxxx0      KIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGR
GNSBact      KVHARATGPYSLISQQPLGGKAQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGR
             *:***  *.**:::********* ************: *:.::  *:*:**:****: **
Prim.cons.   KIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVVGR

                   1630      1640      1650      1660      1670      1680
                      |         |         |         |         |         |
Mycoplasma   SKTYEAIVRSKRIPEPGIPESFNVLSKEIMGLGFNMYMIDETGEKSAINAYDKKDFEIDN
EUCARYOTE    NEALKAIVKGKAIPRPGIPESFKVLMRELQALCLDVVAYKIQNG----DQDECEALAID-
EUBact       VKTYEAIVKGENIPEPGVPESFKVLIKELQSLGLDVKILSEDEREIEIKEVEEDVAETA-
GramBact     VKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDGVQIEMRDTDEDVFRAA-
ProteoBact   TKVYEAIVRGDDTFEAGIPESFNVLVKEMRSLGLNVDLHNSKIGDMMPTSEAAE------
CyanoBact    TKVYEAIVRGDDTFEAGIPESFNVLVKEMRSLGLNVDLHNSKIGDMMPTSEAAE------
Enterobact   TKMYKNIVDGNYKMEPGMPESFNVLLKEIRSLAINIELENE-------------------
GSBact       NKTYESIVKGQNLPDPGTPESFNVLVRELQGLGLEIRIDNKVP-----------------
CFBbact      AKTYEAIVKGEPMPEPGLPESFNVLMHELKGLGLDIRLEE--------------------
ORFxxx0      VKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLSVELLNEDI------DKYAEIEKVDQ
GNSBact      AKAYESIVKGEDVIQPGVPESFKVLVKELQSLGLAVEVINEEVK-IAPSEKVAALTEANL
              :  : ** ..    .* ****:** :*: .* : :   .                    
Prim.cons.   2KTYEAIVKGE2IPEPGIPESFNVLVKELQSLGLNVELLNEDIGDI3PT323AEVFE2D3

                   1690      1700      1710      1720      1730
                      |         |         |         |         |
Mycoplasma   ---YDDEILIKTDNLYIDDQDVDAEFEDLTYVDENDILNSFELDNEEE-----
EUCARYOTE    ---LSGSLATPIDNIIKEVIQQEELGEELTS----------------------
EUBact       ---KELGIDIQGEERPEADNVPSPVAEESDDEEDLDFAAGFLQDALDELEEE-
GramBact     ---EELGIDLSRRE-------PSSVEEV-------------------------
ProteoBact   -----------------------------------------------------
CyanoBact    -----------------------------------------------------
Enterobact   -----------------------------------------------------
GSBact       -----------------------------------------------------
CFBbact      -----------------------------------------------------
ORFxxx0      --DESISTSIGWDDISE--EPLELLEIEELNLND-DSNLIVEEEESEESKEIE
GNSBact      PGSEDVSAEILPETLYAGAEDIEDSMMSVIDTDDQDLAMSSNDEEVSENDERS
                                                                         
Prim.cons.   PG2E3LSIDI66D22YE4DEDPE62EEELTD4DD3D4A4SFE42E4EE33E32       

BLAST

1)Nous avons effectué un blastp contre swissprot.
Sequences producing significant alignements:                        (Bits)  Value

gi|88909133|sp|Q3Z8V4|RPOB_DEHE1  DNA-directed RNA polymerase ...   260    4e-69  Gene info
gi|88909134|sp|Q3ZX01|RPOB_DEHSC  DNA-directed RNA polymerase ...   258    2e-68  Gene info
gi|88909127|sp|Q3A9Q7|RPOB_CARHZ  DNA-directed RNA polymerase ...   222    9e-58  Gene info
gi|108884786|sp|Q2JFI5|RPOB_FRASC  DNA-directed RNA polymerase...   220    4e-57
gi|109904224|sp|Q2RFN9|RPOB_MOOTA  DNA-directed RNA polymerase...   219    8e-57
gi|88909644|sp|Q47LI5|RPOB_THEFY  DNA-directed RNA polymerase ...   216    4e-56  Gene info
gi|81387938|sp|Q67JT3|RPOB_SYMTH  DNA-directed RNA polymerase ...   214    2e-55
gi|75358070|sp|Q5FM97|RPOB_LACAC  DNA-directed RNA polymerase ...   214    3e-55
gi|41017975|sp|Q82DQ5|RPOB_STRAW  DNA-directed RNA polymerase ...   213    4e-55
gi|41018149|sp|Q9L0L0|RPOB_STRCO  DNA-directed RNA polymerase ...   213    4e-55
gi|88909131|sp|Q4JT32|RPOB_CORJK  DNA-directed RNA polymerase ...   213    6e-55  Gene info
gi|61234284|sp|P0A680|RPOB_MYCTU  DNA-directed RNA polymerase ...   213    6e-55
gi|41018079|sp|Q8R7U6|RPOB_THETN  DNA-directed RNA polymerase ...   213    6e-55
gi|41017721|sp|Q890N4|RPOB_CLOTE  DNA-directed RNA polymerase ...   213    6e-55
gi|88909143|sp|Q73SE4|RPOB_MYCPA  DNA-directed RNA polymerase ...   213    7e-55
gi|81668275|sp|Q74L95|RPOB_LACJO  DNA-directed RNA polymerase ...   213    8e-55
gi|13124539|sp|Q9Z9M2|RPOB_BACHD  DNA-directed RNA polymerase ...   212    9e-55
gi|81367464|sp|Q5WLS0|RPOB_BACSK  DNA-directed RNA polymerase ...   212    1e-54  Gene info
gi|41017692|sp|Q81VT8|RPOB_BACAN  DNA-directed RNA polymerase ...   211    2e-54
gi|41017600|sp|P60281|RPOB2_MYCSM  DNA-directed RNA polymerase...   211    3e-54
gi|82581604|sp|Q4L3K3|RPOB_STAHJ  DNA-directed RNA polymerase ...   211    3e-54  Gene info
gi|41017761|sp|Q8NT26|RPOB_CORGL  DNA-directed RNA polymerase ...   210    3e-54
gi|41017690|sp|Q81J48|RPOB_BACCR  DNA-directed RNA polymerase ...   210    3e-54  Gene info
gi|41017740|sp|Q8FS97|RPOB_COREF  DNA-directed RNA polymerase ...   210    3e-54
gi|81397480|sp|Q6HPR6|RPOB_BACHK  DNA-directed RNA polymerase ...   210    4e-54
gi|81667235|sp|Q65PB5|RPOB_BACLD  DNA-directed RNA polymerase ...   210    4e-54  Gene info
gi|82581605|sp|Q49V52|RPOB_STAS1  DNA-directed RNA polymerase ...   210    5e-54  Gene info
gi|88909122|sp|Q6MJ09|RPOB_BDEBA  DNA-directed RNA polymerase ...   210    5e-54
gi|41017768|sp|Q8UE08|RPOB_AGRT5  DNA-directed RNA polymerase ...   210    5e-54  Gene info
gi|20139537|sp|Q92F22|RPOB_LISIN  DNA-directed RNA polymerase ...   209    7e-54
gi|20139600|sp|Q97EG9|RPOB_CLOAB  DNA-directed RNA polymerase ...   209    7e-54
gi|41017599|sp|P60280|RPOB_CORDI  DNA-directed RNA polymerase ...   209    8e-54
gi|20139836|sp|Q9RLT9|RPOB_LISMO  DNA-directed RNA polymerase ...   209    8e-54
gi|13432231|sp|P30760|RPOB_MYCLE  DNA-directed RNA polymerase ...   209    8e-54
gi|81348402|sp|Q5L405|RPOB_GEOKA  DNA-directed RNA polymerase ...   209    9e-54
gi|88909623|sp|Q3SSY0|RPOB_NITWN  DNA-directed RNA polymerase ...   209    1e-53  Gene info
gi|41018015|sp|Q8CQ84|RPOB_STAES  DNA-directed RNA polymerase ...   209    1e-53  Gene info
gi|41017783|sp|Q98N66|RPOB_RHILO  DNA-directed RNA polymerase ...   208    1e-53
gi|81373140|sp|Q5YPE0|RPOB2_NOCFA  DNA-directed RNA polymerase...   208    2e-53
gi|41017808|sp|Q9L637|RPOB_AMYMD  DNA-directed RNA polymerase ...   208    2e-53
gi|109904152|sp|Q2W2I1|RPOB_MAGMM  DNA-directed RNA polymerase...   207    2e-53
gi|109914403|sp|Q2JJ19|RPOB_SYNJB  DNA-directed RNA polymerase...   207    2e-53
gi|41018106|sp|Q92QH7|RPOB_RHIME  DNA-directed RNA polymerase ...   207    2e-53
gi|20139579|sp|Q93R88|RPOB_CLOPE  DNA-directed RNA polymerase ...   207    2e-53
gi|81390570|sp|Q6ACX5|RPOB_LEIXX  DNA-directed RNA polymerase ...   207    2e-53
gi|41017724|sp|Q89J74|RPOB_BRAJA  DNA-directed RNA polymerase ...   207    2e-53
gi|81695152|sp|Q5HID3|RPOB_STAAC  DNA-directed RNA polymerase ...   207    3e-53  Gene info
gi|56749585|sp|Q6GJC6|RPOB_STAAR  DNA-directed RNA polymerase ...   207    3e-53  Gene info
gi|41017889|sp|P60278|RPOB_STAAN  DNA-directed RNA polymerase ...   207    3e-53  Gene info
gi|41018107|sp|Q932F8|RPOB_STAAM  DNA-directed RNA polymerase ...   207    3e-53  Gene info
gi|81373434|sp|Q5YQP4|RPOB1_NOCFA  DNA-directed RNA polymerase...   207    4e-53
gi|41017622|sp|Q50388|RPOB1_MYCSM  DNA-directed RNA polymerase...   207    4e-53
gi|41017805|sp|Q9KJG4|RPOB_BARHE  DNA-directed RNA polymerase ...   206    5e-53
gi|41017790|sp|Q9CEN6|RPOB_LACLA  DNA-directed RNA polymerase ...   206    6e-53
gi|109914402|sp|Q2JX64|RPOB_SYNJA  DNA-directed RNA polymerase...   206    7e-53
gi|51338825|sp|Q9KJM5|RPOB_BARQU  DNA-directed RNA polymerase ...   206    7e-53
gi|81348897|sp|Q5LMQ5|RPOB_SILPO  DNA-directed RNA polymerase ...   206    7e-53
gi|88909140|sp|Q38UQ2|RPOB_LACSS  DNA-directed RNA polymerase ...   206    8e-53  Gene info
gi|109914404|sp|Q31N17|RPOB_SYNP7  DNA-directed RNA polymerase...   205    1e-52
gi|88909635|sp|Q3J5T0|RPOB_RHOS4  DNA-directed RNA polymerase ...   205    1e-52  Gene info
gi|81561186|sp|Q5MZ23|RPOB_SYNP6  DNA-directed RNA polymerase ...   205    1e-52  Gene info
gi|41017700|sp|Q82Z40|RPOB_ENTFA  DNA-directed RNA polymerase ...   205    1e-52
gi|81611188|sp|Q6A6K6|RPOB_PROAC  DNA-directed RNA polymerase ...   205    2e-52
gi|109914389|sp|Q2RQV3|RPOB_RHORT  DNA-directed RNA polymerase...   204    2e-52
gi|41017775|sp|Q8YHP8|RPOB_BRUME  DNA-directed RNA polymerase ...   204    2e-52
gi|41017741|sp|Q8G069|RPOB_BRUSU  DNA-directed RNA polymerase ...   204    2e-52
gi|81562131|sp|Q6N4R9|RPOB_RHOPA  DNA-directed RNA polymerase ...   204    2e-52
gi|30173235|sp|P59642|RPOB_TROW8  DNA-directed RNA polymerase ...   204    2e-52
gi|30179895|sp|Q93GF2|RPOB_TROWT  DNA-directed RNA polymerase ...   204    2e-52
gi|109914401|sp|Q2LQ87|RPOB_SYNAS  DNA-directed RNA polymerase...   204    3e-52
gi|109904624|sp|Q3B1H7|RPOB_PELLD  DNA-directed RNA polymerase...   204    3e-52
gi|81355250|sp|Q5NPK5|RPOB_ZYMMO  DNA-directed RNA polymerase ...   204    3e-52
gi|88909139|sp|Q5FTX7|RPOB_GLUOX  DNA-directed RNA polymerase ...   204    3e-52
gi|41017743|sp|Q8GCR3|RPOB4_ENTFC  DNA-directed RNA polymerase...   203    6e-52
gi|41017735|sp|Q8ETY8|RPOB_OCEIH  DNA-directed RNA polymerase ...   202    8e-52
gi|41017742|sp|Q8G514|RPOB_BIFLO  DNA-directed RNA polymerase ...   202    9e-52
gi|30248018|sp|P59643|RPOB_TROWH  DNA-directed RNA polymerase ...   202    1e-51
gi|20139789|sp|Q9KWU7|RPOB_THEAQ  DNA-directed RNA polymerase ...   202    1e-51
gi|88909128|sp|Q3ATP5|RPOB_CHLCH  DNA-directed RNA polymerase ...   202    1e-51  Gene info
gi|41017786|sp|Q9AAU2|RPOB_CAUCR  DNA-directed RNA polymerase ...   202    1e-51
gi|585920|sp|P37870|RPOB_BACSU  DNA-directed RNA polymerase be...   202    1e-51
gi|41017746|sp|Q8GCR6|RPOB1_ENTFC  DNA-directed RNA polymerase...   202    1e-51
gi|41017744|sp|Q8GCR4|RPOB2_ENTFC  DNA-directed RNA polymerase...   202    1e-51
gi|41017720|sp|Q88XZ3|RPOB_LACPL  DNA-directed RNA polymerase ...   202    1e-51
gi|1350848|sp|P47767|RPOB_SPICI  DNA-directed RNA polymerase b...   202    1e-51
gi|41017745|sp|Q8GCR5|RPOB3_ENTFC  DNA-directed RNA polymerase...   201    1e-51
gi|1350843|sp|P48119|RPOB_CYAPA  DNA-directed RNA polymerase b...   201    2e-51  Gene info
gi|2500610|sp|P77965|RPOB_SYNY3  DNA-directed RNA polymerase b...   201    2e-51  Gene info
gi|81313502|sp|Q5L897|RPOB_BACFN  DNA-directed RNA polymerase ...   201    2e-51  Gene info
gi|41017794|sp|Q9F3X8|RPOB_PORCN  DNA-directed RNA polymerase ...   201    2e-51
gi|88909625|sp|Q4FLL2|RPOB_PELUB  DNA-directed RNA polymerase ...   201    3e-51  Gene info
gi|41017641|sp|Q7NIA0|RPOB_GLOVI  DNA-directed RNA polymerase ...   201    3e-51
gi|41017813|sp|Q9X6Y1|RPOB_AQUPY  DNA-directed RNA polymerase ...   201    3e-51
gi|81378217|sp|Q5ZYQ0|RPOB_LEGPH  DNA-directed RNA polymerase ...   201    3e-51  Gene info
gi|81369318|sp|Q5WZL9|RPOB_LEGPL  DNA-directed RNA polymerase ...   201    3e-51  Gene info
gi|41017593|sp|O86094|RPOB_LEGPN  DNA-directed RNA polymerase ...   201    3e-51
gi|41018021|sp|Q8D233|RPOB_WIGBR  DNA-directed RNA polymerase ...   200    3e-51  Gene info
gi|6226042|sp|O67762|RPOB_AQUAE  DNA-directed RNA polymerase b...   200    3e-51
gi|81405493|sp|Q72HM5|RPOB_THET2  DNA-directed RNA polymerase ...   200    4e-51  Gene info
gi|41018085|sp|Q8RQE9|RPOB_THET8  DNA-directed RNA polymerase ...   200    4e-51  Gene info
gi|1710671|sp|P51252|RPOB_PORPU  DNA-directed RNA polymerase b...   200    4e-51  Gene info
gi|41017727|sp|Q8A469|RPOB_BACTN  DNA-directed RNA polymerase ...   200    5e-51
gi|109904721|sp|Q1XDN5|RPOB_PORYE  DNA-directed RNA polymerase...   200    5e-51
gi|109904495|sp|Q2GCD7|RPOB_NOVAD  DNA-directed RNA polymerase...   199    6e-51
gi|88909646|sp|Q5E238|RPOB_VIBF1  DNA-directed RNA polymerase ...   199    6e-51
gi|730609|sp|P41184|RPOB_BUCAP  DNA-directed RNA polymerase be...   199    6e-51
gi|41018037|sp|Q8E239|RPOB_STRA5  DNA-directed RNA polymerase ...   199    7e-51
gi|41018025|sp|Q8DL55|RPOB_SYNEL  DNA-directed RNA polymerase ...   199    8e-51
gi|41018064|sp|Q8K8W3|RPOB_STRP3  DNA-directed RNA polymerase ...   199    8e-51
gi|41018073|sp|Q8P2Y3|RPOB_STRP8  DNA-directed RNA polymerase ...   199    8e-51
gi|41017697|sp|Q82T75|RPOB_NITEU  DNA-directed RNA polymerase ...   199    9e-51
gi|41018043|sp|Q8EK74|RPOB_SHEON  DNA-directed RNA polymerase ...   199    9e-51
gi|81393894|sp|Q6FF90|RPOB_ACIAD  DNA-directed RNA polymerase ...   199    1e-50  Gene info
gi|41018125|sp|Q9A1U1|RPOB_STRP1  DNA-directed RNA polymerase ...   199    1e-50
gi|115305555|sp|Q2II86|RPOB_ANADE  DNA-directed RNA polymerase...   199    1e-50
gi|41017716|sp|Q889X8|RPOB_PSESM  DNA-directed RNA polymerase ...   198    1e-50
gi|41017753|sp|Q8KG15|RPOB_CHLTE  DNA-directed RNA polymerase ...   198    1e-50
gi|115305557|sp|Q3M5D0|RPOB_ANAVT  DNA-directed RNA polymerase...   198    1e-50
gi|88909632|sp|Q3K5Y1|RPOB_PSEPF  DNA-directed RNA polymerase ...   198    2e-50  Gene info
gi|88909630|sp|Q4K526|RPOB_PSEF5  DNA-directed RNA polymerase ...   198    2e-50  Gene info
gi|31340404|sp|Q89B20|RPOB_BUCBP  DNA-directed RNA polymerase ...   198    2e-50
gi|41017719|sp|Q88QP2|RPOB_PSEPK  DNA-directed RNA polymerase ...   198    2e-50  Gene info
gi|41017994|sp|Q87KQ4|RPOB_VIBPA  DNA-directed RNA polymerase ...   197    2e-50
gi|41017634|sp|Q7MX27|RPOB_PORGI  DNA-directed RNA polymerase ...   197    3e-50
gi|41019520|sp|Q9KV30|RPOB_VIBCH  DNA-directed RNA polymerase ...   197    3e-50
gi|81558888|sp|Q5LXV3|RPOB_STRT1  DNA-directed RNA polymerase ...   197    3e-50  Gene info
gi|81371224|sp|Q5X866|RPOB_LEGPA  DNA-directed RNA polymerase ...   197    3e-50  Gene info
gi|109903820|sp|Q39Y13|RPOB_GEOMG  DNA-directed RNA polymerase...   197    3e-50
gi|109904235|sp|Q2ST48|RPOB_MYCCT  DNA-directed RNA polymerase...   197    4e-50
gi|41018032|sp|Q8DS46|RPOB_STRMU  DNA-directed RNA polymerase ...   197    4e-50
gi|81682419|sp|Q60A06|RPOB_METCA  DNA-directed RNA polymerase ...   197    4e-50
gi|88909638|sp|Q32AF9|RPOB_SHIDS  DNA-directed RNA polymerase ...   197    4e-50  Gene info
gi|67472412|sp|P0A8V2|RPOB_ECOLI  DNA-directed RNA polymerase ...   197    4e-50
gi|41018098|sp|Q8Z320|RPOB_SALTI  DNA-directed RNA polymerase ...   196    5e-50
gi|88909636|sp|Q57H69|RPOB_SALCH  DNA-directed RNA polymerase ...   196    5e-50
gi|19855075|sp|P06173|RPOB_SALTY  DNA-directed RNA polymerase ...   196    5e-50
gi|81361175|sp|Q5PK93|RPOB_SALPA  DNA-directed RNA polymerase ...   196    5e-50
gi|12230977|sp|Q51561|RPOB_PSEAE  DNA-directed RNA polymerase ...   196    6e-50
gi|41017666|sp|Q7VKL7|RPOB_HAEDU  DNA-directed RNA polymerase ...   196    6e-50
gi|41017659|sp|Q7V5P1|RPOB_PROMM  DNA-directed RNA polymerase ...   196    6e-50  Gene info
gi|41017905|sp|Q7MGR8|RPOB_VIBVY  DNA-directed RNA polymerase ...   196    6e-50  Gene info
gi|2500606|sp|P78013|RPOB_MYCPN  DNA-directed RNA polymerase b...   196    6e-50
gi|11134500|sp|P57146|RPOB_BUCAI  DNA-directed RNA polymerase ...   196    6e-50
gi|41018028|sp|Q8DNF0|RPOB_STRR6  DNA-directed RNA polymerase ...   196    6e-50  Gene info
gi|81391714|sp|Q6F0L7|RPOB_MESFL  DNA-directed RNA polymerase ...   196    7e-50
gi|81398906|sp|Q6LLW2|RPOB_PHOPR  DNA-directed RNA polymerase ...   196    7e-50
gi|109914406|sp|Q3AHX5|RPOB_SYNSC  DNA-directed RNA polymerase...   196    7e-50
gi|109914405|sp|Q3AZA4|RPOB_SYNS9  DNA-directed RNA polymerase...   196    8e-50
gi|41018113|sp|Q97NQ7|RPOB_STRPN  DNA-directed RNA polymerase ...   196    8e-50
gi|88909130|sp|Q47UV9|RPOB_COLP3  DNA-directed RNA polymerase ...   196    8e-50  Gene info
gi|81642549|sp|Q6AP78|RPOB_DESPS  DNA-directed RNA polymerase ...   196    9e-50
gi|81357338|sp|Q5P339|RPOB_AZOSE  DNA-directed RNA polymerase ...   196    1e-49  Gene info
gi|81701325|sp|Q748Y6|RPOB_GEOSL  DNA-directed RNA polymerase ...   195    1e-49
gi|88909628|sp|Q48D29|RPOB_PSE14  DNA-directed RNA polymerase ...   195    2e-49  Gene info
gi|75500409|sp|Q4ZMN7|RPOB_PSEU2  DNA-directed RNA polymerase ...   195    2e-49  Gene info
gi|81336482|sp|Q4QN33|RPOB_HAEI8  DNA-directed RNA polymerase ...   195    2e-49  Gene info
gi|1173148|sp|P43738|RPOB_HAEIN  DNA-directed RNA polymerase b...   195    2e-49
gi|548824|sp|P29398|RPOB_THEMA  DNA-directed RNA polymerase be...   194    2e-49
gi|109904478|sp|Q2YB05|RPOB_NITMU  DNA-directed RNA polymerase...   194    2e-49
gi|41017774|sp|Q8XUZ8|RPOB_RALSO  DNA-directed RNA polymerase ...   194    2e-49
gi|88909627|sp|Q46J22|RPOB_PROMT  DNA-directed RNA polymerase ...   194    2e-49  Gene info
gi|88909634|sp|Q46WD4|RPOB_RALEJ  DNA-directed RNA polymerase ...   194    2e-49  Gene info
gi|20141699|sp|P22703|RPOB_ANASP  DNA-directed RNA polymerase ...   194    2e-49  Gene info
gi|1350845|sp|P47583|RPOB_MYCGE  DNA-directed RNA polymerase b...   194    3e-49
gi|88909633|sp|Q4FQH3|RPOB_PSYAR  DNA-directed RNA polymerase ...   194    3e-49
gi|88909624|sp|Q3A6Q4|RPOB_PELCD  DNA-directed RNA polymerase ...   193    4e-49  Gene info
gi|41018148|sp|Q9KW14|RPOB_SHEVI  DNA-directed RNA polymerase ...   193    4e-49
gi|109914396|sp|Q2NWR6|RPOB_SODGM  DNA-directed RNA polymerase...   193    4e-49
gi|81400331|sp|Q6MRX6|RPOB_MYCMS  DNA-directed RNA polymerase ...   193    5e-49
gi|109914407|sp|Q31IY9|RPOB_THICR  DNA-directed RNA polymerase...   193    5e-49
gi|109914393|sp|Q2S1Q5|RPOB_SALRD  DNA-directed RNA polymerase...   193    5e-49
gi|41017809|sp|Q9RVV9|RPOB_DEIRA  DNA-directed RNA polymerase ...   193    6e-49
gi|41018099|sp|Q8ZAP5|RPOB_YERPE  DNA-directed RNA polymerase ...   193    6e-49
gi|13878753|sp|Q9MUS5|RPOB_MESVI  DNA-directed RNA polymerase ...   193    6e-49  Gene info
gi|1350847|sp|P49466|RPOB_ODOSI  DNA-directed RNA polymerase b...   193    6e-49  Gene info
gi|41017924|sp|Q7U8K4|RPOB_SYNPX  DNA-directed RNA polymerase ...   193    6e-49  Gene info
gi|41017672|sp|Q7VRP7|RPOB_BLOFL  DNA-directed RNA polymerase ...   193    6e-49  Gene info
gi|73917873|sp|Q72UA8|RPOB_LEPIC  DNA-directed RNA polymerase ...   193    6e-49
gi|41017737|sp|Q8F0S2|RPOB_LEPIN  DNA-directed RNA polymerase ...   193    6e-49
gi|68053109|sp|Q6B8R8|RPOB_GRATL  DNA-directed RNA polymerase ...   192    7e-49  Gene info
gi|88909123|sp|Q492B9|RPOB_BLOPB  DNA-directed RNA polymerase ...   192    7e-49  Gene info
gi|41017640|sp|Q7N9A4|RPOB_PHOLL  DNA-directed RNA polymerase ...   192    8e-49
gi|114153758|sp|Q2L2M3|RPOB_BORA1  DNA-directed RNA polymerase...   192    8e-49
gi|41017677|sp|Q7W2G9|RPOB_BORPA  DNA-directed RNA polymerase ...   192    9e-49
gi|88909135|sp|Q30X05|RPOB_DESDG  DNA-directed RNA polymerase ...   192    9e-49  Gene info
gi|41017684|sp|Q7WRD9|RPOB_BORBR  DNA-directed RNA polymerase ...   192    9e-49
gi|41017646|sp|Q7NQE6|RPOB_CHRVO  DNA-directed RNA polymerase ...   192    1e-48
gi|41017676|sp|Q7W0R9|RPOB_BORPE  DNA-directed RNA polymerase ...   192    1e-48
gi|115305560|sp|Q2SU19|RPOB_BURTA  DNA-directed RNA polymerase...   192    1e-48
gi|81378946|sp|Q63Q03|RPOB_BURPS  DNA-directed RNA polymerase ...   192    1e-48
gi|133418|sp|P19175|RPOB_PSEPU  DNA-directed RNA polymerase be...   192    1e-48
gi|41017927|sp|Q7URW6|RPOB_RHOBA  DNA-directed RNA polymerase ...   192    1e-48
gi|88909631|sp|Q3ILP9|RPOB_PSEHT  DNA-directed RNA polymerase ...   192    1e-48  Gene info
gi|88909137|sp|Q4G3A7|RPOB_EMIHU  DNA-directed RNA polymerase ...   191    2e-48
gi|81646553|sp|Q6DAN0|RPOB_ERWCT  DNA-directed RNA polymerase ...   191    2e-48
gi|41017655|sp|Q7V006|RPOB_PROMP  DNA-directed RNA polymerase ...   191    2e-48  Gene info
gi|109904738|sp|Q318Q7|RPOB_PROM9  DNA-directed RNA polymerase...   191    2e-48
gi|6094123|sp|O78485|RPOB_GUITH  DNA-directed RNA polymerase b...   191    2e-48  Gene info
gi|81387641|sp|Q65W41|RPOB_MANSM  DNA-directed RNA polymerase ...   191    2e-48  Gene info
gi|41017792|sp|Q9CK91|RPOB_PASMU  DNA-directed RNA polymerase ...   191    3e-48
gi|81312570|sp|Q5L5I3|RPOB_CHLAB  DNA-directed RNA polymerase ...   190    3e-48
gi|88909645|sp|Q3SLQ6|RPOB_THIDA  DNA-directed RNA polymerase ...   190    4e-48  Gene info
gi|88909132|sp|Q47JB0|RPOB_DECAR  DNA-directed RNA polymerase ...   190    5e-48  Gene info
gi|41017755|sp|Q8KWX4|RPOB_ANAMA  DNA-directed RNA polymerase ...   190    5e-48
gi|6831647|sp|O84317|RPOB_CHLTR  DNA-directed RNA polymerase b...   190    5e-48
gi|7388085|sp|P56869|RPOB_CHLMU  DNA-directed RNA polymerase b...   190    5e-48
gi|88909129|sp|Q3KM47|RPOB_CHLTA  DNA-directed RNA polymerase ...   189    6e-48  Gene info
gi|81359248|sp|Q5PBG4|RPOB_ANAMM  DNA-directed RNA polymerase ...   189    6e-48  Gene info
gi|41017695|sp|Q822J1|RPOB_CHLCV  DNA-directed RNA polymerase ...   189    6e-48
gi|75497690|sp|Q5GRY9|RPOBC_WOLTR  Bifunctional DNA-directed R...   189    7e-48
gi|17369366|sp|Q9PA86|RPOB_XYLFA  DNA-directed RNA polymerase ...   189    8e-48
gi|88909147|sp|Q3J8Q7|RPOB_NITOC  DNA-directed RNA polymerase ...   189    9e-48  Gene info
gi|6647782|sp|Q9Z9A0|RPOB_CHLPN  DNA-directed RNA polymerase b...   189    9e-48
gi|81404163|sp|Q727C7|RPOB_DESVH  DNA-directed RNA polymerase ...   189    1e-47  Gene info
gi|32129997|sp|Q87A32|RPOB_XYLFT  DNA-directed RNA polymerase ...   189    1e-47  Gene info
gi|9911111|sp|Q59622|RPOB_NEIMB  DNA-directed RNA polymerase b...   189    1e-47
gi|9910857|sp|P57009|RPOB_NEIMA  DNA-directed RNA polymerase b...   189    1e-47
gi|33860205|sp|P47715|RPOB_MYCGA  DNA-directed RNA polymerase ...   189    1e-47
gi|109903916|sp|Q2S905|RPOB_HAHCH  DNA-directed RNA polymerase...   189    1e-47
gi|75355443|sp|Q5F5R5|RPOB_NEIG1  DNA-directed RNA polymerase ...   189    1e-47  Gene info
gi|41017765|sp|Q8RHI6|RPOB_FUSNN  DNA-directed RNA polymerase ...   188    1e-47
gi|115305556|sp|Q2GJ68|RPOB_ANAPZ  DNA-directed RNA polymerase...   188    2e-47
gi|88909136|sp|Q3YST5|RPOB_EHRCJ  DNA-directed RNA polymerase ...   188    2e-47  Gene info
gi|81652940|sp|Q73IW9|RPOBC_WOLPM  Bifunctional DNA-directed R...   188    2e-47
gi|81353036|sp|Q5HC05|RPOB_EHRRW  DNA-directed RNA polymerase ...   188    2e-47  Gene info
gi|75356604|sp|Q5FFD9|RPOB_EHRRG  DNA-directed RNA polymerase ...   188    2e-47  Gene info
gi|41017662|sp|Q7VA29|RPOB_PROMA  DNA-directed RNA polymerase ...   187    2e-47
gi|30581033|sp|O87903|RPOB_COXBU  DNA-directed RNA polymerase ...   187    2e-47
gi|97537056|sp|Q8KWX2|RPOB_EHRCR  DNA-directed RNA polymerase ...   187    2e-47  Gene info
gi|81627411|sp|Q6MDM1|RPOB_PARUW  DNA-directed RNA polymerase ...   187    3e-47  Gene info
gi|81610031|sp|Q661M9|RPOB_BORGA  DNA-directed RNA polymerase ...   187    5e-47
gi|14916699|sp|Q9RH43|RPOB_RICMA  DNA-directed RNA polymerase ...   186    7e-47
gi|14195191|sp|Q9TM35|RPOB_CYACA  DNA-directed RNA polymerase ...   186    7e-47  Gene info
gi|14916698|sp|Q9RH41|RPOB_RICCN  DNA-directed RNA polymerase ...   186    8e-47
gi|73917872|sp|Q9KK59|RPOB_LEPBI  DNA-directed RNA polymerase ...   186    8e-47
gi|3915861|sp|Q59191|RPOB_BORBU  DNA-directed RNA polymerase b...   186    8e-47
gi|115305558|sp|Q2NJ15|RPOB_AYWBP  DNA-directed RNA polymerase...   186    8e-47
gi|55584169|sp|P77941|RPOB_RICTY  DNA-directed RNA polymerase ...   186    9e-47
gi|88909126|sp|Q39KH5|RPOB_BURS3  DNA-directed RNA polymerase ...   186    9e-47  Gene info
gi|81362632|sp|Q5QWA5|RPOB_IDILO  DNA-directed RNA polymerase ...   186    1e-46
gi|75536057|sp|Q4UKD4|RPOB_RICFE  DNA-directed RNA polymerase ...   186    1e-46
gi|6094125|sp|O83269|RPOB_TREPA  DNA-directed RNA polymerase b...   185    1e-46
gi|88909647|sp|Q3BWZ1|RPOB_XANC5  DNA-directed RNA polymerase ...   185    1e-46  Gene info
gi|41018077|sp|Q8PNT0|RPOB_XANAC  DNA-directed RNA polymerase ...   185    2e-46
gi|6094124|sp|O52271|RPOB_RICPR  DNA-directed RNA polymerase b...   185    2e-46
gi|81402498|sp|Q6YQW3|RPOB_ONYPE  DNA-directed RNA polymerase ...   184    2e-46
gi|81304396|sp|Q4URD2|RPOB_XANC8  DNA-directed RNA polymerase ...   184    2e-46  Gene info
gi|41018075|sp|Q8PC56|RPOB_XANCP  DNA-directed RNA polymerase ...   184    2e-46
gi|75434343|sp|Q5GWS6|RPOB_XANOR  DNA-directed RNA polymerase ...   184    2e-46
gi|41018108|sp|Q93MK7|RPOB_WOLPI  DNA-directed RNA polymerase ...   183    5e-46
gi|41017710|sp|Q85FR7|RPOB_CYAME  DNA-directed RNA polymerase ...   182    9e-46
gi|41017624|sp|Q7MA56|RPOBC_WOLSU  Bifunctional DNA-directed R...   181    2e-45
gi|14195189|sp|Q9PQV6|RPOB_UREPA  DNA-directed RNA polymerase ...   180    4e-45
gi|81598038|sp|Q5NID2|RPOB_FRATT  DNA-directed RNA polymerase ...   179    6e-45
gi|548822|sp|P36440|RPOB_HETCA  DNA-directed RNA polymerase be...   179    7e-45
gi|109904440|sp|Q2GD90|RPOB_NEOSM  DNA-directed RNA polymerase...   178    2e-44
gi|41017780|sp|Q93MK8|RPOB_EHRRI  DNA-directed RNA polymerase ...   178    2e-44
gi|41017814|sp|Q9ZK23|RPOBC_HELPJ  Bifunctional DNA-directed R...   178    2e-44  Gene info
gi|41017590|sp|O25806|RPOBC_HELPY  Bifunctional DNA-directed R...   178    2e-44
gi|17433259|sp|Q9TL06|RPOB_NEPOL  DNA-directed RNA polymerase ...   177    2e-44  Gene info
gi|81411477|sp|Q73JJ7|RPOB_TREDE  DNA-directed RNA polymerase ...   177    4e-44
gi|81353964|sp|Q5HVY9|RPOB_CAMJR  DNA-directed RNA polymerase ...   176    5e-44  Gene info
gi|9297126|sp|Q46124|RPOB_CAMJE  DNA-directed RNA polymerase b...   176    5e-44
gi|41017664|sp|Q7VJ82|RPOBC_HELHP  Bifunctional DNA-directed R...   176    1e-43
gi|41017736|sp|Q8EWX1|RPOB_MYCPE  DNA-directed RNA polymerase ...   175    1e-43
gi|109914408|sp|Q30TP7|RPOB_THIDN  DNA-directed RNA polymerase...   173    4e-43
gi|109904551|sp|Q20EX1|RPOB_OLTVI  DNA-directed RNA polymerase...   173    5e-43  Gene info
gi|41017784|sp|Q98Q23|RPOB_MYCPU  DNA-directed RNA polymerase ...   168    2e-41
gi|88909142|sp|Q4A969|RPOB_MYCHJ  DNA-directed RNA polymerase ...   166    6e-41  Gene info
gi|88909629|sp|Q3ZJ93|RPOB_PSEAK  DNA-directed RNA polymerase ...   166    6e-41  Gene info
gi|88909144|sp|Q4A5S7|RPOB_MYCS5  DNA-directed RNA polymerase ...   166    9e-41  Gene info
gi|41017781|sp|Q93MK9|RPOB_EHRSE  DNA-directed RNA polymerase ...   166    1e-40
gi|60393870|sp|Q85FM7|RPOB_ADICA  DNA-directed RNA polymerase ...   165    2e-40
gi|41017787|sp|Q9AIU3|RPOB_ANAPH  DNA-directed RNA polymerase ...   165    2e-40
gi|88909141|sp|Q4A7A9|RPOB_MYCH7  DNA-directed RNA polymerase ...   163    6e-40  Gene info
gi|81378457|sp|Q5ZZS1|RPOB_MYCH2  DNA-directed RNA polymerase ...   162    7e-40  Gene info
gi|41017708|sp|Q85BW1|RPOB_ANTFO  DNA-directed RNA polymerase ...   162    1e-39  Gene info
gi|3024561|sp|P56299|RPOB_CHLVU  DNA-directed RNA polymerase b...   161    3e-39  Gene info
gi|133397|sp|P23579|RPOB_EUGGR  DNA-directed RNA polymerase be...   160    6e-39  Gene info
gi|68053052|sp|Q5SCX8|RPOB_HUPLU  DNA-directed RNA polymerase ...   158    1e-38
gi|81614307|sp|Q6KI09|RPOB_MYCMO  DNA-directed RNA polymerase ...   158    1e-38
gi|41017748|sp|Q8HTL7|RPOB2_CHLRE  DNA-directed RNA polymerase...   155    1e-37  Gene info
gi|88909641|sp|Q32RW5|RPOB_STAPU  DNA-directed RNA polymerase ...   154    3e-37  Gene info
gi|88909648|sp|Q32RG0|RPOB_ZYGCR  DNA-directed RNA polymerase ...   152    1e-36  Gene info
gi|41017711|sp|Q85X54|RPOB_PINKO  DNA-directed RNA polymerase ...   151    2e-36  Gene info
gi|1173150|sp|P41607|RPOB_PINTH  DNA-directed RNA polymerase b...   151    3e-36  Gene info
gi|41017601|sp|P60282|RPOB_AMBTC  DNA-directed RNA polymerase ...   150    3e-36  Gene info
gi|23822111|sp|Q9BBS9|RPOB_LOTJA  DNA-directed RNA polymerase ...   150    4e-36  Gene info
gi|68053165|sp|Q6EW56|RPOB_NYMAL  DNA-directed RNA polymerase ...   150    5e-36
gi|68053153|sp|Q6ENX3|RPOB_SACOF  DNA-directed RNA polymerase ...   149    1e-35
gi|92090945|sp|Q6L3A7|RPOB_SACHY  DNA-directed RNA polymerase ...   149    1e-35
gi|15214264|sp|Q9XPS7|RPOB_WHEAT  DNA-directed RNA polymerase ...   149    1e-35  Gene info
gi|133416|sp|P12091|RPOB_ORYSA  DNA-directed RNA polymerase be...   149    1e-35
gi|41017771|sp|Q8WI24|RPOB_PSINU  DNA-directed RNA polymerase ...   148    2e-35  Gene info
gi|133414|sp|P16023|RPOB_MAIZE  DNA-directed RNA polymerase be...   148    2e-35  Gene info
gi|133421|sp|P11703|RPOB_SPIOL  DNA-directed RNA polymerase be...   148    2e-35  Gene info
gi|75317325|sp|Q4VZP1|RPOB_CUCSA  DNA-directed RNA polymerase ...   146    7e-35
gi|88909121|sp|Q3V542|RPOB_ACOCL  DNA-directed RNA polymerase ...   146    8e-35
gi|68053043|sp|Q5QA72|RPOB_ACOGR  DNA-directed RNA polymerase ...   146    8e-35
gi|85700397|sp|Q56P13|RPOB_LACSA  DNA-directed RNA polymerase ...   146    9e-35
gi|41017685|sp|Q7YJX8|RPOB_CALFE  DNA-directed RNA polymerase ...   146    9e-35
gi|68053101|sp|Q68S14|RPOB_PANGI  DNA-directed RNA polymerase ...   146    9e-35
gi|109904147|sp|Q2MIA8|RPOB_LYCES  DNA-directed RNA polymerase...   145    9e-35  Gene info
gi|88909640|sp|Q2VEI4|RPOB_SOLTU  DNA-directed RNA polymerase ...   145    9e-35
gi|88909138|sp|Q49L06|RPOB_EUCGG  DNA-directed RNA polymerase ...   145    1e-34  Gene info
gi|109914397|sp|Q2MIJ5|RPOB_SOLBU  DNA-directed RNA polymerase...   145    1e-34
gi|88909146|sp|Q33C46|RPOB_NICTO  DNA-directed RNA polymerase ...   145    1e-34  Gene info
gi|41017766|sp|Q8S8X9|RPOB_ATRBE  DNA-directed RNA polymerase ...   145    1e-34  Gene info
gi|133424|sp|P06271|RPOB_TOBAC  DNA-directed RNA polymerase be...   145    1e-34  Gene info
gi|133415|sp|P06272|RPOB_MARPO  DNA-directed RNA polymerase be...   145    1e-34  Gene info
gi|109903858|sp|Q2L8Z9|RPOB_GOSHI  DNA-directed RNA polymerase...   145    2e-34
gi|12644277|sp|P46818|RPOB_SINAL  DNA-directed RNA polymerase ...   144    2e-34
gi|68053016|sp|Q589C0|RPOB_SILLA  DNA-directed RNA polymerase ...   143    5e-34
gi|88909626|sp|Q3BAP8|RPOB_PHAAO  DNA-directed RNA polymerase ...   143    5e-34
gi|22257026|sp|Q9MTM5|RPOB_OENHO  DNA-directed RNA polymerase ...   142    1e-33  Gene info
gi|88984774|sp|Q8HVY5|RPOB_SOYBN  DNA-directed RNA polymerase ...   139    9e-33  Gene info
gi|14286166|sp|P27059|RPOB_ASTLO  DNA-directed RNA polymerase ...   138    2e-32  Gene info
gi|41017602|sp|P60283|RPOB_PHYPA  DNA-directed RNA polymerase ...   137    5e-32
gi|6686323|sp|P50546|RPOB_ARATH  DNA-directed RNA polymerase b...   134    3e-31
gi|41017759|sp|Q8MA12|RPOB_CHAGL  DNA-directed RNA polymerase ...   134    3e-31  Gene info
gi|1710670|sp|P21421|RPOB_PLAFA  DNA-directed RNA polymerase beta   113    8e-25
gi|1710663|sp|Q10233|RPC2_SCHPO  Putative DNA-directed RNA pol...  81.3    3e-15
gi|133420|sp|P08036|RPOB_SAPOF  DNA-directed RNA polymerase be...  80.1    8e-15
gi|1173132|sp|P41557|RPOB1_METVA  DNA-directed RNA polymerase sub  79.7    8e-15
gi|21542437|sp|P38420|RPB2_ARATH  DNA-directed RNA polymerase ...  79.7    9e-15  Gene info
gi|2500640|sp|Q60181|RPOB1_METJA  DNA-directed RNA polymerase sub  79.7    1e-14
gi|1350832|sp|P28365|RPA2_EUPOC  DNA-directed RNA polymerase I...  79.7    1e-14
gi|11134656|sp|Q42877|RPB2_LYCES  DNA-directed RNA polymerase ...  79.0    2e-14  Gene info
gi|78099797|sp|P25167|RPC2_DROME  DNA-directed RNA polymerase ...  78.6    2e-14  Gene info
gi|51704303|sp|P59470|RPC2_MOUSE  DNA-directed RNA polymerase ...  78.6    2e-14  Gene info
gi|29428029|sp|Q9NW08|RPC2_HUMAN  DNA-directed RNA polymerase ...  78.6    2e-14  Gene info
gi|401018|sp|P31814|RPOB_THECE  DNA-directed RNA polymerase subun  78.2    2e-14
gi|3122770|sp|O28392|RPOB1_ARCFU  DNA-directed RNA polymerase sub  78.2    3e-14
gi|93140682|sp|Q4MY95|RPOB_THEPA  DNA-directed RNA polymerase bet  78.2    3e-14
gi|2507350|sp|P22276|RPC2_YEAST  DNA-directed RNA polymerase I...  77.0    6e-14  Gene info
gi|3122768|sp|O27124|RPOB1_METTH  DNA-directed RNA polymerase sub  75.5    2e-13  Gene info
gi|133460|sp|P09845|RPOB1_METTW  DNA-directed RNA polymerase subu  75.1    2e-13
gi|548823|sp|Q03587|RPOB_THEAC  DNA-directed RNA polymerase subun  73.9    6e-13
gi|51701974|sp|Q753Q4|RPB2_ASHGO  DNA-directed RNA polymerase ...  73.6    7e-13  Gene info
gi|2500625|sp|P70700|RPA2_MOUSE  DNA-directed RNA polymerase I...  73.2    8e-13  Gene info
gi|51701949|sp|Q6FLD5|RPB2_CANGA  DNA-directed RNA polymerase ...  73.2    1e-12
gi|92090637|sp|Q9H9Y6|RPA2_HUMAN  DNA-directed RNA polymerase ...  72.4    1e-12
gi|2507349|sp|P08518|RPB2_YEAST  DNA-directed RNA polymerase I...  72.4    2e-12  Gene info
gi|3914801|sp|O54888|RPA2_RAT  DNA-directed RNA polymerase I 1...  72.4    2e-12  Gene info
gi|73920765|sp|P11513|RPOB_SULAC  DNA-directed RNA polymerase sub  72.0    2e-12
gi|51702025|sp|Q8SR75|RPB2_ENCCU  DNA-directed RNA polymerase ...  70.9    4e-12
gi|12644108|sp|P08266|RPB2_DROME  DNA-directed RNA polymerase ...  70.5    6e-12  Gene info
gi|133320|sp|P22138|RPA2_YEAST  DNA-directed RNA polymerase I ...  70.5    6e-12  Gene info
gi|51701984|sp|Q75DS1|RPA2_ASHGO  DNA-directed RNA polymerase ...  70.1    7e-12  Gene info
gi|401012|sp|P30876|RPB2_HUMAN  DNA-directed RNA polymerase II...  70.1    8e-12  Gene info
gi|51702009|sp|Q8CFI7|RPB2_MOUSE  DNA-directed RNA polymerase ...  70.1    8e-12  Gene info
gi|1350834|sp|P15351|RPOB1_HALSA  DNA-directed RNA polymerase sub  69.3    1e-11
gi|75062001|sp|Q5REE8|RPA2_PONPY  DNA-directed RNA polymerase ...  68.2    2e-11
gi|12230600|sp|Q9P7X8|RPA2_SCHPO  Probable DNA-directed RNA po...  67.8    3e-11
gi|51704242|sp|O74633|RPA2_NEUCR  DNA-directed RNA polymerase ...  67.4    4e-11
gi|2507348|sp|Q10578|RPB2_CAEEL  DNA-directed RNA polymerase I...  67.4    5e-11  Gene info
gi|19862286|sp|Q02061|RPB2_SCHPO  DNA-directed RNA polymerase ...  65.9    1e-10
gi|78099796|sp|P20028|RPA2_DROME  DNA-directed RNA polymerase ...  64.7    3e-10  Gene info
gi|1173143|sp|P42487|RPO2_ASFB7  DNA-directed RNA polymerase subu  64.3    4e-10
gi|56404925|sp|Q8V4V3|RPO2_MONPV  DNA-directed RNA polymerase 132  62.4    2e-09  Gene info
gi|56405295|sp|P33811|RPO2_VARV  DNA-directed RNA polymerase 132   61.2    3e-09
gi|56404839|sp|Q775Q3|RPO2_CAMPS  DNA-directed RNA polymerase ...  61.2    4e-09
gi|56404863|sp|Q80DV1|RPO2_CWPXG  DNA-directed RNA polymerase 132  59.7    9e-09
gi|56404712|sp|O57230|RPO2_VACCA  DNA-directed RNA polymerase 132  59.7    9e-09
gi|56404962|sp|Q9JF79|RPO2_VACCT  DNA-directed RNA polymerase 132  59.7    9e-09
gi|56405099|sp|P68694|RPO2_VACCC  DNA-directed RNA polymerase ...  59.7    9e-09
gi|133382|sp|P17474|RPO2_CWPXB  DNA-directed RNA polymerase 132 k  59.7    1e-08
gi|56404906|sp|Q8JL90|RPO2_ECTVM  DNA-directed RNA polymerase 132  59.7    1e-08
gi|56404808|sp|Q6RZF8|RPO2_RABPU  DNA-directed RNA polymerase 132  59.7    1e-08
gi|133381|sp|P16716|RPO2_SHEVK  DNA-directed RNA polymerase 132 k  57.4    5e-08
gi|133456|sp|P05472|RPOL_KLULA  Probable DNA-directed RNA poly...  56.6    9e-08
gi|18203059|sp|Q9J544|RPO2_FOWPV  DNA-directed RNA polymerase 132  55.8    1e-07  Gene info
gi|3914644|sp|O46310|RIR2_LEIAM  Ribonucleoside-diphosphate re...  32.3    1.9  
gi|1705591|sp|P51060|CAPP_THES7  Phosphoenolpyruvate carboxylase   30.8    5.0  
gi|3914984|sp|O43103|SID2_USTMA  Ferrichrome siderophore peptide   30.8    5.5  
gi|110815903|sp|Q3TFD2|PCAT1_MOUSE  1-acylglycerophosphocholin...  30.0    7.3    Gene info
gi|110815904|sp|Q1HAQ0|PCAT1_RAT  1-acylglycerophosphocholine ...  30.0    7.5    Gene info
gi|34921746|sp|Q8D7G7|GCSP_VIBVU  Glycine dehydrogenase [decar...  30.0    7.6  
gi|81891667|sp|Q6IE82|JADE3_MOUSE  Protein Jade-3 (PHD finger pro  30.0    7.7    Gene info
gi|41688536|sp|Q7MEH9|GCSP_VIBVY  Glycine dehydrogenase [decar...  30.0    8.0    Gene info


Alignements deux à deux ( les 10 premiers ont étés selectionnés) :

>gi|88909133|sp|Q3Z8V4|RPOB_DEHE1 Gene info DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
Length=1272

 Score =  260 bits (664),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 142/274 (51%), Positives = 192/274 (70%), Gaps = 23/274 (8%)

Query  7     LKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSVSRENNL  66
             +K++GFD  K++ +   + G A++  +++WLKD    DAS L   E+ +K   VS ++ L
Sbjct  1005  IKQQGFDGKKVFDE--RHPGLAKEVSLKLWLKDM-GVDASSLSGAELEKKAYEVSSQSRL  1061

Query  67    SAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGK  126
              +PI GK  + DG TG  FDQP+TVGN+Y+LKLIHLVEDK+HAR+TGPYSLI+QQPLGGK
Sbjct  1062  PSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGGK  1121

Query  127   AQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPES  186
             AQFGGQRFGEMEVWA+ AY  A+ LQEMLT+KSDD+ GR KAYE+IVKGE++IQPG+PES
Sbjct  1122  AQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVIQPGVPES  1181

Query  187   FHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQ--------DESISTSI-------GWDD  231
             F VL+KELQ LGL+VE++NE++ K A  EKV           E +S  I       G +D
Sbjct  1182  FKVLVKELQSLGLAVEVINEEV-KIAPSEKVAALTEANLPGSEDVSAEILPETLYAGAED  1240

Query  232   ISEEPLELLEIEELNLNDDSNLIVEEEESEESKE  265
             I +  + +++ ++ +L   SN    +EE  E+ E
Sbjct  1241  IEDSMMSVIDTDDQDLAMSSN----DEEVSENDE  1270


>gi|88909134|sp|Q3ZX01|RPOB_DEHSC Gene info DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
Length=1273

 Score =  258 bits (658),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 139/259 (53%), Positives = 191/259 (73%), Gaps = 10/259 (3%)

Query  7     LKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSVSRENNL  66
             +K++GFD  K++ +   + G A++  +++WLKD    DAS L   E+ +K   VS ++ L
Sbjct  1005  IKQQGFDGKKIFDE--KHPGLAKEVSLKLWLKDM-GVDASALSGAELEKKAYDVSSQSRL  1061

Query  67    SAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGK  126
              +PI GK  + DG TG  FDQP+TVGN+Y+LKLIHLVEDK+HAR+TGPYSLI+QQPLGGK
Sbjct  1062  PSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGGK  1121

Query  127   AQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPES  186
             AQFGGQRFGEMEVWA+ AY  A+ LQEMLT+KSDD+ GR KAYE+IVKGE+++QPG+PES
Sbjct  1122  AQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVLQPGVPES  1181

Query  187   FHVLLKELQGLGLSVELLNEDIDKYAEIEKVD--QDESISTSIGWDDISEEPL-ELLEIE  243
             F VL+KELQ LGL+VE++NE++ K A  EKV    + ++  S   D+IS E L E L   
Sbjct  1182  FKVLVKELQSLGLAVEVINEEV-KIAPSEKVSSLNEGNLPAS---DEISAEILPETLYAN  1237

Query  244   ELNLNDDSNLIVEEEESEE  262
               ++++DS + V + + ++
Sbjct  1238  TEDISEDSMMSVIDADDQD  1256


>gi|88909127|sp|Q3A9Q7|RPOB_CARHZ Gene info DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
Length=1132

 Score =  222 bits (566),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 112/152 (73%), Positives = 130/152 (85%), Gaps = 1/152 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK +V DG TG PFD  +TVG VYMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  937   PEDGKIEVRDGRTGEPFDSRVTVGYVYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQ  996

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQE+LT+KSDDV+GRVK YEAIVKGE I +PG+PESF 
Sbjct  997   FGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGRVKTYEAIVKGENIPEPGVPESFK  1056

Query  189   VLLKELQGLGLSVELLNEDIDKYAEIEKVDQD  220
             VL+KELQ LGL V++L ++ D+  EI+++D D
Sbjct  1057  VLIKELQSLGLDVKVLTDN-DEEVEIKEIDDD  1087


>gi|108884786|sp|Q2JFI5|RPOB_FRASC  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
Length=1141

 Score =  220 bits (560),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 111/174 (63%), Positives = 135/174 (77%), Gaps = 6/174 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK K+ DG TG P+  P+ VG +Y+LKL+HLV+DKIHARSTGPYS+ITQQPLGGKAQFGG
Sbjct  971   GKAKLFDGRTGEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGG  1030

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAY LQE+LT+KSDDV+GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1031  QRFGEMEVWALEAYGAAYALQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLI  1090

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESI---STSIGWDDISEEPLELLEI  242
             KE+Q L L+VE+L+ D     +IE  D DE +   +  +G D    EP  + E+
Sbjct  1091  KEMQSLCLNVEVLSSD---GVQIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV  1141


>gi|109904224|sp|Q2RFN9|RPOB_MOOTA  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1141

 Score =  219 bits (558),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK  + DG TG PFD+PITVG +YMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  922   PEDGKTILYDGRTGEPFDRPITVGYMYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQ  981

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQE+LTVKSDDV+GRVK YEAIVKGE + +PG+PESF 
Sbjct  982   FGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFK  1041

Query  189   VLLKELQGLGLSVELLN  205
             VL+KELQ LGL V++L+
Sbjct  1042  VLIKELQSLGLDVKVLS  1058


>gi|88909644|sp|Q47LI5|RPOB_THEFY Gene info DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1155

 Score =  216 bits (551),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 114/203 (56%), Positives = 143/203 (70%), Gaps = 6/203 (2%)

Query  43    FDASKLKPTEVMQKCLSVSRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHL  102
             FD ++      +  C+   ++ ++    FGK K+ DG TG PF +P+ VG  Y LKL HL
Sbjct  956   FDGAREDEISGLLSCVLPDQDGDILVNKFGKAKLYDGRTGEPFKEPVAVGYAYFLKLHHL  1015

Query  103   VEDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDV  162
             V+DKIHARSTGPYS+ITQQPLGGKAQFGGQRFGEMEVWALEAY AAY LQE+LT+KSDD+
Sbjct  1016  VDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDI  1075

Query  163   IGRVKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQDES  222
              GRVK YEAIVKGE I +PG+PESF VL+KE+Q L L+VE+L+ D      IE  D +E 
Sbjct  1076  NGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSRD---GMSIEMRDSEED  1132

Query  223   I---STSIGWDDISEEPLELLEI  242
             +   +  +G D    EP  + E+
Sbjct  1133  VFRAAEELGIDLGRREPSSVEEV  1155


>gi|81387938|sp|Q67JT3|RPOB_SYMTH  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1250

 Score =  214 bits (546),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 113/171 (66%), Positives = 133/171 (77%), Gaps = 10/171 (5%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK  + DG TG PFD  +TVG  YMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  975   PPNGKTVLYDGKTGEPFDNEVTVGYKYMLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQ  1034

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQE+LTVKSDDV+GRVK YEAIVKGE + +PG+PESF 
Sbjct  1035  FGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFK  1094

Query  189   VLLKELQGLGLSVELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEPLEL  239
             VL+KELQ L L V++L+E  +   EIE  + D+ +       D+S+  LE+
Sbjct  1095  VLIKELQSLALDVKVLDESGN---EIELRELDDEM-------DLSDRDLEI  1135


>gi|75358070|sp|Q5FM97|RPOB_LACAC  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1213

 Score =  214 bits (544),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 114/194 (58%), Positives = 141/194 (72%), Gaps = 6/194 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK  + DG TG PF   ++VG ++ LKL H+V+DKIHARS GPYSL+TQQPLGGKAQFGG
Sbjct  1011  GKTVIYDGRTGEPFHNRVSVGVMHYLKLTHMVDDKIHARSIGPYSLVTQQPLGGKAQFGG  1070

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAYTLQE+LT KSDDV+GRVKAYEAIVKGE I +PG+PESF VL+
Sbjct  1071  QRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKAYEAIVKGERIPKPGVPESFRVLV  1130

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEPLELLEIEELNLNDDS  251
             KELQ LGL + +L+ D   + EIE  D DE  S  +  D +S    E    E+  L +++
Sbjct  1131  KELQSLGLDIRVLDMD---HNEIELRDMDEDSSEHLNIDTLSRMAEEQ---EKKKLAEET  1184

Query  252   NLIVEEEESEESKE  265
                  +E+S E+ +
Sbjct  1185  GKSENKEDSNETAD  1198


>gi|41017975|sp|Q82DQ5|RPOB_STRAW  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1181

 Score =  213 bits (543),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 110/174 (63%), Positives = 133/174 (76%), Gaps = 6/174 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK  + DG +G PF +PI+VG +Y+LKL HLV+DK+HARSTGPYS+ITQQPLGGKAQFGG
Sbjct  1011  GKAPLFDGRSGEPFPEPISVGYMYILKLHHLVDDKLHARSTGPYSMITQQPLGGKAQFGG  1070

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAY LQE+LT+KSDDV GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1071  QRFGEMEVWALEAYGAAYALQELLTIKSDDVTGRVKVYEAIVKGENIPEPGIPESFKVLI  1130

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESI---STSIGWDDISEEPLELLEI  242
             KE+Q L L+VE+L+ D      IE  D DE +   +  +G D    EP  + E+
Sbjct  1131  KEMQSLCLNVEVLSSD---GMSIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV  1181


>gi|41018149|sp|Q9L0L0|RPOB_STRCO  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1161

 Score =  213 bits (543),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 110/174 (63%), Positives = 134/174 (77%), Gaps = 6/174 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK ++ DG +G PF +PI+VG +Y+LKL HLV+DK+HARSTGPYS+ITQQPLGGKAQFGG
Sbjct  991   GKARLFDGRSGEPFPEPISVGYMYILKLHHLVDDKLHARSTGPYSMITQQPLGGKAQFGG  1050

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAY LQE+LT+KSDDV GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1051  QRFGEMEVWALEAYGAAYALQELLTIKSDDVTGRVKVYEAIVKGENIPEPGIPESFKVLI  1110

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESI---STSIGWDDISEEPLELLEI  242
             KE+Q L L+VE+L+ D      IE  D DE +   +  +G D    EP  + E+
Sbjct  1111  KEMQSLCLNVEVLSSD---GMSIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV  1161


>gi|88909131|sp|Q4JT32|RPOB_CORJK Gene info DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
Length=1164

 Score =  213 bits (542),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 107/151 (70%), Positives = 123/151 (81%), Gaps = 1/151 (0%)

Query  71    FGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFG  130
             FGK  +IDG +G PF  P+ VG +YMLKL HLV++KIHARSTGPYS+ITQQPLGGKAQFG
Sbjct  990   FGKSNLIDGRSGEPFPYPVAVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFG  1049

Query  131   GQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVL  190
             GQRFGEMEVWA++AY AAYTLQE+LT+KSDDV+GRVK YEAIVKGE I  PG+PESF VL
Sbjct  1050  GQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVL  1109

Query  191   LKELQGLGLSVELLNEDIDKYAEIEKVDQDE  221
             LKELQ L L+VE+L  D     E+   D DE
Sbjct  1110  LKELQSLCLNVEVLAAD-GTPMELSSDDDDE  1139


>gi|61234284|sp|P0A680|RPOB_MYCTU  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
 gi|61234288|sp|P0A681|RPOB_MYCBO  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1178

 Score =  213 bits (541),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 108/187 (57%), Positives = 138/187 (73%), Gaps = 1/187 (0%)

Query  43    FDASKLKPTEVMQKCLSVSRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHL  102
             FD ++    + +  C   +R+ ++     GK  + DG +G PF  P+TVG +Y++KL HL
Sbjct  977   FDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHL  1036

Query  103   VEDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDV  162
             V+DKIHARSTGPYS+ITQQPLGGKAQFGGQRFGEME WA++AY AAYTLQE+LT+KSDD 
Sbjct  1037  VDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDT  1096

Query  163   IGRVKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQD-E  221
             +GRVK YEAIVKGE I +PG+PESF VLLKELQ L L+VE+L+ D       E  D+D E
Sbjct  1097  VGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLE  1156

Query  222   SISTSIG  228
               + ++G
Sbjct  1157  RAAANLG  1163


>gi|41018079|sp|Q8R7U6|RPOB_THETN  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1234

 Score =  213 bits (541),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 105/136 (77%), Positives = 119/136 (87%), Gaps = 0/136 (0%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK ++ DG TG PFD  +TVG +YMLKL HLV+DK+HARSTGPYSL+TQQPLGGKAQFGG
Sbjct  1025  GKVQLYDGRTGEPFDNKVTVGYMYMLKLHHLVDDKMHARSTGPYSLVTQQPLGGKAQFGG  1084

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AA+TLQEMLTVKSDDV GRVKAYEAIVKGE I +PG+PESF VL+
Sbjct  1085  QRFGEMEVWALEAYGAAHTLQEMLTVKSDDVTGRVKAYEAIVKGENIPEPGIPESFKVLV  1144

Query  192   KELQGLGLSVELLNED  207
             KELQ L L V+++ ED
Sbjct  1145  KELQSLALDVKVITED  1160


>gi|41017721|sp|Q890N4|RPOB_CLOTE  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
Length=1236

 Score =  213 bits (541),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 108/149 (72%), Positives = 125/149 (83%), Gaps = 0/149 (0%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK  + DG TG PFD  +TVG +Y+LKL HLV+DKIHARSTGPYSL+TQQPLGGKAQFGG
Sbjct  1029  GKTVLYDGRTGEPFDNRVTVGYMYILKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGG  1088

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AA+TLQE+LTVKSDDV+GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1089  QRFGEMEVWALEAYGAAHTLQEILTVKSDDVVGRVKTYEAIVKGENIPEPGVPESFKVLI  1148

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQD  220
             KELQ L L V++LN+D ++ A  E  D D
Sbjct  1149  KELQALCLDVKVLNDDNEEIAIKELADDD  1177


>gi|88909143|sp|Q73SE4|RPOB_MYCPA  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
Length=1175

 Score =  213 bits (541),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 110/187 (58%), Positives = 137/187 (73%), Gaps = 1/187 (0%)

Query  43    FDASKLKPTEVMQKCLSVSRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHL  102
             FD +K +    M  C   +R+  +     GK  + DG +G PF  P+TVG +Y++KL HL
Sbjct  974   FDGAKEEELAGMLSCTLPNRDGEVMVDGDGKAVLFDGRSGEPFPYPVTVGYMYIMKLHHL  1033

Query  103   VEDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDV  162
             V+DKIHARSTGPYS+ITQQPLGGKAQFGGQRFGEME WA++AY AAYTLQE+LT+KSDD 
Sbjct  1034  VDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDT  1093

Query  163   IGRVKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQD-E  221
             +GRVK YEAIVKGE I +PG+PESF VLLKELQ L L+VE+L+ D       E  D+D E
Sbjct  1094  VGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLE  1153

Query  222   SISTSIG  228
               + ++G
Sbjct  1154  RAAANLG  1160



Ensuite nous effectuons un Blastp contre NR:

Sequences producing significant alignments:                        (Bits)  Value

gi|57234592|ref|YP_181345.1|  DNA-directed RNA polymerase, bet...   260    5e-68  
gi|73748443|ref|YP_307682.1|  DNA-directed RNA polymerase, bet...   258    3e-67  
gi|88933697|ref|ZP_01139367.1|  DNA-directed RNA polymerase, b...   258    3e-67
gi|98660450|dbj|GAA02292.1|  unnamed protein product [Pelotomacul   231    2e-59
gi|27262300|gb|AAN87431.1|  DNA-directed RNA polymerase beta chai   226    1e-57
gi|106895657|ref|ZP_01362738.1|  DNA-directed RNA polymerase, ...   224    3e-57
gi|106888501|ref|ZP_01355701.1|  DNA-directed RNA polymerase, ...   224    4e-57
gi|78043606|ref|YP_361127.1|  DNA-directed RNA polymerase, bet...   222    1e-56  
gi|76261395|ref|ZP_00769007.1|  DNA-directed RNA polymerase, b...   222    1e-56
gi|82501186|ref|ZP_00886552.1|  DNA-directed RNA polymerase, b...   220    5e-56
gi|86739286|ref|YP_479686.1|  DNA-directed RNA polymerase, bet...   220    5e-56  
gi|83591284|ref|YP_431293.1|  DNA-directed RNA polymerase, bet...   219    1e-55  
gi|111220537|ref|YP_711331.1|  DNA-directed RNA polymerase bet...   217    4e-55  
gi|116671530|ref|YP_832463.1|  DNA-directed RNA polymerase, be...   217    5e-55  
gi|68230917|ref|ZP_00570093.1|  DNA-directed RNA polymerase, b...   217    6e-55
gi|72163053|ref|YP_290710.1|  DNA-directed RNA polymerase beta...   216    6e-55  
gi|113939448|ref|ZP_01425302.1|  DNA-directed RNA polymerase, ...   216    8e-55
gi|54303711|gb|AAV33242.1|  rifampicin-sensitive RNA polymeras...   216    9e-55
gi|46360922|gb|AAS89194.1|  RpoB [Corynebacterium pseudodiphtheri   215    2e-54
gi|69285489|ref|ZP_00616975.1|  DNA-directed RNA polymerase, b...   215    2e-54
gi|117927508|ref|YP_872059.1|  DNA-directed RNA polymerase, be...   215    2e-54
gi|54303713|gb|AAV33243.1|  rifampicin-resistant RNA polymeras...   214    2e-54
gi|67917242|ref|ZP_00510902.1|  DNA-directed RNA polymerase, b...   214    3e-54
gi|51894220|ref|YP_076911.1|  DNA-directed RNA polymerase beta...   214    3e-54  
gi|89893209|ref|YP_516696.1|  hypothetical protein DSY0463 [De...   214    3e-54  
gi|109647477|ref|ZP_01371380.1|  DNA-directed RNA polymerase, ...   214    3e-54
gi|82749036|ref|ZP_00911506.1|  DNA-directed RNA polymerase, b...   214    4e-54
gi|58336623|ref|YP_193208.1|  DNA-directed RNA polymerase beta...   214    4e-54  
gi|46360920|gb|AAS89193.1|  RpoB [Corynebacterium jeikeium]         213    5e-54
gi|62720650|gb|AAX93861.1|  RNA polymerase subunit B [Mycobacteri   213    5e-54
gi|88944027|ref|ZP_01147360.1|  DNA-directed RNA polymerase, b...   213    5e-54
gi|29831457|ref|NP_826091.1|  DNA-directed RNA polymerase beta...   213    6e-54  
gi|104773535|ref|YP_618515.1|  DNA-directed RNA polymerase bet...   213    6e-54  
gi|21223036|ref|NP_628815.1|  DNA-directed RNA polymerase beta...   213    6e-54  
gi|81255451|ref|ZP_00879930.1|  COG0085: DNA-directed RNA poly...   213    7e-54
gi|34595755|gb|AAQ76600.1|  RpoB [Mycobacterium abscessus]          213    8e-54
gi|68536938|ref|YP_251643.1|  DNA-directed RNA polymerase, bet...   213    8e-54  
gi|34391547|gb|AAN65351.1|  RpoB [Mycobacterium abscessus]          213    8e-54
gi|116513532|ref|YP_812438.1|  DNA-directed RNA polymerase, be...   213    8e-54  
gi|34391567|gb|AAN65361.1|  RpoB [Mycobacterium mucogenicum]        213    8e-54
gi|468334|gb|AAA21416.1|  RNA polymerase beta-subunit               213    8e-54
gi|34391559|gb|AAN65357.1|  RpoB [Mycobacterium mucogenicum]        213    8e-54
gi|34595751|gb|AAQ76598.1|  RpoB [Mycobacterium immunogenum]        213    8e-54
gi|46360930|gb|AAS89198.1|  RpoB [Corynebacterium bovis]            213    9e-54
gi|15840070|ref|NP_335107.1|  DNA-directed RNA polymerase beta...   213    9e-54  
gi|76785577|ref|ZP_00772744.1|  COG0085: DNA-directed RNA poly...   213    9e-54
gi|20808668|ref|NP_623839.1|  DNA-directed RNA polymerase beta...   213    9e-54  
gi|28212181|ref|NP_783125.1|  DNA-directed RNA polymerase beta...   213    9e-54  
gi|41410228|ref|NP_963064.1|  DNA-directed RNA polymerase beta...   213    9e-54  
gi|88909143|sp|Q73SE4|RPOB_MYCPA  DNA-directed RNA polymerase ...   213    1e-53
gi|34595753|gb|AAQ76599.1|  RpoB [Mycobacterium chelonae]           213    1e-53
gi|34391545|gb|AAN65350.1|  RpoB [Mycobacterium chelonae]           213    1e-53
gi|62720646|gb|AAX93859.1|  RNA polymerase subunit B [Mycobacteri   213    1e-53
gi|77687234|ref|ZP_00802506.1|  DNA-directed RNA polymerase, b...   213    1e-53
gi|116628956|ref|YP_814128.1|  DNA-directed RNA polymerase, be...   213    1e-53  
gi|42518422|ref|NP_964352.1|  DNA-directed RNA polymerase beta...   213    1e-53  
gi|15607807|ref|NP_215181.1|  DNA-directed RNA polymerase beta...   213    1e-53  
gi|46360936|gb|AAS89201.1|  RpoB [Corynebacterium pseudotuberculo   212    1e-53
gi|10637863|emb|CAC10557.1|  DNA-dependent RNA polymerase subunit   212    1e-53
gi|15612689|ref|NP_240992.1|  DNA-directed RNA polymerase beta...   212    1e-53  
gi|62720648|gb|AAX93860.1|  RNA polymerase subunit B [Mycobacteri   212    1e-53
gi|34595747|gb|AAQ76596.1|  RpoB [Mycobacterium porcinum]           212    1e-53
gi|34391561|gb|AAN65358.1|  RpoB [Mycobacterium mucogenicum]        212    1e-53
gi|62720652|gb|AAX93862.1|  RNA polymerase subunit B [Mycobacteri   212    1e-53
gi|46360924|gb|AAS89195.1|  RpoB [Corynebacterium xerosis]          212    1e-53
gi|116624533|ref|YP_826689.1|  DNA-directed RNA polymerase, be...   212    2e-53  
gi|56961924|ref|YP_173646.1|  DNA-directed RNA polymerase beta...   212    2e-53  
gi|89211783|ref|ZP_01190125.1|  DNA-directed RNA polymerase, b...   211    2e-53
gi|62720654|gb|AAX93863.1|  RNA polymerase subunit B [Mycobacteri   211    3e-53
gi|92910107|ref|ZP_01278883.1|  DNA-directed RNA polymerase, b...   211    3e-53
gi|92917289|ref|ZP_01285903.1|  DNA-directed RNA polymerase, b...   211    3e-53
gi|46361006|gb|AAS89236.1|  RpoB [Corynebacterium kroppenstedtii]   211    3e-53
gi|62424433|ref|ZP_00379579.1|  COG0085: DNA-directed RNA poly...   211    3e-53
gi|34391553|gb|AAN65354.1|  RpoB [Mycobacterium septicum]           211    3e-53
gi|116488418|gb|AAQ76602.2|  RpoB [Mycobacterium wolinskyi]         211    3e-53
gi|30260293|ref|NP_842670.1|  DNA-directed RNA polymerase beta...   211    3e-53  
gi|34391563|gb|AAN65359.1|  RpoB [Mycobacterium fortuitum]          211    3e-53
gi|34391551|gb|AAN65353.1|  RpoB [Mycobacterium peregrinum]         211    3e-53
gi|34595757|gb|AAQ76601.1|  RpoB [Mycobacterium farcinogenes]       211    4e-53
gi|34595749|gb|AAQ76597.1|  RpoB [Mycobacterium senegalense]        211    4e-53
gi|34391549|gb|AAN65352.1|  RpoB [Mycobacterium fortuitum]          211    4e-53
gi|41017600|sp|P60281|RPOB2_MYCSM  DNA-directed RNA polymerase...   211    4e-53
gi|89100358|ref|ZP_01173223.1|  DNA-directed RNA polymerase be...   211    4e-53
gi|70727464|ref|YP_254380.1|  DNA-directed RNA polymerase beta...   211    4e-53  
gi|34391565|gb|AAN65360.1|  RpoB [Mycobacterium fortuitum]          211    4e-53
gi|90202724|ref|ZP_01205370.1|  DNA-directed RNA polymerase, b...   210    4e-53
gi|65317559|ref|ZP_00390518.1|  COG0085: DNA-directed RNA poly...   210    4e-53
gi|19551731|ref|NP_599733.1|  DNA-directed RNA polymerase beta...   210    4e-53  
gi|62389386|ref|YP_224788.1|  DNA-directed RNA polymerase beta...   210    4e-53  
gi|30018372|ref|NP_830003.1|  DNA-directed RNA polymerase beta...   210    4e-53  
gi|34595745|gb|AAQ76595.1|  RpoB [Mycobacterium goodii]             210    5e-53
gi|34595743|gb|AAQ76594.1|  RpoB [Mycobacterium smegmatis]          210    5e-53
gi|25027053|ref|NP_737107.1|  DNA-directed RNA polymerase beta...   210    5e-53  
gi|113943870|ref|ZP_01429571.1|  DNA-directed RNA polymerase, ...   210    5e-53
gi|34391555|gb|AAN65355.1|  RpoB [Mycobacterium mageritense] >...   210    5e-53
gi|85715144|ref|ZP_01046128.1|  DNA-directed RNA polymerase be...   210    5e-53
gi|47570395|ref|ZP_00241035.1|  DNA-directed RNA polymerase, b...   210    5e-53
gi|42524381|ref|NP_969761.1|  DNA-directed RNA polymerase beta...   210    5e-53  
gi|42779183|ref|NP_976430.1|  DNA-directed RNA polymerase beta...   210    5e-53  
gi|15889250|ref|NP_354931.1|  DNA-directed RNA polymerase beta...   210    5e-53  
gi|46360938|gb|AAS89202.1|  RpoB [Corynebacterium renale]           210    5e-53
gi|111018959|ref|YP_701931.1|  DNA-directed RNA polymerase bet...   210    6e-53  
gi|52078601|ref|YP_077392.1|  DNA-directed RNA polymerase beta...   210    6e-53  
gi|73663522|ref|YP_302303.1|  DNA-directed RNA polymerase beta...   210    6e-53  
gi|88909122|sp|Q6MJ09|RPOB_BDEBA  DNA-directed RNA polymerase ...   210    6e-53
gi|17935846|ref|NP_532636.1|  DNA-directed RNA polymerase beta...   210    7e-53  
gi|89338439|ref|ZP_01191204.1|  DNA-directed RNA polymerase, b...   209    7e-53
gi|46360932|gb|AAS89199.1|  RpoB [Corynebacterium freneyi]          209    7e-53
gi|36333353|gb|AAP75734.1|  RNA polymerase beta subunit [Afipia s   209    9e-53
gi|116871647|ref|YP_848428.1|  DNA-directed RNA polymerase bet...   209    1e-52  
gi|16799362|ref|NP_469630.1|  DNA-directed RNA polymerase beta...   209    1e-52  
gi|15896392|ref|NP_349741.1|  DNA-directed RNA polymerase beta...   209    1e-52  
gi|581334|emb|CAA78668.1|  RNA polymerase beta subunit [Mycobacte   209    1e-52
gi|38233060|ref|NP_938827.1|  DNA-directed RNA polymerase beta...   209    1e-52  
gi|46360918|gb|AAS89192.1|  RpoB [Corynebacterium diphtheriae]      209    1e-52
gi|17225232|gb|AAL37309.1|  RNA polymerase B-subunit [Staphylococ   209    1e-52
gi|117607904|gb|ABK43359.1|  DNA-directed RNA polymerase, beta...   209    1e-52
gi|47091392|ref|ZP_00229189.1|  DNA-directed RNA polymerase, b...   209    1e-52
gi|16802304|ref|NP_463789.1|  DNA-directed RNA polymerase beta...   209    1e-52  
gi|15828010|ref|NP_302273.1|  DNA-directed RNA polymerase beta...   209    1e-52  
gi|17225226|gb|AAL37306.1|  RNA polymerase B-subunit [Staphylococ   209    1e-52
gi|56418633|ref|YP_145951.1|  DNA-directed RNA polymerase beta...   209    1e-52  
gi|85666788|ref|ZP_01029011.1|  hypothetical protein Badol_010...   209    1e-52
gi|88854711|ref|ZP_01129377.1|  DNA-directed RNA polymerase be...   209    1e-52
gi|75675542|ref|YP_317963.1|  DNA-directed RNA polymerase beta...   209    2e-52  
gi|27467224|ref|NP_763861.1|  DNA-directed RNA polymerase beta...   209    2e-52  
gi|75762690|ref|ZP_00742528.1|  DNA-directed RNA polymerase be...   208    2e-52
gi|13470542|ref|NP_102110.1|  DNA-directed RNA polymerase beta...   208    2e-52  
gi|50897992|gb|AAT86005.1|  RpoB [Mycobacterium massiliense]        208    2e-52
gi|54027073|ref|YP_121315.1|  DNA-directed RNA polymerase beta...   208    2e-52  
gi|68056507|ref|ZP_00540623.1|  DNA-directed RNA polymerase, b...   208    2e-52
gi|46360926|gb|AAS89196.1|  RpoB [Corynebacterium auris]            208    2e-52
gi|108804981|ref|YP_644918.1|  DNA-directed RNA polymerase, be...   208    2e-52  
gi|17225230|gb|AAL37308.1|  RNA polymerase B-subunit [Staphylococ   208    2e-52
gi|41017808|sp|Q9L637|RPOB_AMYMD  DNA-directed RNA polymerase ...   208    2e-52
gi|78698570|ref|ZP_00863071.1|  DNA-directed RNA polymerase, b...   208    2e-52
gi|113875389|ref|ZP_01415514.1|  DNA-directed RNA polymerase [...   208    2e-52
gi|76797452|ref|ZP_00779767.1|  DNA-directed RNA polymerase, b...   208    2e-52
gi|114845492|ref|ZP_01455890.1|  DNA-directed RNA polymerase, ...   208    3e-52
gi|36333355|gb|AAP75735.1|  RNA polymerase beta subunit [Afipia g   208    3e-52
gi|83312239|ref|YP_422503.1|  DNA-directed RNA polymerase, bet...   207    3e-52  
gi|108761304|ref|YP_631280.1|  DNA-directed RNA polymerase, be...   207    3e-52  
gi|94971702|ref|YP_593750.1|  DNA-directed RNA polymerase, bet...   207    3e-52  
gi|89209105|ref|ZP_01187566.1|  DNA-directed RNA polymerase, b...   207    3e-52
gi|86609871|ref|YP_478633.1|  DNA-directed RNA polymerase, bet...   207    3e-52  
gi|15965101|ref|NP_385454.1|  DNA-directed RNA polymerase beta...   207    3e-52  
gi|18311395|ref|NP_563329.1|  DNA-directed RNA polymerase beta...   207    3e-52  
gi|677851|emb|CAA45512.1|  DNA-directed RNA polymerase beta ch...   207    3e-52
gi|50955586|ref|YP_062874.1|  DNA-directed RNA polymerase beta...   207    3e-52  
gi|86357297|ref|YP_469189.1|  DNA-directed RNA polymerase beta...   207    3e-52  
gi|110801957|ref|YP_699671.1|  DNA-directed RNA polymerase, be...   207    3e-52  
gi|27380521|ref|NP_772050.1|  DNA-directed RNA polymerase beta...   207    3e-52  
gi|36333359|gb|AAP75737.1|  RNA polymerase beta subunit [Bradyrhi   207    3e-52
gi|116251532|ref|YP_767370.1|  putative DNA-directed RNA polym...   207    4e-52  
gi|36333369|gb|AAP75742.1|  RNA polymerase beta subunit [Bosea ma   207    4e-52
gi|90587131|ref|ZP_01242804.1|  DNA-directed RNA polymerase, b...   207    4e-52
gi|69299011|ref|ZP_00621140.1|  DNA-directed RNA polymerase, b...   207    4e-52  
gi|57651418|ref|YP_185474.1|  DNA-directed RNA polymerase beta...   207    4e-52  
gi|49482772|ref|YP_039996.1|  DNA-directed RNA polymerase beta...   207    4e-52  
gi|15926220|ref|NP_373753.1|  DNA-directed RNA polymerase beta...   207    4e-52  
gi|87159984|ref|YP_493230.1|  DNA-directed RNA polymerase, bet...   207    4e-52  
gi|36333361|gb|AAP75738.1|  RNA polymerase beta subunit [Bosea th   207    4e-52
gi|17225228|gb|AAL37307.1|  RNA polymerase B-subunit [Staphylococ   207    5e-52
gi|15923532|ref|NP_371066.1|  DNA-directed RNA polymerase beta...   207    5e-52  
gi|46360954|gb|AAS89210.1|  RpoB [Corynebacterium confusum]         207    5e-52
gi|50982576|gb|AAP75731.2|  RNA polymerase beta subunit [Afipia f   207    5e-52
gi|36333363|gb|AAP75739.1|  RNA polymerase beta subunit [Bosea mi   207    5e-52
gi|89358263|ref|ZP_01196085.1|  DNA-directed RNA polymerase, b...   207    5e-52
gi|84494796|ref|ZP_00993915.1|  DNA-directed RNA polymerase be...   207    5e-52
gi|46361028|gb|AAS89247.1|  RpoB [Rhodococcus equi]                 207    6e-52
gi|73913595|gb|AAZ91715.1|  DNA-directed RNA polymerase beta c...   207    6e-52
gi|54026619|ref|YP_120861.1|  DNA-directed RNA polymerase beta...   207    6e-52  
gi|41017622|sp|Q50388|RPOB1_MYCSM  DNA-directed RNA polymerase...   207    6e-52
gi|46360952|gb|AAS89209.1|  RpoB [Corynebacterium capitovis]        206    6e-52
gi|49475398|ref|YP_033439.1|  DNA-directed RNA polymerase beta...   206    7e-52  
gi|23013725|ref|ZP_00053589.1|  COG0085: DNA-directed RNA poly...   206    7e-52
gi|36333365|gb|AAP75740.1|  RNA polymerase beta subunit [Bosea ve   206    7e-52
gi|36333367|gb|AAP75741.1|  RNA polymerase beta subunit [Bosea en   206    7e-52
gi|15673782|ref|NP_267957.1|  DNA-directed RNA polymerase beta...   206    8e-52  
gi|86605128|ref|YP_473891.1|  DNA-directed RNA polymerase, bet...   206    9e-52  
gi|8895200|gb|AAF80850.1|AF165994_1  RNA polymerase beta subunit    206    9e-52
gi|49474307|ref|YP_032349.1|  DNA-directed RNA polymerase beta...   206    9e-52  
gi|56698330|ref|YP_168703.1|  DNA-directed RNA polymerase beta...   206    1e-51  
gi|67939900|ref|ZP_00532382.1|  DNA-directed RNA polymerase, b...   206    1e-51
gi|15705366|gb|AAL05611.1|  RpoB [bacterium DR-2001]                206    1e-51
gi|81429387|ref|YP_396388.1|  DNA-directed RNA polymerase, bet...   206    1e-51  
gi|36333337|gb|AAP75726.1|  RNA polymerase beta subunit [Afipia m   206    1e-51
gi|46361002|gb|AAS89234.1|  RpoB [Corynebacterium variabile]        206    1e-51
gi|83854989|ref|ZP_00948519.1|  DNA-directed RNA polymerase be...   205    1e-51
gi|83371926|ref|ZP_00916706.1|  DNA-directed RNA polymerase, b...   205    2e-51
gi|92117084|ref|YP_576813.1|  DNA-directed RNA polymerase, bet...   205    2e-51  
gi|71365441|ref|ZP_00655994.1|  DNA-directed RNA polymerase, b...   205    2e-51
gi|91215208|ref|ZP_01252180.1|  DNA-directed RNA polymerase be...   205    2e-51
gi|46982194|gb|AAT08137.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|46982190|gb|AAT08135.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|46982192|gb|AAT08136.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|46982196|gb|AAT08138.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|46982198|gb|AAT08139.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|46982204|gb|AAT08142.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|116512669|ref|YP_811576.1|  DNA-directed RNA polymerase, be...   205    2e-51  
gi|36333345|gb|AAP75730.1|  RNA polymerase beta subunit [Afipia f   205    2e-51
gi|46982188|gb|AAT08134.1|  DNA-dependent RNA polymerase beta ...   205    2e-51
gi|46982200|gb|AAT08140.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|46982202|gb|AAT08141.1|  DNA-dependent RNA polymerase beta cha   205    2e-51
gi|28493038|ref|NP_787199.1|  DNA-directed RNA polymerase beta...   205    2e-51  
gi|81300331|ref|YP_400539.1|  DNA-directed RNA polymerase, bet...   205    2e-51  
gi|46360956|gb|AAS89211.1|  RpoB [Corynebacterium argentoratense]   205    2e-51
gi|77462251|ref|YP_351755.1|  DNA-directed RNA polymerase beta...   205    2e-51  
gi|115525596|ref|YP_782507.1|  DNA-directed RNA polymerase, be...   205    2e-51  
gi|106887335|ref|ZP_01354644.1|  DNA-directed RNA polymerase, ...   205    2e-51
gi|83367884|ref|ZP_00912751.1|  DNA-directed RNA polymerase, b...   205    2e-51
gi|36333341|gb|AAP75728.1|  RNA polymerase beta subunit [Afipia b   205    2e-51
gi|56752516|ref|YP_173217.1|  DNA-directed RNA polymerase beta...   205    2e-51  
gi|29377682|ref|NP_816836.1|  DNA-directed RNA polymerase beta...   205    2e-51  
gi|50843338|ref|YP_056565.1|  DNA-directed RNA polymerase beta...   205    2e-51  
gi|110681145|ref|YP_684152.1|  DNA-directed RNA polymerase, be...   205    2e-51  
gi|36333357|gb|AAP75736.1|  RNA polymerase beta subunit [Bradyrhi   205    2e-51
gi|46360946|gb|AAS89206.1|  RpoB [Corynebacterium auriscanis]       204    2e-51
gi|78496067|ref|ZP_00848281.1|  DNA-directed RNA polymerase, b...   204    2e-51  
gi|86749405|ref|YP_485901.1|  DNA-directed RNA polymerase, bet...   204    2e-51  
gi|91977663|ref|YP_570322.1|  DNA-directed RNA polymerase, bet...   204    3e-51  
gi|90576475|ref|ZP_01232937.1|  hypothetical protein CdifQ_020...   204    3e-51
gi|36333349|gb|AAP75732.1|  RNA polymerase beta subunit [Afipia g   204    3e-51
gi|83594027|ref|YP_427779.1|  DNA-directed RNA polymerase, bet...   204    3e-51  
gi|36333373|gb|AAP75744.1|  RNA polymerase beta subunit [Bosea sp   204    3e-51
gi|115249070|emb|CAJ66881.1|  DNA-directed RNA polymerase beta...   204    3e-51
gi|71390290|gb|AAZ31532.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|71390280|gb|AAZ31527.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|71390304|gb|AAZ31539.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|49089813|gb|AAT51864.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|46982206|gb|AAT08143.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|17987032|ref|NP_539666.1|  DNA-directed RNA polymerase beta...   204    3e-51  
gi|23502120|ref|NP_698247.1|  DNA-directed RNA polymerase beta...   204    3e-51  
gi|28572249|ref|NP_789029.1|  DNA-directed RNA polymerase beta...   204    3e-51  
gi|116495960|ref|YP_807694.1|  DNA-directed RNA polymerase, be...   204    3e-51  
gi|115378469|ref|ZP_01465628.1|  DNA-directed RNA polymerase, ...   204    3e-51
gi|71390282|gb|AAZ31528.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|71390274|gb|AAZ31524.1|  DNA-dependent RNA polymerase beta cha   204    3e-51
gi|71390300|gb|AAZ31537.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|49089817|gb|AAT51866.1|  DNA-dependent RNA polymerase beta ...   204    3e-51
gi|46360928|gb|AAS89197.1|  RpoB [Corynebacterium minutissimum]     204    3e-51
gi|39936331|ref|NP_948607.1|  DNA-directed RNA polymerase beta...   204    3e-51  
gi|89053059|ref|YP_508510.1|  DNA-directed RNA polymerase, bet...   204    3e-51  
gi|30173235|sp|P59642|RPOB_TROW8  DNA-directed RNA polymerase ...   204    3e-51
gi|30179895|sp|Q93GF2|RPOB_TROWT  DNA-directed RNA polymerase ...   204    3e-51
gi|103486971|ref|YP_616532.1|  DNA-directed RNA polymerase, be...   204    3e-51  
gi|94497753|ref|ZP_01304320.1|  DNA-directed RNA polymerase, b...   204    3e-51
gi|52082901|gb|AAU26030.1|  RNA polymerase beta subunit [Afipia s   204    3e-51
gi|85858138|ref|YP_460340.1|  DNA-directed RNA polymerase beta...   204    4e-51  
gi|78187804|ref|YP_375847.1|  DNA-directed RNA polymerase beta...   204    4e-51  
gi|56551627|ref|YP_162466.1|  DNA-directed RNA polymerase beta...   204    4e-51  
gi|116618914|ref|YP_819285.1|  DNA-directed RNA polymerase, be...   204    4e-51  
gi|36333339|gb|AAP75727.1|  RNA polymerase beta subunit [Afipia b   204    4e-51
gi|58038861|ref|YP_190825.1|  DNA-directed RNA polymerase beta...   204    4e-51  
gi|46360940|gb|AAS89203.1|  RpoB [Corynebacterium amycolatum]       204    4e-51
gi|52082903|gb|AAU26031.1|  RNA polymerase beta subunit [Afipia s   204    4e-51
gi|110597684|ref|ZP_01385969.1|  DNA-directed RNA polymerase, ...   204    4e-51
gi|89890192|ref|ZP_01201703.1|  RNA  polymerase beta subunit r...   204    4e-51
gi|46360962|gb|AAS89214.1|  RpoB [Corynebacterium durum]            204    4e-51
gi|86137185|ref|ZP_01055763.1|  DNA-directed RNA polymerase be...   204    4e-51
gi|88909139|sp|Q5FTX7|RPOB_GLUOX  DNA-directed RNA polymerase ...   204    5e-51
gi|36333343|gb|AAP75729.1|  RNA polymerase beta subunit [Afipia c   204    5e-51
gi|114704476|ref|ZP_01437384.1|  DNA-directed RNA polymerase b...   203    5e-51
gi|83949807|ref|ZP_00958540.1|  DNA-directed RNA polymerase be...   203    5e-51
gi|113934121|ref|ZP_01420022.1|  DNA-directed RNA polymerase, ...   203    6e-51
gi|86131817|ref|ZP_01050414.1|  DNA-directed RNA polymerase be...   203    6e-51
gi|46360992|gb|AAS89229.1|  RpoB [Corynebacterium striatum]         203    6e-51
gi|86140281|ref|ZP_01058840.1|  DNA-directed RNA polymerase be...   203    6e-51
gi|114771278|ref|ZP_01448698.1|  DNA-directed RNA polymerase b...   203    8e-51
gi|68550721|ref|ZP_00590162.1|  DNA-directed RNA polymerase, b...   203    8e-51
gi|46360998|gb|AAS89232.1|  RpoB [Corynebacterium thomssenii]       203    8e-51
gi|84499871|ref|ZP_00998137.1|  DNA-directed RNA polymerase be...   203    8e-51
gi|41017743|sp|Q8GCR3|RPOB4_ENTFC  DNA-directed RNA polymerase...   203    9e-51
gi|67919885|ref|ZP_00513440.1|  DNA-directed RNA polymerase, b...   202    9e-51
gi|90961179|ref|YP_535095.1|  DNA-directed RNA polymerase beta...   202    9e-51  
gi|110639542|ref|YP_679751.1|  DNA-directed RNA polymerase, be...   202    1e-50  
gi|114327212|ref|YP_744369.1|  DNA-directed RNA polymerase bet...   202    1e-50  
gi|14278483|pdb|1I6V|C  Chain C, Thermus Aquaticus Core Rna Po...   202    1e-50  
gi|110634169|ref|YP_674377.1|  DNA-directed RNA polymerase, be...   202    1e-50  
gi|23097567|ref|NP_691033.1|  DNA-directed RNA polymerase beta...   202    1e-50  
gi|23465772|ref|NP_696375.1|  DNA-directed RNA polymerase beta...   202    1e-50  
gi|13096178|pdb|1HQM|C  Chain C, Crystal Structure Of Thermus ...   202    1e-50  
gi|21466005|pdb|1L9U|C  Chain C, Thermus Aquaticus Rna Polymer...   202    1e-50  
gi|46191128|ref|ZP_00120579.2|  COG0085: DNA-directed RNA poly...   202    1e-50
gi|85709549|ref|ZP_01040614.1|  DNA-directed RNA polymerase be...   202    1e-50
gi|68552535|ref|ZP_00591923.1|  DNA-directed RNA polymerase, b...   202    1e-50
gi|30248018|sp|P59643|RPOB_TROWH  DNA-directed RNA polymerase ...   202    1e-50
gi|20139789|sp|Q9KWU7|RPOB_THEAQ  DNA-directed RNA polymerase ...   202    1e-50
gi|71481438|ref|ZP_00661145.1|  DNA-directed RNA polymerase, b...   202    1e-50
gi|83751225|ref|ZP_00947639.1|  COG0085: DNA-directed RNA poly...   202    2e-50
gi|78188335|ref|YP_378673.1|  DNA-directed RNA polymerase beta...   202    2e-50  
gi|16124757|ref|NP_419321.1|  DNA-directed RNA polymerase beta...   202    2e-50  
gi|46360934|gb|AAS89200.1|  RpoB [Corynebacterium matruchotii]      202    2e-50
gi|16077175|ref|NP_387988.1|  DNA-directed RNA polymerase beta...   202    2e-50  
gi|41017746|sp|Q8GCR6|RPOB1_ENTFC  DNA-directed RNA polymerase...   202    2e-50
gi|41017744|sp|Q8GCR4|RPOB2_ENTFC  DNA-directed RNA polymerase...   202    2e-50
gi|84515197|ref|ZP_01002560.1|  DNA-directed RNA polymerase be...   202    2e-50
gi|46360944|gb|AAS89205.1|  RpoB [Corynebacterium ammoniagenes]     202    2e-50
gi|116748984|ref|YP_845671.1|  DNA-directed RNA polymerase, be...   202    2e-50  
gi|28377825|ref|NP_784717.1|  DNA-directed RNA polymerase beta...   202    2e-50  
gi|1350848|sp|P47767|RPOB_SPICI  DNA-directed RNA polymerase b...   202    2e-50
gi|46360970|gb|AAS89218.1|  RpoB [Corynebacterium glucuronolyticu   201    2e-50
gi|41017745|sp|Q8GCR5|RPOB3_ENTFC  DNA-directed RNA polymerase...   201    2e-50
gi|69246466|ref|ZP_00603961.1|  DNA-directed RNA polymerase, b...   201    2e-50
gi|11467373|ref|NP_043230.1|  RNA polymerase beta chain [Cyano...   201    3e-50  
gi|46360948|gb|AAS89207.1|  RpoB [Corynebacterium callunae]         201    3e-50
gi|85375719|ref|YP_459781.1|  DNA-directed RNA polymerase 140 ...   201    3e-50  
gi|23009165|ref|ZP_00050316.1|  COG0085: DNA-directed RNA poly...   201    3e-50
gi|16329957|ref|NP_440685.1|  DNA-directed RNA polymerase beta...   201    3e-50  
gi|114764154|ref|ZP_01443392.1|  DNA-directed RNA polymerase b...   201    3e-50
gi|114799111|ref|YP_761536.1|  DNA-directed RNA polymerase, be...   201    3e-50  
gi|38049094|gb|AAR10354.1|  RNA polymerase B subunit [Candidatus    201    3e-50
gi|46360960|gb|AAS89213.1|  RpoB [Corynebacterium cystitidis]       201    3e-50
gi|53715477|ref|YP_101469.1|  DNA-directed RNA polymerase beta...   201    3e-50  
gi|91763154|ref|ZP_01265118.1|  DNA-directed RNA polymerase [C...   201    3e-50
gi|41017794|sp|Q9F3X8|RPOB_PORCN  DNA-directed RNA polymerase ...   201    3e-50
gi|88802467|ref|ZP_01117994.1|  DNA-directed RNA polymerase be...   201    3e-50
gi|116334277|ref|YP_795804.1|  DNA-directed RNA polymerase, be...   201    3e-50  
gi|46360994|gb|AAS89230.1|  RpoB [Corynebacterium sundsvallense]    201    3e-50
gi|71083810|ref|YP_266530.1|  DNA-directed RNA polymerase [Can...   201    3e-50  
gi|88950291|ref|ZP_01152899.1|  DNA-directed RNA polymerase, b...   201    3e-50
gi|37521852|ref|NP_925229.1|  DNA-directed RNA polymerase beta...   201    4e-50  
gi|46360978|gb|AAS89222.1|  RpoB [Corynebacterium lipophiloflavum   201    4e-50
gi|92089238|ref|ZP_01274187.1|  DNA-directed RNA polymerase, b...   201    4e-50
gi|46360988|gb|AAS89227.1|  RpoB [Corynebacterium afermentans sub   201    4e-50
gi|89091381|ref|ZP_01164390.1|  DNA-directed RNA polymerase, b...   201    4e-50
gi|46360966|gb|AAS89216.1|  RpoB [Corynebacterium felinum]          201    4e-50
gi|88713022|ref|ZP_01107106.1|  DNA-directed RNA polymerase be...   201    4e-50
gi|84685445|ref|ZP_01013343.1|  DNA-directed RNA polymerase be...   201    4e-50
gi|41017813|sp|Q9X6Y1|RPOB_AQUPY  DNA-directed RNA polymerase ...   201    4e-50
gi|52840567|ref|YP_094366.1|  DNA-directed RNA polymerase beta...   201    4e-50  
gi|54293314|ref|YP_125729.1|  RNA polymerase B-subunit [Legion...   201    4e-50  
gi|41017593|sp|O86094|RPOB_LEGPN  DNA-directed RNA polymerase ...   201    4e-50
gi|46360950|gb|AAS89208.1|  RpoB [Corynebacterium camporealensis]   201    4e-50
gi|67935041|ref|ZP_00528065.1|  DNA-directed RNA polymerase, b...   201    4e-50
gi|32491271|ref|NP_871525.1|  hypothetical protein WGLp522 [Wi...   200    4e-50  
gi|15606949|ref|NP_214331.1|  RNA polymerase beta subunit [Aqu...   200    4e-50  
gi|116493170|ref|YP_804905.1|  DNA-directed RNA polymerase, be...   200    5e-50  
gi|117578865|emb|CAL67334.1|  DNA-directed RNA polymerase subu...   200    5e-50
gi|46199763|ref|YP_005430.1|  DNA-directed RNA polymerase beta...   200    5e-50  
gi|55981782|ref|YP_145079.1|  DNA-directed RNA polymerase beta...   200    5e-50  
gi|11465718|ref|NP_053862.1|  RNA polymerase beta chain [Porph...   200    6e-50  
gi|45439264|gb|AAS64308.1|  putative RNA polymerase beta subun...   200    6e-50
gi|108744243|gb|ABD62240.1|  beta subunit of RNA polymerase [Chlo   200    6e-50
gi|90417770|ref|ZP_01225682.1|  DNA-directed RNA polymerase be...   200    6e-50
gi|55139438|gb|AAV41383.1|  RpoB [Corynebacterium aurimucosum]      200    6e-50
gi|86134000|ref|ZP_01052582.1|  DNA-directed RNA polymerase be...   200    6e-50
gi|69938876|ref|ZP_00633237.1|  DNA-directed RNA polymerase [P...   200    7e-50
gi|78099440|gb|ABB20856.1|  RNA polymerase subunit B [Acinetobact   200    7e-50
gi|29348143|ref|NP_811646.1|  DNA-directed RNA polymerase beta...   200    7e-50  
gi|90994443|ref|YP_536933.1|  DNA-directed RNA polymerase beta...   200    7e-50  
gi|88807055|ref|ZP_01122570.1|  DNA-directed RNA polymerase be...   199    7e-50
gi|114319612|ref|YP_741295.1|  DNA-directed RNA polymerase, be...   199    7e-50  
gi|77413372|ref|ZP_00789565.1|  DNA-directed RNA polymerase, b...   199    7e-50
gi|110003980|emb|CAK98320.1|  dna-directed rna polymerase beta...   199    7e-50
gi|36333371|gb|AAP75743.1|  RNA polymerase beta subunit [Bosea ma   199    7e-50
gi|87198050|ref|YP_495307.1|  DNA-directed RNA polymerase, bet...   199    8e-50  
gi|89902356|ref|YP_524827.1|  DNA-directed RNA polymerase, bet...   199    8e-50  
gi|88909646|sp|Q5E238|RPOB_VIBF1  DNA-directed RNA polymerase ...   199    9e-50
gi|21672328|ref|NP_660395.1|  DNA-directed RNA polymerase beta...   199    9e-50  
gi|77410922|ref|ZP_00787278.1|  DNA-directed RNA polymerase, b...   199    9e-50
gi|22536344|ref|NP_687195.1|  DNA-directed RNA polymerase beta...   199    9e-50  
gi|91222738|ref|ZP_01258081.1|  DNA-directed RNA polymerase [P...   199    9e-50
gi|114570352|ref|YP_757032.1|  DNA-directed RNA polymerase, be...   199    1e-49  
gi|46360982|gb|AAS89224.1|  RpoB [Corynebacterium mycetoides]       199    1e-49
gi|22298184|ref|NP_681431.1|  DNA-directed RNA polymerase beta...   199    1e-49  
gi|88812764|ref|ZP_01128010.1|  DNA-directed RNA polymerase, b...   199    1e-49
gi|90417542|ref|ZP_01225463.1|  DNA-directed RNA polymerase be...   199    1e-49
gi|21909611|ref|NP_663879.1|  DNA-directed RNA polymerase beta...   199    1e-49  
gi|19745277|ref|NP_606413.1|  DNA-directed RNA polymerase beta...   199    1e-49  
gi|30249986|ref|NP_842056.1|  DNA-directed RNA polymerase beta...   199    1e-49  
gi|113968537|ref|YP_732330.1|  DNA-directed RNA polymerase, be...   199    1e-49  
gi|24371822|ref|NP_715864.1|  DNA-directed RNA polymerase, bet...   199    1e-49  
gi|114045700|ref|YP_736250.1|  DNA-directed RNA polymerase, be...   199    1e-49  
gi|117918650|ref|YP_867842.1|  DNA-directed RNA polymerase, be...   199    1e-49
gi|81096693|ref|ZP_00875028.1|  DNA-directed RNA polymerase, b...   199    1e-49
gi|78368995|ref|ZP_00839175.1|  DNA-directed RNA polymerase, b...   199    1e-49
gi|86147869|ref|ZP_01066174.1|  DNA-directed RNA polymerase be...   199    1e-49
gi|83855426|ref|ZP_00948955.1|  DNA-directed RNA polymerase be...   199    1e-49
gi|83858573|ref|ZP_00952095.1|  DNA-directed RNA polymerase be...   199    1e-49
gi|116491358|ref|YP_810902.1|  DNA-directed RNA polymerase, be...   199    1e-49  
gi|84393084|ref|ZP_00991850.1|  DNA-directed RNA polymerase be...   199    1e-49
gi|50083579|ref|YP_045089.1|  DNA-directed RNA polymerase beta...   199    1e-49  
gi|90413408|ref|ZP_01221401.1|  DNA-directed RNA polymerase be...   199    1e-49
gi|37912997|gb|AAR05326.1|  DNA-directed RNA polymerase beta s...   199    1e-49
gi|15674321|ref|NP_268495.1|  DNA-directed RNA polymerase beta...   199    1e-49  
gi|86158017|ref|YP_464802.1|  DNA-directed RNA polymerase, bet...   199    1e-49  
gi|46360980|gb|AAS89223.1|  RpoB [Corynebacterium mucifaciens]      199    1e-49
gi|78099452|gb|ABB20862.1|  RNA polymerase subunit B [Acinetobact   199    1e-49
gi|81251487|gb|ABB70065.1|  RpoB [Acinetobacter ursingii]           199    2e-49
gi|90581313|ref|ZP_01237110.1|  DNA-directed RNA polymerase be...   199    2e-49
gi|78099446|gb|ABB20859.1|  RNA polymerase subunit B [Acinetobact   199    2e-49
gi|89075377|ref|ZP_01161799.1|  DNA-directed RNA polymerase be...   199    2e-49
gi|46360976|gb|AAS89221.1|  RpoB [Corynebacterium imitans]          198    2e-49
gi|87301294|ref|ZP_01084135.1|  DNA-directed RNA polymerase be...   198    2e-49
gi|94500503|ref|ZP_01307034.1|  DNA-directed RNA polymerase, b...   198    2e-49
gi|90590328|ref|ZP_01245975.1|  DNA-directed RNA polymerase, b...   198    2e-49
gi|59713020|ref|YP_205796.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|28867847|ref|NP_790466.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|114567849|ref|YP_755003.1|  DNA-directed RNA polymerase [Sy...   198    2e-49  
gi|21672996|ref|NP_661061.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|75910405|ref|YP_324701.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|67922541|ref|ZP_00516049.1|  DNA-directed RNA polymerase, b...   198    2e-49
gi|77461307|ref|YP_350814.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|89095345|ref|ZP_01168262.1|  DNA-directed RNA polymerase be...   198    2e-49
gi|84703909|ref|ZP_01017737.1|  DNA-directed RNA polymerase, b...   198    2e-49
gi|106883895|ref|ZP_01351286.1|  DNA-directed RNA polymerase, ...   198    2e-49
gi|46360964|gb|AAS89215.1|  RpoB [Corynebacterium falsenii]         198    2e-49
gi|90407965|ref|ZP_01216138.1|  DNA-directed RNA polymerase, b...   198    2e-49
gi|90020571|ref|YP_526398.1|  DNA-directed RNA polymerase [Sac...   198    2e-49  
gi|70732889|ref|YP_262657.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|27904547|ref|NP_777673.1|  DNA-directed RNA polymerase beta...   198    2e-49  
gi|15640355|ref|NP_229982.1|  DNA-directed RNA polymerase beta...   198    3e-49  
gi|78099458|gb|ABB20865.1|  RNA polymerase subunit B [Acinetobact   198    3e-49
gi|26987188|ref|NP_742613.1|  DNA-directed RNA polymerase beta...   198    3e-49  
gi|28899696|ref|NP_799301.1|  DNA-directed RNA polymerase beta...   197    3e-49  
gi|34540221|ref|NP_904700.1|  DNA-directed RNA polymerase beta...   197    3e-49  
gi|91770311|ref|ZP_01272138.1|  DNA-directed RNA polymerase, b...   197    4e-49
gi|116188095|ref|ZP_01477883.1|  hypothetical protein VchoM_02...   197    4e-49
gi|75828313|ref|ZP_00757748.1|  COG0085: DNA-directed RNA poly...   197    4e-49
gi|116628547|ref|YP_821166.1|  DNA-directed RNA polymerase, be...   197    4e-49  
gi|55821840|ref|YP_140282.1|  DNA-directed RNA polymerase beta...   197    4e-49  
gi|109896926|ref|YP_660181.1|  DNA-directed RNA polymerase, be...   197    4e-49  
gi|54296358|ref|YP_122727.1|  RNA polymerase B-subunit [Legion...   197    4e-49  
gi|223245|prf||0612199A  polymerase beta,RNA                        197    4e-49
gi|77955741|ref|ZP_00820087.1|  DNA-directed RNA polymerase, b...   197    4e-49
gi|396326|gb|AAC43085.1|  DNA-directed RNA polymerase, beta-subun   197    5e-49
gi|78221839|ref|YP_383586.1|  DNA-directed RNA polymerase, bet...   197    5e-49  
gi|223297|prf||0705170A  polymerase beta,RNA                        197    5e-49
gi|42818|emb|CAA23625.1|  rpoB [Escherichia coli] >gi|42821|em...   197    5e-49
gi|26250758|ref|NP_756798.1|  DNA-directed RNA polymerase beta...   197    5e-49  
gi|83319487|ref|YP_424065.1|  DNA-directed RNA polymerase, bet...   197    5e-49  
gi|24380333|ref|NP_722288.1|  DNA-directed RNA polymerase beta...   197    5e-49  
gi|53804616|ref|YP_113541.1|  DNA-directed RNA polymerase, bet...   197    5e-49  
gi|110807837|ref|YP_691357.1|  RNA polymerase, beta subunit [S...   197    5e-49  
gi|110644322|ref|YP_672052.1|  DNA-directed RNA polymerase bet...   197    5e-49  
gi|82778838|ref|YP_405187.1|  RNA polymerase, beta subunit [Sh...   197    5e-49  
gi|15834164|ref|NP_312937.1|  DNA-directed RNA polymerase beta...   197    5e-49  
gi|15804577|ref|NP_290618.1|  DNA-directed RNA polymerase beta...   197    5e-49  
gi|78099448|gb|ABB20860.1|  RNA polymerase subunit B [Acinetobact   197    5e-49
gi|62182607|ref|YP_219024.1|  DNA-directed RNA polymerase beta...   197    6e-49  
gi|88704391|ref|ZP_01102105.1|  RNA polymerase, beta-subunit [...   197    6e-49
gi|94984743|ref|YP_604107.1|  DNA-directed RNA polymerase, bet...   197    6e-49  
gi|88937666|ref|ZP_01143218.1|  DNA-directed RNA polymerase, b...   197    6e-49
gi|16762300|ref|NP_457917.1|  DNA-directed RNA polymerase beta...   196    7e-49  
gi|88909636|sp|Q57H69|RPOB_SALCH  DNA-directed RNA polymerase ...   196    7e-49
gi|16767407|ref|NP_463022.1|  DNA-directed RNA polymerase beta...   196    7e-49  
gi|29143788|ref|NP_807130.1|  DNA-directed RNA polymerase beta...   196    7e-49  
gi|78099428|gb|ABB20850.1|  RNA polymerase subunit B [Acinetobact   196    7e-49
gi|47919|emb|CAA28302.1|  unnamed protein product [Salmonella typ   196    7e-49
gi|116052305|ref|YP_788849.1|  DNA-directed RNA polymerase bet...   196    7e-49  
gi|114773734|ref|ZP_01450759.1|  DNA-directed RNA polymerase b...   196    7e-49
gi|107103782|ref|ZP_01367700.1|  hypothetical protein PaerPA_0...   196    7e-49
gi|94414345|ref|ZP_01294207.1|  hypothetical protein PaerP_010...   196    8e-49
gi|15599466|ref|NP_252960.1|  DNA-directed RNA polymerase beta...   196    8e-49  
gi|91228701|ref|ZP_01262614.1|  DNA-directed RNA polymerase be...   196    8e-49
gi|33152866|ref|NP_874219.1|  DNA-directed RNA polymerase beta...   196    8e-49  
gi|33863774|ref|NP_895334.1|  DNA-directed RNA polymerase beta...   196    8e-49  
gi|27364616|ref|NP_760144.1|  DNA-directed RNA polymerase beta...   196    8e-49  
gi|13508255|ref|NP_110204.1|  DNA-directed RNA polymerase beta...   196    8e-49  
gi|15616663|ref|NP_239875.1|  DNA-directed RNA polymerase beta...   196    9e-49  
gi|15903819|ref|NP_359369.1|  DNA-directed RNA polymerase beta...   196    9e-49  
gi|104779748|ref|YP_606246.1|  RNA polymerase, beta subunit [P...   196    9e-49  
gi|50365415|ref|YP_053840.1|  DNA-directed RNA polymerase beta...   196    9e-49  
gi|54310498|ref|YP_131518.1|  DNA-directed RNA polymerase beta...   196    1e-48  
gi|78099464|gb|ABB20868.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|78099438|gb|ABB20855.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|78099466|gb|ABB20869.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|116071172|ref|ZP_01468441.1|  DNA-directed RNA polymerase b...   196    1e-48
gi|78213583|ref|YP_382362.1|  DNA-directed RNA polymerase beta...   196    1e-48  
gi|78099456|gb|ABB20864.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|78099434|gb|ABB20853.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|147722|gb|AAA24581.1|  RNA polymerase beta subunit (rpoB) (...   196    1e-48
gi|116516435|ref|YP_817182.1|  DNA-directed RNA polymerase, be...   196    1e-48  
gi|78184182|ref|YP_376617.1|  DNA-directed RNA polymerase beta...   196    1e-48  
gi|15901784|ref|NP_346388.1|  DNA-directed RNA polymerase beta...   196    1e-48  
gi|47574111|ref|ZP_00244147.1|  COG0085: DNA-directed RNA poly...   196    1e-48
gi|94266150|ref|ZP_01289862.1|  DNA-directed RNA polymerase, b...   196    1e-48
gi|78099436|gb|ABB20854.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|71839066|ref|ZP_00678820.1|  DNA-directed RNA polymerase, b...   196    1e-48
gi|111611763|ref|ZP_01398851.1|  DNA-directed RNA polymerase [...   196    1e-48
gi|71278694|ref|YP_271413.1|  DNA-directed RNA polymerase, bet...   196    1e-48  
gi|78099462|gb|ABB20867.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|78099450|gb|ABB20861.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|51244969|ref|YP_064853.1|  DNA-directed RNA polymerase, bet...   196    1e-48  
gi|116183880|ref|ZP_01473843.1|  hypothetical protein VEx2w_02003   196    1e-48
gi|78099422|gb|ABB20847.1|  RNA polymerase subunit B [Acinetobact   196    1e-48
gi|46143683|ref|ZP_00134648.2|  COG0085: DNA-directed RNA poly...   196    1e-48
gi|56477587|ref|YP_159176.1|  DNA-directed RNA polymerase beta...   196    1e-48  
gi|78099444|gb|ABB20858.1|  RNA polymerase subunit B [Acinetobact   195    1e-48
gi|113951161|ref|ZP_01436751.1|  DNA-directed RNA polymerase, ...   195    1e-48
gi|114331772|ref|YP_747994.1|  DNA-directed RNA polymerase, be...   195    1e-48  
gi|88938867|ref|ZP_01144319.1|  DNA-directed RNA polymerase, b...   195    2e-48
gi|88807332|ref|ZP_01122844.1|  DNA-directed RNA polymerase be...   195    2e-48
gi|78099424|gb|ABB20848.1|  RNA polymerase subunit B [Acinetob...   195    2e-48
gi|89071237|ref|ZP_01158416.1|  DNA-directed RNA polymerase be...   195    2e-48
gi|39997954|ref|NP_953905.1|  DNA-directed RNA polymerase, bet...   195    2e-48  
gi|23129279|ref|ZP_00111111.1|  COG0085: DNA-directed RNA poly...   195    2e-48
gi|77816615|ref|ZP_00815789.1|  DNA-directed RNA polymerase, b...   195    2e-48
gi|78099430|gb|ABB20851.1|  RNA polymerase subunit B [Acinetobact   195    2e-48


Le résultat de l'alignement de séquences deux à deux donne:
     
>gi|57234592|ref|YP_181345.1|  DNA-directed RNA polymerase, beta subunit [Dehalococcoides ethenogenes 
195]
 gi|88909133|sp|Q3Z8V4|RPOB_DEHE1  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
 gi|57225040|gb|AAW40097.1|  DNA-directed RNA polymerase, beta subunit [Dehalococcoides ethenogenes 
195]
Length=1272

 Score =  260 bits (664),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 142/274 (51%), Positives = 192/274 (70%), Gaps = 23/274 (8%)

Query  7     LKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSVSRENNL  66
             +K++GFD  K++ +   + G A++  +++WLKD    DAS L   E+ +K   VS ++ L
Sbjct  1005  IKQQGFDGKKVFDE--RHPGLAKEVSLKLWLKDM-GVDASSLSGAELEKKAYEVSSQSRL  1061

Query  67    SAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGK  126
              +PI GK  + DG TG  FDQP+TVGN+Y+LKLIHLVEDK+HAR+TGPYSLI+QQPLGGK
Sbjct  1062  PSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGGK  1121

Query  127   AQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPES  186
             AQFGGQRFGEMEVWA+ AY  A+ LQEMLT+KSDD+ GR KAYE+IVKGE++IQPG+PES
Sbjct  1122  AQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVIQPGVPES  1181

Query  187   FHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQ--------DESISTSI-------GWDD  231
             F VL+KELQ LGL+VE++NE++ K A  EKV           E +S  I       G +D
Sbjct  1182  FKVLVKELQSLGLAVEVINEEV-KIAPSEKVAALTEANLPGSEDVSAEILPETLYAGAED  1240

Query  232   ISEEPLELLEIEELNLNDDSNLIVEEEESEESKE  265
             I +  + +++ ++ +L   SN    +EE  E+ E
Sbjct  1241  IEDSMMSVIDTDDQDLAMSSN----DEEVSENDE  1270


>gi|73748443|ref|YP_307682.1|  DNA-directed RNA polymerase, beta subunit [Dehalococcoides sp. 
CBDB1]
 gi|88909134|sp|Q3ZX01|RPOB_DEHSC  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
 gi|73660159|emb|CAI82766.1|  DNA-directed RNA polymerase, beta subunit [Dehalococcoides sp. 
CBDB1]
Length=1273

 Score =  258 bits (658),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 139/259 (53%), Positives = 191/259 (73%), Gaps = 10/259 (3%)

Query  7     LKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSVSRENNL  66
             +K++GFD  K++ +   + G A++  +++WLKD    DAS L   E+ +K   VS ++ L
Sbjct  1005  IKQQGFDGKKIFDE--KHPGLAKEVSLKLWLKDM-GVDASALSGAELEKKAYDVSSQSRL  1061

Query  67    SAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGK  126
              +PI GK  + DG TG  FDQP+TVGN+Y+LKLIHLVEDK+HAR+TGPYSLI+QQPLGGK
Sbjct  1062  PSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGGK  1121

Query  127   AQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPES  186
             AQFGGQRFGEMEVWA+ AY  A+ LQEMLT+KSDD+ GR KAYE+IVKGE+++QPG+PES
Sbjct  1122  AQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVLQPGVPES  1181

Query  187   FHVLLKELQGLGLSVELLNEDIDKYAEIEKVD--QDESISTSIGWDDISEEPL-ELLEIE  243
             F VL+KELQ LGL+VE++NE++ K A  EKV    + ++  S   D+IS E L E L   
Sbjct  1182  FKVLVKELQSLGLAVEVINEEV-KIAPSEKVSSLNEGNLPAS---DEISAEILPETLYAN  1237

Query  244   ELNLNDDSNLIVEEEESEE  262
               ++++DS + V + + ++
Sbjct  1238  TEDISEDSMMSVIDADDQD  1256


>gi|88933697|ref|ZP_01139367.1|  DNA-directed RNA polymerase, beta subunit [Dehalococcoides sp. 
BAV1]
 gi|88913819|gb|EAR33212.1|  DNA-directed RNA polymerase, beta subunit [Dehalococcoides sp. 
BAV1]
Length=1273

 Score =  258 bits (658),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 139/259 (53%), Positives = 191/259 (73%), Gaps = 10/259 (3%)

Query  7     LKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSVSRENNL  66
             +K++GFD  K++ +   + G A++  +++WLKD    DAS L   E+ +K   VS ++ L
Sbjct  1005  IKQQGFDGKKIFDE--KHPGLAKEVSLKLWLKDM-GVDASALSGAELEKKAYDVSSQSRL  1061

Query  67    SAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGK  126
              +PI GK  + DG TG  FDQP+TVGN+Y+LKLIHLVEDK+HAR+TGPYSLI+QQPLGGK
Sbjct  1062  PSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGGK  1121

Query  127   AQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPES  186
             AQFGGQRFGEMEVWA+ AY  A+ LQEMLT+KSDD+ GR KAYE+IVKGE+++QPG+PES
Sbjct  1122  AQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVLQPGVPES  1181

Query  187   FHVLLKELQGLGLSVELLNEDIDKYAEIEKVD--QDESISTSIGWDDISEEPL-ELLEIE  243
             F VL+KELQ LGL+VE++NE++ K A  EKV    + ++  S   D+IS E L E L   
Sbjct  1182  FKVLVKELQSLGLAVEVINEEV-KIAPSEKVSSLNEGNLPAS---DEISAEILPETLYAN  1237

Query  244   ELNLNDDSNLIVEEEESEE  262
               ++++DS + V + + ++
Sbjct  1238  TEDISEDSMMSVIDADDQD  1256


>gi|98660450|dbj|GAA02292.1|  unnamed protein product [Pelotomaculum thermopropionicum SI]
Length=1224

 Score =  231 bits (590),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 125/188 (66%), Positives = 149/188 (79%), Gaps = 7/188 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK  + DG TG PFD PITVG VYMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQFGG
Sbjct  1027  GKMTLYDGRTGEPFDSPITVGYVYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGG  1086

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAYTLQE+LTVKSDDV+GRVK YEAIVKGE + +PG+PESF VL+
Sbjct  1087  QRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFKVLI  1146

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEPLELLEIEELNLNDDS  251
             KELQ LGL V++L+ED D+  EI +V++D   +      D+ E   EL E+EE + ++D 
Sbjct  1147  KELQSLGLDVKVLSED-DQEIEIREVEEDIGETAKELGIDLQEG--ELPEVEEADYSED-  1202

Query  252   NLIVEEEE  259
                VE+E+
Sbjct  1203  ---VEDED  1207


>gi|27262300|gb|AAN87431.1|  DNA-directed RNA polymerase beta chain [Heliobacillus mobilis]
Length=1150

 Score =  226 bits (575),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 120/175 (68%), Positives = 142/175 (81%), Gaps = 3/175 (1%)

Query  62    RENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQ  121
             RE   S P+ GK  + DG TG PFD PITVG +Y+LKL HLV+DKIHARSTGPYSL+TQQ
Sbjct  940   REIFPSIPL-GKTILFDGRTGEPFDNPITVGYMYVLKLAHLVDDKIHARSTGPYSLVTQQ  998

Query  122   PLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQP  181
             PLGGKAQFGGQRFGEMEVWALEAY AAYTLQE+LTVKSDDV+GRVK YEAIVKGE I +P
Sbjct  999   PLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENIPEP  1058

Query  182   GLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQD-ESISTSIGWDDISEE  235
             G+PESF VL+KELQ LGL V++L+ED ++  EI++V++D    +  +G D   EE
Sbjct  1059  GVPESFKVLIKELQSLGLDVKILSED-EREIEIKEVEEDVAETAKELGIDIQGEE  1112


>gi|106895657|ref|ZP_01362738.1|  DNA-directed RNA polymerase, beta subunit [Clostridium sp. OhILAs]
 gi|106773054|gb|EAT29657.1|  DNA-directed RNA polymerase, beta subunit [Clostridium sp. OhILAs]
Length=1241

 Score =  224 bits (571),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 4/199 (2%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK K+ DG TG PFD  +TVG +YMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQFGG
Sbjct  1028  GKVKLYDGRTGEPFDNDVTVGYMYMLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGG  1087

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AA+TLQE+LTVKSDDV+GRVK YE IVKGE I +PG+PESF VL+
Sbjct  1088  QRFGEMEVWALEAYGAAHTLQEILTVKSDDVVGRVKTYECIVKGENIPEPGVPESFKVLI  1147

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEP---LELLEIEELNLN  248
             KELQ L L V++L E+ D   EI++  +D+S   SI + D++ E    LE++E  E   +
Sbjct  1148  KELQSLCLDVKVLTEE-DSEIEIKESVEDDSGELSIEYGDLTYEADGELEIIEPAEEEQD  1206

Query  249   DDSNLIVEEEESEESKEIE  267
              D + I E++      EI+
Sbjct  1207  TDVDYITEDDFESPDPEID  1225


>gi|106888501|ref|ZP_01355701.1|  DNA-directed RNA polymerase, beta subunit [Roseiflexus sp. RS-1]
 gi|106772262|gb|EAT28897.1|  DNA-directed RNA polymerase, beta subunit [Roseiflexus sp. RS-1]
Length=1282

 Score =  224 bits (570),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 124/152 (81%), Gaps = 0/152 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK  + DG TG  FD+P+TVG +YM+KL HLVEDKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  1114  PPDGKITLYDGRTGEAFDRPVTVGYIYMMKLAHLVEDKIHARSTGPYSLVTQQPLGGKAQ  1173

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQEMLTVKSDDV+GRVK YEAIVKGE I + G+PESF 
Sbjct  1174  FGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVVGRVKTYEAIVKGEPIQEAGVPESFK  1233

Query  189   VLLKELQGLGLSVELLNEDIDKYAEIEKVDQD  220
             VL+KELQ LGLSVE+L+ D       +  D D
Sbjct  1234  VLIKELQSLGLSVEVLSADETPVELTDDADSD  1265


>gi|78043606|ref|YP_361127.1|  DNA-directed RNA polymerase, beta subunit [Carboxydothermus hydrogenoformans 
Z-2901]
 gi|88909127|sp|Q3A9Q7|RPOB_CARHZ  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
 gi|77995721|gb|ABB14620.1|  DNA-directed RNA polymerase, beta subunit [Carboxydothermus hydrogenoformans 
Z-2901]
Length=1132

 Score =  222 bits (566),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 112/152 (73%), Positives = 130/152 (85%), Gaps = 1/152 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK +V DG TG PFD  +TVG VYMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  937   PEDGKIEVRDGRTGEPFDSRVTVGYVYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQ  996

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQE+LT+KSDDV+GRVK YEAIVKGE I +PG+PESF 
Sbjct  997   FGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGRVKTYEAIVKGENIPEPGVPESFK  1056

Query  189   VLLKELQGLGLSVELLNEDIDKYAEIEKVDQD  220
             VL+KELQ LGL V++L ++ D+  EI+++D D
Sbjct  1057  VLIKELQSLGLDVKVLTDN-DEEVEIKEIDDD  1087


>gi|76261395|ref|ZP_00769007.1|  DNA-directed RNA polymerase, beta subunit [Chloroflexus aurantiacus 
J-10-fl]
 gi|76163716|gb|EAO57884.1|  DNA-directed RNA polymerase, beta subunit [Chloroflexus aurantiacus 
J-10-fl]
Length=1227

 Score =  222 bits (565),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 112/152 (73%), Positives = 123/152 (80%), Gaps = 0/152 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK  + DG TG  FD P+TVG  YMLKL HLVEDKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  1059  PADGKVTLYDGRTGERFDNPVTVGYAYMLKLAHLVEDKIHARSTGPYSLVTQQPLGGKAQ  1118

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQEMLTVKSDDV+GRVK YEAIVKGE I + G+PESF 
Sbjct  1119  FGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVVGRVKTYEAIVKGEPIQEAGVPESFK  1178

Query  189   VLLKELQGLGLSVELLNEDIDKYAEIEKVDQD  220
             VL+KELQ LGLSVE+L+ D       + +D D
Sbjct  1179  VLIKELQSLGLSVEVLSADEKPVELSDDLDSD  1210


>gi|82501186|ref|ZP_00886552.1|  DNA-directed RNA polymerase, beta subunit [Caldicellulosiruptor 
saccharolyticus DSM 8903]
 gi|82400822|gb|EAP41677.1|  DNA-directed RNA polymerase, beta subunit [Caldicellulosiruptor 
saccharolyticus DSM 8903]
Length=1229

 Score =  220 bits (561),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 111/150 (74%), Positives = 126/150 (84%), Gaps = 0/150 (0%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK  + DG TG PFD  +TVG +YMLKL+HLV+DKIHARSTGPYSL+TQQPLGGKAQFGG
Sbjct  1032  GKTILYDGRTGEPFDNEVTVGYMYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQFGG  1091

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAYTLQE+LTVKSDDV GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1092  QRFGEMEVWALEAYGAAYTLQELLTVKSDDVTGRVKTYEAIVKGENIPEPGIPESFKVLV  1151

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDE  221
             KELQ L L V+LL+ED  +    E +D+DE
Sbjct  1152  KELQSLCLDVKLLSEDNKEIELKESIDEDE  1181


>gi|86739286|ref|YP_479686.1|  DNA-directed RNA polymerase, beta subunit [Frankia sp. CcI3]
 gi|108884786|sp|Q2JFI5|RPOB_FRASC  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit)
 gi|86566148|gb|ABD09957.1|  DNA-directed RNA polymerase, beta subunit [Frankia sp. CcI3]
Length=1141

 Score =  220 bits (560),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 111/174 (63%), Positives = 135/174 (77%), Gaps = 6/174 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK K+ DG TG P+  P+ VG +Y+LKL+HLV+DKIHARSTGPYS+ITQQPLGGKAQFGG
Sbjct  971   GKAKLFDGRTGEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGG  1030

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAY LQE+LT+KSDDV+GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1031  QRFGEMEVWALEAYGAAYALQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLI  1090

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESI---STSIGWDDISEEPLELLEI  242
             KE+Q L L+VE+L+ D     +IE  D DE +   +  +G D    EP  + E+
Sbjct  1091  KEMQSLCLNVEVLSSD---GVQIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV  1141


>gi|83591284|ref|YP_431293.1|  DNA-directed RNA polymerase, beta subunit [Moorella thermoacetica 
ATCC 39073]
 gi|109904224|sp|Q2RFN9|RPOB_MOOTA  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
 gi|83574198|gb|ABC20750.1|  DNA-directed RNA polymerase, beta subunit [Moorella thermoacetica 
ATCC 39073]
Length=1141

 Score =  219 bits (558),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P  GK  + DG TG PFD+PITVG +YMLKL HLV+DKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  922   PEDGKTILYDGRTGEPFDRPITVGYMYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQ  981

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAYTLQE+LTVKSDDV+GRVK YEAIVKGE + +PG+PESF 
Sbjct  982   FGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFK  1041

Query  189   VLLKELQGLGLSVELLN  205
             VL+KELQ LGL V++L+
Sbjct  1042  VLIKELQSLGLDVKVLS  1058


>gi|111220537|ref|YP_711331.1|  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit) [Frankia 
alni ACN14a]
 gi|111148069|emb|CAJ59737.1|  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase beta subunit) [Frankia 
alni ACN14a]
Length=1141

 Score =  217 bits (553),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 110/174 (63%), Positives = 134/174 (77%), Gaps = 6/174 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK  + DG TG P+  P+ VG +Y+LKL+HLV+DKIHARSTGPYS+ITQQPLGGKAQFGG
Sbjct  971   GKATLFDGRTGEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGG  1030

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAY LQE+LT+KSDDV+GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1031  QRFGEMEVWALEAYGAAYALQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLI  1090

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESI---STSIGWDDISEEPLELLEI  242
             KE+Q L L+VE+L+ D     +IE  D DE +   +  +G D    EP  + E+
Sbjct  1091  KEMQSLCLNVEVLSSD---GVQIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV  1141


>gi|116671530|ref|YP_832463.1|  DNA-directed RNA polymerase, beta subunit [Arthrobacter sp. FB24]
 gi|116611639|gb|ABK04363.1|  DNA-directed RNA polymerase, beta subunit [Arthrobacter sp. FB24]
Length=1171

 Score =  217 bits (552),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 115/203 (56%), Positives = 148/203 (72%), Gaps = 6/203 (2%)

Query  43    FDASKLKPTEVMQKCLSVSRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHL  102
             FD ++ +    +    +V+R+ +      GK ++ DG +G PF  PI+VG +Y+LKL HL
Sbjct  972   FDGAREEEITGLLDSTNVTRDGDRLINSSGKTRLFDGRSGEPFPDPISVGYMYILKLHHL  1031

Query  103   VEDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDV  162
             V+DKIHARSTGPYS+ITQQPLGGKAQFGGQRFGEMEVWALEAY AAYTLQE+LT+KSDD+
Sbjct  1032  VDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTIKSDDI  1091

Query  163   IGRVKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQDES  222
              GRVK YEAIVKGE I +PG+PESF VL+KE+Q L L+VE+L+ D      IE  D D++
Sbjct  1092  HGRVKVYEAIVKGENIPEPGVPESFKVLIKEMQSLCLNVEVLSTD---GTTIEMRDSDDA  1148

Query  223   ISTS---IGWDDISEEPLELLEI  242
             + T+   +G D    EP  + E+
Sbjct  1149  VFTAAEELGIDLSRAEPSSVEEV  1171


>gi|68230917|ref|ZP_00570093.1|  DNA-directed RNA polymerase, beta subunit [Frankia sp. EAN1pec]
 gi|68201409|gb|EAN15605.1|  DNA-directed RNA polymerase, beta subunit [Frankia sp. EAN1pec]
Length=1141

 Score =  217 bits (552),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 110/174 (63%), Positives = 134/174 (77%), Gaps = 6/174 (3%)

Query  72    GKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQFGG  131
             GK ++ DG TG P+  P+ VG +Y+LKL+HLV+DKIHARSTGPYS+ITQQPLGGKAQFGG
Sbjct  971   GKAELYDGRTGEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGG  1030

Query  132   QRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFHVLL  191
             QRFGEMEVWALEAY AAY LQE+LT+KSDDV+GRVK YEAIVKGE I +PG+PESF VL+
Sbjct  1031  QRFGEMEVWALEAYGAAYALQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLI  1090

Query  192   KELQGLGLSVELLNEDIDKYAEIEKVDQDESI---STSIGWDDISEEPLELLEI  242
             KE+Q L L+VE+L+ D      IE  D DE +   +  +G D    EP  + E+
Sbjct  1091  KEMQSLCLNVEVLSSD---GVSIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV  1141


>gi|72163053|ref|YP_290710.1|  DNA-directed RNA polymerase beta subunit [Thermobifida fusca 
YX]
 gi|88909644|sp|Q47LI5|RPOB_THEFY  DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase 
beta chain) (RNA polymerase subunit beta)
 gi|71916785|gb|AAZ56687.1|  DNA-directed RNA polymerase, beta subunit [Thermobifida fusca 
YX]
Length=1155

 Score =  216 bits (551),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 114/203 (56%), Positives = 143/203 (70%), Gaps = 6/203 (2%)

Query  43    FDASKLKPTEVMQKCLSVSRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHL  102
             FD ++      +  C+   ++ ++    FGK K+ DG TG PF +P+ VG  Y LKL HL
Sbjct  956   FDGAREDEISGLLSCVLPDQDGDILVNKFGKAKLYDGRTGEPFKEPVAVGYAYFLKLHHL  1015

Query  103   VEDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDV  162
             V+DKIHARSTGPYS+ITQQPLGGKAQFGGQRFGEMEVWALEAY AAY LQE+LT+KSDD+
Sbjct  1016  VDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDI  1075

Query  163   IGRVKAYEAIVKGEEIIQPGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQDES  222
              GRVK YEAIVKGE I +PG+PESF VL+KE+Q L L+VE+L+ D      IE  D +E 
Sbjct  1076  NGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSRD---GMSIEMRDSEED  1132

Query  223   I---STSIGWDDISEEPLELLEI  242
             +   +  +G D    EP  + E+
Sbjct  1133  VFRAAEELGIDLGRREPSSVEEV  1155


>gi|113939448|ref|ZP_01425302.1|  DNA-directed RNA polymerase, beta subunit [Herpetosiphon aurantiacus 
ATCC 23779]
 gi|113898876|gb|EAU17884.1|  DNA-directed RNA polymerase, beta subunit [Herpetosiphon aurantiacus 
ATCC 23779]
Length=1217

 Score =  216 bits (550),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 110/156 (70%), Positives = 125/156 (80%), Gaps = 1/156 (0%)

Query  69    PIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQQPLGGKAQ  128
             P   K  + DG TG  FD P+TVG  YMLKL HLVEDKIHARSTGPYSL+TQQPLGGKAQ
Sbjct  1049  PSDAKIDLYDGRTGEKFDNPVTVGYKYMLKLAHLVEDKIHARSTGPYSLVTQQPLGGKAQ  1108

Query  129   FGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQPGLPESFH  188
             FGGQRFGEMEVWALEAY AAY LQEMLTVKSDDV+GRVK YEAIVKG+ I + G+PESF 
Sbjct  1109  FGGQRFGEMEVWALEAYGAAYILQEMLTVKSDDVVGRVKTYEAIVKGDPINEAGVPESFK  1168

Query  189   VLLKELQGLGLSVELLNEDIDKYAEIEKVDQDESIS  224
             VL+KELQ LGLSV++L  D ++  E+   + D+ IS
Sbjct  1169  VLIKELQSLGLSVDVLTAD-ERPVELTDSEADDLIS  1203


Le groupe d'étude correspond à celui des bactéries :

     -GNSBactérie     gi|57234592|  (Dehalococcoides ethenogenes 195)
     -EUBactérie      gi|27262300|  (Heliobacillus mobilis)
     -Gram+Bactérie   gi|111220537| (Frankia alni ACN14a) 
     -ProtéoBactérie  gi|85715144|  (Nitrobacter sp. Nb-311A)
     -CyanoBactérie   gi|85715144|  (Nitrobacter sp. Nb-311A)
     -GSBactérie      gi|67939900|  (Chlorobium phaeobacteroides BS1)
     -CFBbactérie     gi|91215208|  (Psychroflexus torquis ATCC 700755)
     -Entérobactérie  gi|27904547|  (Buchnera aphidicola str. Bp (Baizongia pistaciae))
     -Mycoplasma      gi|83319487|  (Mycoplasma capricolum subsp. capricolum ATCC 27343)

Le groupe extérieur est celui des Eucaryotes :

     -EUCARYOTE   gi|11467373|  (Cyanophora paradoxa)


Format FASTA :

>ORF 
QVLQGSLKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSV
SRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQ
QPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQ
PGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEPLELL
EIEELNLNDDSNLIVEEEESEESKEIE

>GNSBact gi|57234592|  (Dehalococcoides ethenogenes 195)
MVSMLPKADAATGITRKSYAQLPEVVNVPNLIEMQLQSFVWFQEEGLRELIEEISPIKDFVGNRLELEFI
GYEFREPRLSEYECTQRDQTYSVPLYVKARLIVKTTGEIKEPFDLFFGDIPLMTALGTFITSGTERVVVS
QLLRSPGVYFTISDDPATGRPLCHTNLIPSRGAWLEFETSNRDVISVKIDGRRKIPVSTLLRAIGYSDDL
DILNLFEVIDNDPERHYIQSSIDRDPLIKDEISALIDIYSRLRPGDPPNADNARKLINEMFFDPQHYDLG
KVGRYKVNRRLELPDREVGDNRALTREDIVAIIKRIIMVNNGQDTPDDIDHLGNRRIRTVGELVQNQFRI
GLVRLERVARERMSIVNLEVVTPSALVNIRPVVSAVKEFFGGSQLSQFMDQTNPLAEITNKRRLSAMGPG
GLSRERAGFDVRDVHYSHYGRICPIETPEGPNIGLIGSLATYSRINRYGFVETPYRKVYSKLKNNDKKLV
GLKLAAAVSDKDKVLASAGSVVSEENFKLISKLPECDIQVMPFVSAEVKYMPADEEDRYIIAQANTRLDE
NGYFLDERIEARLAERYVIEPPEKIDYMDVSPKQIFSVAASLIPFLEHDDANRALMGANMQRQAVPLLRA
EAPMVATGMEREAARYSGQVIFAKRAGVAASVTSEKIIIRTAEGQDDEYLLKKFVRTNQGTCINQHAVIN
KGQKIEAGQVLADSSATENGELALGQNCVVAFMSWQGFNYEDAIILSERLVREDAFTSIHITKHELEAHD
TKLGGEEITRDIPNVGEESLRELDEDGIIRIGAEVGPDDILVGKITPKGETELSAEEKLLRAIFGEKARE
VKDTSLRMPHGEWGKVINVRVFSRENGDDLPARVNKWVQVWVAQKRKVSVGDKLAGRHGNKGVISIIAPV
EDMPYLPDGTPVDVVLNPIGVPSRMNLGQILETHLGWAGHLLGFRVATPVFDGADDTAIEDALARSWLSA
KAGATDMSPENKRPSTDTAKAVEWIKQQGFDGKKVFDERHPGLAKEVSLKLWLKDMGVDASSLSGAELEK
KAYEVSSQSRLPSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGG
KAQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVIQPGVPESFKVLVKELQ
SLGLAVEVINEEVKIAPSEKVAALTEANLPGSEDVSAEILPETLYAGAEDIEDSMMSVIDTDDQDLAMSS
NDEEVSENDERS

>EUBact gi|27262300| (Heliobacillus mobilis)
MVGHKTVELSPDSQKFWELAQLVKIPTNSELWFLDEGLREMFRDISPIQDFTGNLILEFIDYSLGEPKYS
VEECKERDVTFAAPLRVKVRLINKETGEVKEQEVFMGDFPLMTEKGTFIINGAERVIVSQLVRSPGVYFN
ETTDPTSGKKVYGATMIPNRGAWLEFESDANDNVYVRIDRTRKLPATVLIRALGYSNNVQVHELFDGDER
IRITLERDNTENTEEALVEIYKRLRPGEPPTVDSARSLLDTLFFDPKRYDLAKVGRYKINKRLGLQIEKE
IRHLTKDDIIATVREMLKLMQGEGHADDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQDVEV
ITPQVLINIRPVVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYG
RMCPIETPEGPNIGLIGSLSTFARINEFGFIETPYRKVDKERGAVTEQIDYLTADEEDKFIVAQANAPLD
EEGRFIQKKVNARHGHDILVVPMEMVDYMDVSPKQVVSIATALIPFLEHDDANRALMGANMQRQAVPLLR
TDAPYVGTGMEYKAAKDSGVVAIAKKPGVIERVSGDEIIIRSDDGTLEQHKLLKFLRSNQGTCINQKPIC
HKGQRVEAGDIIADGPSTDQGELALGRNVLVAFMTWEGYNYEDAILVNEKLVREDYFTSIHIEEYECDSR
DTKLGPEEITRDIPNVGEEVLKDLDDRGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKAR
EVRDTSLRVPHGEAGKIVDVKVFSRENGDELAPGVNQLVRCYIAQKRKISQGDKMAGRHGNKGVISRIMA
EAEMPYLPDGTPVEIVLNPLGVPSRMNIGQVLECHLGWASKNIDRGLLADGEPSGERGIRVATPVFDGAT
EEDIYEFLTQARLPELAETAMSDARTEHMREIFPSIPLGKTILFDGRTGEPFDNPITVGYMYVLKLAHLV
DDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIV
KGENIPEPGVPESFKVLIKELQSLGLDVKILSEDEREIEIKEVEEDVAETAKELGIDIQGEERPEADNVP
SPVAEESDDEEDLDFAAGFLQDALDELEEE

>Gram+Bact gi|111220537| (Frankia alni ACN14a) 
MAASRSSSRISFAKIIEPLEVPDLLALQTQSFDWLIGSDAWAERVQEAIDSGRDDVPITSGLEEVFEEIS
PIEDFSGSMSLSFRDHRFEPPKYSVEECKDKDMTFSAPLFVTAEFTNNTTGEIKSQTVFMGDFPLMTPKG
TFVINGTERVVVSQLVRSPGVYFERSLDKASDKDLYSCKVIPSRGAWLEFEIDKRDTVGVRIDRKRRQSV
TVLLKALGWDEARILERFGDFPSMRITLEKDHTASQDDALLDIYRKLRPGEPPTRESAQTLLENLFFNPK
RYDLAKVGRYKVNKKLTLEIAHDVGVLTEDDIVRTIEYVVKLHAGADPAEYEVDDIDHFGNRRLRTVGEL
IQNQVRLGLARMERVVRERMTTQDVEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGLTHKRR
LSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSTFARVNPFGFVETPYRKVVNGRV
TDQIDYLTADEEDRHVKAQANTPLSPDGTFAEDRVLVRRKGGEVEFIPPDEVDYMDVSPRQMVSVATAMI
PFLEHDDANRALMGSNMQRQSVPLLRSEAPLVGTGMEARAAKDAGDVVVCVQAGVVEDLSADYITVMHDD
GTRRTYRLAKFRRSNQGTCINQKPIVFEGDRVEAGQVIADGPCTDNGEMALGKNLLVAFMPWEGHNYEDA
IILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVAEEVLADLDERGIIRIGAEVSPGDVLVG
KVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDGDELPPGVNELVRVYVA
QKRKITDGDKLAGRHGNKGVIAKILPQEDMPFLEDGTPVDIVLNPHGVPRRMNIGQILETHLGWVAKTGW
QVDAGTEDWKERLRGIGADSSTPGTNVATPVFDGAREEEITGLLDSTLPNRDGVQLIGSSGKATLFDGRT
GEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYAL
QELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDGVQIEMRDTDEDVF
RAAEELGIDLSRREPSSVEEV

>ProteoBact gi|85715144|  (Nitrobacter sp. Nb-311A)
MVQQTFTGRKRVRKFFGHIREVAAMPNLIEVQKASYDQFLMVDEPEGGRLDEGLQAVFKSVFPINDFSGT
SQLEFVRYEFEAPKYDVDECRQRGMTYAAPLKVTLRLIVFDIDEETGAKSVKDIKEQDVYMGDIPLMTMN
GTFVVNGTERVIVSQMHRSPGVFFDHDKGKTHSSGKLLFAARVIPYRGSWLDIEFDAKDIVFARIDRRRK
IPVTSLMFALGLDSEEILSTFYKKIVYKRAKSGGHSDGWRVPYDPVRFRGYSTLNDLIDADTGKVVLEAG
KKLTVRAARQLQEKGLKALRMSDEELVGMYLAEDLVNPKTGEIYAEAGEEITEKSLKALNEEGYKELPLL
DIDHVNVGPYIRNTLAADKNMTREDALFDIYRVMRPGEPPTLESAQNMFQSLFFDAERYDLSAVGRVKMN
MRLDLDAPDTYRTLRKEDILAVIKTLVDLRDGKGEIDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIK
ERMSSVDIDTVMPQDLINAKPAAAAVREFFGSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFE
VRDVHPTHYGRICPIETPEGPNIGLINSLATFARVNKYGFVETPYRKVKDGRVTDEVVYLSAMEEGRYHV
AQANLPLDNRGRFTEDLVVCRHAGEVLPVTPDKVDFMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQ
RQAVPLVRAEAPFVGTGMEGVVARDSGAAIAARRSGVIDQIDATRVVIRATEDLDPTKSGVDIYRLMKYQ
RSNQSTCINQRPLVKVGDTVRKGDIIADGPSTDLGELALGRNVLVAFMPWNGYNFEDSILLSERIVKEDV
FTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEALKNLDEAGIVYIGAEVRAGDILVGKITPKGESPMTP
EEKLLRAIFGEKASDVRDTSLRVPPGVQGTIVEVRVFNRHGVDKDERALAIEREEIERLAKDRDDEQAIL
DRNVYGRLADLLENRQGIAGPKGFKKDTKITRSVLEEYPKSQWWLFASPNDKLMAEIEAMRKQYDESKKG
LEQRFLDKVEKLQRGDELPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSKIVPIEDMPFLEDGTHA
DIVLNPLGVPSRMNVGQILETHLGWACAGLGRRIGQAVDAYLASTKQETKPLKETLKKVYGDNETIKSLN
DHELVELGRNLSRGVPIATPVFDGAKETDIEQMLELAGMDRSGQSTVYDGRTGDPFDRKVTVGYIYMLKL
HHLVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVY
EAIVRGDDTFEAGIPESFNVLVKEMRSLGLNVDLHNSKIGDMMPTSEAAE

>CyanoBact gi|85715144| (Nitrobacter sp. Nb-311A)
MVQQTFTGRKRVRKFFGHIREVAAMPNLIEVQKASYDQFLMVDEPEGGRLDEGLQAVFKSVFPINDFSGT
SQLEFVRYEFEAPKYDVDECRQRGMTYAAPLKVTLRLIVFDIDEETGAKSVKDIKEQDVYMGDIPLMTMN
GTFVVNGTERVIVSQMHRSPGVFFDHDKGKTHSSGKLLFAARVIPYRGSWLDIEFDAKDIVFARIDRRRK
IPVTSLMFALGLDSEEILSTFYKKIVYKRAKSGGHSDGWRVPYDPVRFRGYSTLNDLIDADTGKVVLEAG
KKLTVRAARQLQEKGLKALRMSDEELVGMYLAEDLVNPKTGEIYAEAGEEITEKSLKALNEEGYKELPLL
DIDHVNVGPYIRNTLAADKNMTREDALFDIYRVMRPGEPPTLESAQNMFQSLFFDAERYDLSAVGRVKMN
MRLDLDAPDTYRTLRKEDILAVIKTLVDLRDGKGEIDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIK
ERMSSVDIDTVMPQDLINAKPAAAAVREFFGSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFE
VRDVHPTHYGRICPIETPEGPNIGLINSLATFARVNKYGFVETPYRKVKDGRVTDEVVYLSAMEEGRYHV
AQANLPLDNRGRFTEDLVVCRHAGEVLPVTPDKVDFMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQ
RQAVPLVRAEAPFVGTGMEGVVARDSGAAIAARRSGVIDQIDATRVVIRATEDLDPTKSGVDIYRLMKYQ
RSNQSTCINQRPLVKVGDTVRKGDIIADGPSTDLGELALGRNVLVAFMPWNGYNFEDSILLSERIVKEDV
FTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEALKNLDEAGIVYIGAEVRAGDILVGKITPKGESPMTP
EEKLLRAIFGEKASDVRDTSLRVPPGVQGTIVEVRVFNRHGVDKDERALAIEREEIERLAKDRDDEQAIL
DRNVYGRLADLLENRQGIAGPKGFKKDTKITRSVLEEYPKSQWWLFASPNDKLMAEIEAMRKQYDESKKG
LEQRFLDKVEKLQRGDELPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSKIVPIEDMPFLEDGTHA
DIVLNPLGVPSRMNVGQILETHLGWACAGLGRRIGQAVDAYLASTKQETKPLKETLKKVYGDNETIKSLN
DHELVELGRNLSRGVPIATPVFDGAKETDIEQMLELAGMDRSGQSTVYDGRTGDPFDRKVTVGYIYMLKL
HHLVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVY
EAIVRGDDTFEAGIPESFNVLVKEMRSLGLNVDLHNSKIGDMMPTSEAAE

>GSBact gi|67939900| (Chlorobium phaeobacteroides BS1)
MADKTQKKCIAFSKIQSIVNPPDLLQVQLDSFKRFIQDSVPLAKRKDQGLEKVLRSAFPITDTRGLYLLE
YISYTFDKPKYTVEECIERGLTYDVSLKVKLKLSYKDEPDEQDWKETIQQEVYLGRIPYMTDRGTFIVNG
AERVVVAQLHRSPGVVFSEAIHPNGKKMYSAKIVPTRGSWIEFQTDINNQIYVYIDQKKNFLVSALLRAI
GFTKDEDILSLFDLIEEVPVKANKKEYLIGKNLASDIIDMQTGEVVSARTAITEEILDQITAAGSKTVRI
MKPGTGEKGLDKSVVTNTILNDSSATEEEALEIVYEELRANEAPDIDAARSFLERTFFNQKKYDLGDVGR
YRINKKLGKEHEAFKEFLSGQPELKALSDSIYEKILQTIQSYSDEPISDDIMVLTHYDIIAVINYLIKLV
NGQAEVDDVDHLANRRVRTVGEQLAAQFVIGLARMGKNVREKLNSRDTDKIAPADLINARTVSSVVSSFF
ATSQLSQFMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLISSLS
VYAEINDKGFIQAPYRVVEKGIVTDKVEMLSAEDEENKITVPVSVKFDENRRITTETVQARTKGDYPVVD
AEQVDYMDVSPIQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLVADAPLVGTGMEAKVARDSRAVV
LAEGDGVIESVTAESIRVRYDMHEDEDDRMIMLDPDEGVKTYNLIKFKRSNQDTCISQKPVVRTGQKLEK
GDVLADGPSTENGELALGKNVLVAFMPWRGYNFEDAIVLSERLVYDDVFTSIHIHEFEANVRDTKRGEEQ
FTRDIYNVSEDALRNLDENGIIRIGAEVKERDILVGKITPKGESDPTPEEKLLRAIFGDKSSDVKDASMH
VPAGMKGIVIKTKLFSRKKKVGLDIRERQEAIDALFERRTADLRSRFNTWMNQLFEGKKSTGIYNLKGKE
IVPAGSVLDAETLGKFAGPGFLESVDLSKGIVKDAKANATLLRLCREYRLMLKDMEDERENEKYKLNIGD
ELPPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKILPIEDLPFMGDGTPVDIVLNPLGVPSRMNIG
QLYETSLGWAARALGVQFKTPIFDGATYTEVQEQLEKAGLPMHGKVRLYDGRTGEPFDDEVTVGYIYMLK
LSHLVDDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAANILREMLTVKSDDVVGRNKT
YESIVKGQNLPDPGTPESFNVLVRELQGLGLEIRIDNKVP

>CFBbact gi|91215208| (Psychroflexus torquis ATCC 700755)
MLAIHNERISFSSVQNKPDYPDFLDIQVKSFQDFFQLETKPEERSNEGLYNTFKENFPITDTRNQFVLEF
LDYFVDPPRYSIQECIERGLTYSVPLKARLKLYCTDPEHEDFETIVQDVYLGTIPYMTPSGTFVINGAER
VVVSQLHRSPGVFFGQSFHANGTKLYSARVIPFKGSWIEFATDINSVMYAYIDRKKKLPVTTLFRAIGFE
RDKDILEIFDLAEEVKVSKTGLKKYLGRKLAARVLNTWYEDFVDEDTGEVVSIERNEIVLDRDTVLEKDH
IEEILETGSKTILLHKEENLTGDYAIIYNTLQKDPTNSEKEAVEHIYRQLRNAEPPDEETARGIIDKLFF
SDQRYNLGEVGRYRMNKKLGLNISMDSKVLTKLDIITIIKYLIELVNSKAEVDDIDHLSNRRVRTVGEQL
SQQFGVGLARMARTIRERMNVRDNEVFTPIDLINAKTLSSVINSFFGTNQLSQFMDQTNPLAELTNKRRL
SALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLISSMSVYGKVNSMGFIETPYRKVENGKID
FKSDPLYLSAEEEENKLIAQANIPISEDGAITSERVIARMEGDFPVVDPKDVDYIDVAPNQISSISASLI
PFLEHDDANRALMGSNMMRQALPLLRVDAPIVGTGLERRVAQDSRVLINAEGEGRVQYVDARKIIIDYDR
TENERLVSFDEDHKTYNLIKFRKTNQGSTINLKPIVRVGDRVTKGQVLCEGYATDNGELALGRNMKVAFM
PWKGYNFEDAIVISERVVKDDILTSVHIDEYSLEVRDTKLGNEELTSDIPNVSEEATKDLDEHGMIRIGA
EIKPGDILIGKITPKGESDPTPEEKLLRAIFGDKAGDVKDASLKASPSLNGVVIDKKLFTRAVKDKRKRA
QDKQEIDALEGNFQIKFEDLRNRLIDKLFGIVGGKTAQGVQNDLGEDTLPKGKKYTLKMLNSVEDFSHLT
KGTWTTDKGTNALVADLLHNYKIKQNDLQGNLRREKFTITVGDELPSGILKLAKIYVAKKRKLKVGDKMA
GRHGNKGIVAKIVREEDMPFLDDGTPVDIVLNPLGVPSRMNIGQIYETVLGWAGQKLGKKFATPIFDGAT
LDQINELTDEAGIPRFGHTYLFDGGTGERFDQPATVGVIYMLKLGHMIEDKMHARSIGPYSLITQQPLGG
KAQFGGQRFGEMEVWALEAYGASATLREILTVKSDDVVGRAKTYEAIVKGEPMPEPGLPESFNVLMHELK
GLGLDIRLEE

>Enterobact gi|27904547| (Buchnera aphidicola str. Bp (Baizongia pistaciae))
MVVYSSTEKKRIRKDFGKRPKVLDIPYLLSIQLNSFQKFIKHDPNGIHGLESAFRSIFPIRSYNGNSELQ
YINYKLGQPIFNVKECQTRGMTYSSPLRVKLRLVIYEKETLDITVKDIKEQEVYMGEIPLMTTNGTFIIN
GTERVVVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFFRIDRRRKLPISII
LKALNYNTEQILDTFFKKNIFKFTENSILMKLVPHRLRGETASFDICIDNKTYIKKGQRITARHINILKE
KKIHTIKVPTEYLIGKISAKNYFNKKTNEIIVSANTELNINIIKELKNNEYTNIETIFTNDLDHGPYISE
TLNIDPTHDKLSALVEIYRMMRPGEPPTREAAENLFENLFFSEERYDLSSVGRMKFNRSLQKQNITERGV
LNQSDIISVIKKLIDIRNGHGEIDDIDHLGNRRVRSVGEMAENQFRIGLIRVERAVKDRLSLGDLDMLMP
QDMINAKPISAAIKEFFGSSQLSQFMDQNNPLSEITHKRRISALGLGGLTRERAGFEVRDVHPTHYGRVC
PIETPEGPNIGLINSLSVYAQTNSYGFLETPYRKIHNGKVTNEIKYLSAIEEGNFIIAQANTNLDETGAF
VEDLITCRYKGESSLFNKNQINYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRSEKPL
VGTGMERAVAVDSGVTIIAKRGGIVQYVDASRIIIKVKKNEINSEEAGIDIYNLKKYTRSNQNTCINQIP
CISLGENVEKGNVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILISEKVVQEDRFTTIHIQELACI
SRDTKLGSEEITSDIPNVGEAALSKLDESGIVYIGAEVNGGDILVGKVTPKGETQLTPEEKLLRAIFGEK
ASDVKDSSLRVPNGVLGTVIDVQIFTRDGVKKDKRALEIEEMQLKQAKKDLTEEQKVFELGLFTQIKSTL
INSGMNIDQLNKIPKSELFKVKVTNNLYQKKIHKLFLKYEELKKCFNKKLETTRNKITQGDDLAPGVLKI
VKVYLAVKRHIQPGDKMAGRHGNKGVISKINPIEDMPYDQNGLPVDVVLNPLGVPSRMNIGQILETHLGL
ASKGLGNIIDTMLKQQKSILNIRKFIQKAFNLGNNTRQKTNLNNFSDDEILSLAKNFKNGIPISTPVFDG
AQESEIKALLKLADLPSSGQITLFDGRTGEKFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPL
GGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNYKMEPGMPESFNVLLKE
IRSLAINIELENE

>Mycoplasma gi|83319487| (Mycoplasma capricolum subsp. capricolum ATCC 27343)
MAYKIRKINRNVERRDYTKVSMNLSLPNLIGIQTETFEWFKTKGIQEVLDEFFPILSFDGSSVLTLENWG
FKEPRLSVRQAREESKIYDAPIYANLKLSVNKTEEIQKEFDGVDQEDTLKVLTHWLEEKTGNGNITFKQQ
SQNSYFFEITIKKSEKPDLIQIDIIEDKKTSLICNVSIYKSGEVFLGDFPLMTEAGTFIINGSQKVIVSQ
LVRSPGAYFNKELNRKTGEMIYFADIIPSRGTWLEYETDSKKIGSDAINPLYVKIDKSRKTTATSLLLAF
GISKDDILNIFDNDEVLVETLQQDSIIGDFKIDWSNQVQEIYKKIRQGETATSEGASKFINSILFDKRKY
DLTKAGRFKLKQKLSIKNRILNKVIAEDILDANNNVLIAKDTEVTKNNIQEISKILDQDVMSIDLKYLSD
IPGNRKVQKIRVYKDSELKTDTTCLIGLTNSSNEEFITVADILSTVSYLLNLKYNIGEIDDIDNLGNRRV
RTVGELLQNQFRMGLNRIDKNVKEKLATSDLYKVKTSTIINAKPLTAIIGEFFNLSQLSQFMDQINPLSE
LTNKRRLTALGPGGLSRDRAGLEVRDVHPSHYGRICPIETPEGPNIGLINNLSTYARVNEYGFITTPYRK
VINGIIQNDQVEYLTADQEKNFIIAQSNVNQDENGKILDEIIVSRFNGDDYMAKVEEIHYIDVSPKQIVS
VATSGIPFLENDDANRALMGANMQRQAVPLIKPESPIVATGIEFEAARDSGEAIVAKEDAIVKYVDSKTI
ITDGESGIRTYILSDYERSNNGTSLTQSPIVKVGDVVKKGEIIADGPSMDQGELAIGQNVVVAFSTYNGY
NFEDAIVMSERIVIDDRFTSIHIDEYTLEVRNTKQGQEEVTREIPNMSEQAKRHLDAEGIVAIGTEVKVG
DVLVGKVTPKGQVQLSPEDKLLHAIFGEKSRNVKDNSLRVPNGGEGIVQSIKRFKAKSALNPDGIELPAD
IIEVIKVYVVQKRKIQEGDKMSGRHGNKGIISRILPIEDMPHLEDGTPVDIILNPQGVPSRMNIGQILEI
HLGMAAKKLNQKVITPVFEGLNEKELEEIMAEAGMTNYGKVTLIDGQTGEPFDKPIAVGVMYMLKLSHMV
DDKIHARNVGPYSLITQQPLGGKAQNGGQRFGEMEVWALEAYGAAHTLREILTIKSDDIKGRSKTYEAIV
RSKRIPEPGIPESFNVLSKEIMGLGFNMYMIDETGEKSAINAYDKKDFEIDNYDDEILIKTDNLYIDDQD
VDAEFEDLTYVDENDILNSFELDNEEE


>EUCARYOTE gi|11467373|  (Cyanophora paradoxa)
MTQLTDTSLIPFDLLEIQKASFKWFFEEGLIEEIENFSPVIDLRGNFEVHFYLKNYELEAPTFTLEEAKQ
RDLTYAAQLYIPVELRDLETGIVKQDRIFFGEIPLMTDRCTFLINGVERVIINQIIRSPGIYYSVNTDEQ
GTRTYDVTIISNRGAWLKFEVDKDDLIWMRIDKTHRLPCHIFLKALNLSESEILSALTHPEFLQKTIYEH
GDCTEEEALIEFHRQLRPGEPPNSIQGRYLLYSRFFDPKRYDLGFVGRYKLNKKLNLNVSPNIRILTTQD
ILEILNYLINLQFGMGQIDDIDHLGNRRVKAVGELLQSQLRIGLNRLERLIHDRLSMLTTKSFKKRKKLT
TLINAKPINECLKEFFGSSQLSQFMDQTNPLAELIHKRRLTILGPGGLSRDRAGCAVRDIHPSHYGRICP
IETPEGQNAGLVGSLTTHAHLNQYGFIETPFYKVEKGYIQKELGIIYLTADEEDQYRIAAADVLINETNK
IIGEDISVRYRQEFITTKIDQIDFIAISPLQTFSVSTSLIPFLEHDDANRALMGSNMQRQAVPLLHAEKP
LVGTGLEFQVAKDSRRVLINKSEGLVKRVTGDHICIQTDTGKEINYTLIKYQRSNQDTCITQRPIVFEGE
RVKKGQILADDTATDKGELALGQNLLVAYMPWEGYNYEDAILINERLVYEDVYTSIHIEKYETETRQTKL
GIEEITREIPNVNEYSLRNLDEKGIVSVGSWIKGGDILVGKVAPKAESDQPPEGKLLKAIFGEKNRDVRD
TSLRMPSGEKGRIVDVRIFIREFGEMLYPGANTANTIVRIYIAQKRKIQVGDKMAGRHGNKGIISKILPR
QDMPYLPDGTPIDIILNPLGVPSRMNVGQVYECLLGWAAEHLGVRFKLIPFDERFGKQASRTFIHEKLKE
AKELTNKNWLFNSNHPGKIQLFDGRTGESFDNPIMVGKAYMLKLVHLVDDKIHARSTGPYSLITQQPLGG
KAQQGGQRFGEMEVWALEAFGAAYTLQEILTIKSDDMLGRNEALKAIVKGKAIPRPGIPESFKVLMRELQ
ALCLDVVAYKIQNGDQDECEALAIDLSGSLATPIDNIIKEVIQQEELGEELTS

ORF finding

SMS:ORf commencant avec any codon, brin direct code génétique standard
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 803.
CAAGTTCTTCAAGGATCTTTGAAGGAAAAAGGGTTTGATAAAGATAAATTGTGGAGTGAC
GCAGTCTCTAACAGAGGCACTGCAAGGCAAGCATGTATGCAAATTTGGCTAAAAGACTAT
TGTAACTTTGATGCTTCGAAATTAAAGCCCACAGAAGTTATGCAAAAATGTTTATCTGTT
TCTAGAGAAAATAACTTGTCTGCTCCTATATTTGGAAAACAAAAGGTAATCGATGGATCT
ACTGGTATTCCTTTTGATCAGCCAATAACTGTTGGTAATGTATACATGCTTAAATTAATA
CACTTAGTTGAAGATAAAATACATGCTAGGTCAACTGGACCTTACTCATTAATTACCCAA
CAGCCATTAGGTGGTAAGGCACAGTTTGGAGGCCAAAGATTTGGAGAAATGGAAGTATGG
GCACTTGAAGCTTATTCTGCTGCATATACTTTACAAGAAATGTTGACAGTTAAGTCAGAT
GATGTAATAGGTAGGGTAAAGGCTTATGAGGCTATCGTAAAGGGTGAAGAAATAATTCAG
CCTGGGTTACCAGAATCTTTTCATGTTTTGCTCAAGGAATTGCAAGGTTTAGGGCTATCA
GTTGAGCTGCTAAATGAAGATATTGATAAATATGCGGAGATTGAAAAAGTTGACCAAGAT
GAATCAATTTCAACATCTATCGGTTGGGATGATATCAGTGAAGAGCCTTTAGAATTACTT
GAAATTGAAGAATTGAATCTTAATGATGATTCAAATTTAATAGTTGAAGAAGAAGAATCT
GAAGAATCCAAAGAAATAGAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
QVLQGSLKEKGFDKDKLWSDAVSNRGTARQACMQIWLKDYCNFDASKLKPTEVMQKCLSV
SRENNLSAPIFGKQKVIDGSTGIPFDQPITVGNVYMLKLIHLVEDKIHARSTGPYSLITQ
QPLGGKAQFGGQRFGEMEVWALEAYSAAYTLQEMLTVKSDDVIGRVKAYEAIVKGEEIIQ
PGLPESFHVLLKELQGLGLSVELLNEDIDKYAEIEKVDQDESISTSIGWDDISEEPLELL
EIEELNLNDDSNLIVEEEESEESKEIE

 SMS ORF commencant avec any codon, sens indirect avec code génétique standard
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 242.
TCTATTTCTTTGGATTCTTCAGATTCTTCTTCTTCAACTATTAAATTTGAATCATCATTA
AGATTCAATTCTTCAATTTCAAGTAATTCTAAAGGCTCTTCACTGATATCATCCCAACCG
ATAGATGTTGAAATTGATTCATCTTGGTCAACTTTTTCAATCTCCGCATATTTATCAATA
TCTTCATTTAGCAGCTCAACTGATAGCCCTAAACCTTGCAATTCCTTGAGCAAAACATGA


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
SISLDSSDSSSSTIKFESSLRFNSSISSNSKGSSLISSQPIDVEIDSSWSTFSISAYLSI
SSFSSSTDSPKPCNSLSKT*