ORF PP16590

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160035.1
Annotathon code: ORF_PP16590
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : clocri
Annotated on : 2008-03-19 18:52:37
  • CAMPAGNA christelle
  • LEYDIER chloé

Synopsis

Genomic Sequence

>AACY01160035.1 ORF_PP16590 genomic DNA
ATTAAAATGAAAGAACGCAAATTAAGAATGATTATTTCCTCAAAATTTTACCAAGTAATTATTATCTTGACATTGAAACTAATAAAAATAAATCTGCTAG
ATTAGACTTTGATAAATTAATTTTTAAATCTAATAAAACGAATTTTTTAATTGACTTTTTAAAATTAGATAAAGATGAATATCTTGAAAATTGTTTTCGA
CTAGAAAACTTGCTCGCCTAAGAAGTATATTCATTTTCGACCCAATTTAAATACTCTTGATTTACTGTTCCTGTTACATAAGTACCAGTAAAACAACTCA
TCTCCAAATGTTCAACAAGAGAATCACTTATTATAGATTTACGTAAATTTTCAACACTTTGATAAACGAGATTATCAATTTCAAGTTTATCAGCAATTTC
ACTTATTGTTCTATCATGAGCTATTAATTCATCTCTATTAGGCATATTAATTCCATAAACATGAGGAAAACGAACTGGAGGAGCAGCTGATGTGAAAGAA
ACTTTATTTGCTCCTGCATCTTTAGCCATCTGTACAATTTCTTTTGAAGTAGTACCTCTTACTATCGAATCATCAACTATTAATACATTTTTATTTTTAA
ATTCTGCACTCATAGCATTTAACTTTTGTCTTACGGATTTCTTACGTTTCTGTTGACCAGGCATAATAAATGTTCTACCAACATATCTATTTTTAAAAAA
GCCCTCTCTATACTCAATACCTAGCTGTCTTGCAACTTGCATAGCAGCAGGTCGTGAAGAATCAGGAATAGGCATTACAACATCAACATCTCCAGAAGTA
ATTATTTCCTTTATTGTTTCAGATAAATAATCTCCCATTTTCAAACGAGCTTTATACACTGAAATTCCATTCATAATTGAATCTGG

Translation

[1 - 666/886]   indirect strand
>ORF_PP16590 Translation [1-666   indirect strand]
PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKN
VLIVDDSIVRGTTSKEIVQMAKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISDSLVEHLEMSCFT
GTYVTGTVNQEYLNWVENEYTS

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

Arbre(s) issus de neighbor :


  11 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


     +--------bordepara (betaprotéobactérie)
     ! 
     !     +-------burksp  (betaprotéobactérie)  
  +--6   +-9 
  !  ! +-8 +--------polysp  (betaprotéobactérie)  
  !  ! ! ! 
  !  ! ! +------ralstoeu  (betaprotéobactérie)
  !  +-7 
  !    !             +ORF_PP1659
  !    !     +-------2 
  !    +-----4       +--prochloma (cyanobactérie)
  !          ! 
  !          +----------synesp  (cyanobactérie)  
  ! 
  !             +---azovin  (gammaprotéobactérie)  
  !    +--------1 
  5----3        +--pseudopu  (gammaprotéobactérie)
  !    ! 
  !    +-----------vibriosp (gammaprotéobactérie)    
  ! 
  +-----------------------------------------solusx9 (acidobactérie)  


Annotator commentaries

Pour conclure, nous avons eu une séquence codante. Nous avons ensuite fait une recherche d'ORF en utilisant les paramètres any codon, Search for ORFs in reading frame 1, 2, and 3 on the direct puis on the reverse strand, only return ORFs that are at least 60 codons long. Nous avons réalisé un blastp avec notre plus grand ORF. Nous avons trouvé un domaine proteique qui correspondait à une amydophosphoribosyltransférase. Nous avons ensuite réalisé un alignement multiple qui nous a permis de visualiser deux arbres phylogénétiques. Nous avons néanmoins choisi celui de neighbor joining car il semblait plus significatif. Grâce à ce dernier nous pouvons dire que notre séquence est celle d'une cyanobactérie qui a comme processus biologique la biosynthèse des bases pyrines et qui a une activité amidophosphoribosyl transférase. D'après les différentes fiches des séquences, nous n'avons pas trouvé de symbole de gène commun à tous les orthologues. Pour la construction de l'arbre nous avons pris comme groupe d'études: les gammaproteobacteries, les betaproteobacteries, les cyanobactéries car ils avaient une forte E-Value.Notre groupe extérieur était une acidobactérie.

Multiple Alignement

                      10        20        30        40        50        60
                       |         |         |         |         |         |
pseudopu      -------MCGIVGIVGKSNVNQALYDALTVLQHRGQDAAGIVTSHDGRLFLRKDNGLVRD
azovin        -------MCGIVGIVGKSNVNQALYDALTVLQHRGQDAAGIVTCHEGRLFLRKDNGLVRD
vibriosp      -------MCGIVGIVGTTPVNQSIYDALTVLQHRGQDAAGICTIESNRFRLRKANGLVKD
prochloma     -------MCGIVGIVSSDDVNQQIYDSLLLLQHRGQDSTGIATMENTIFHIHKAKGQVNT
ORF_PP16590   ------------------------------------------------------------
synesp        -------MCGIIGMLCVDSVNQQIYDNLLLLQHRGQDSAGIVTMDNHTFHVHKQRGRVRE
burksp        -------MCGIVGVISQSPVNQLIYDSLLLLQHRGQDAAGIATADGNNFHMYKANGMVRD
polysp        -------MCGVVGTVSHSPVNQLLYDALLLLQHRGQDAAGIATMNGNSFTMHKANGLVRD
ralstoeu      -------MCGIVGVVSATPVNQLIYDSLLLLQHRGQDAAGIATANGSTFHMHKANGLVRD
bordepara     -------MCGIVGVIGRGPVNQLLYDSLLLLQHRGQDAAGIATLQGNHFNMYKAHGLVRD
solusx9       MFDKFHDECGVVAIYGHPEASKLAYLGLYSLQHRGQESAGICTSDGIEVHTHKTMGHVAD
                                                                          
Prim.cons.    MFDKFHDMCGIVGIVG2SPVNQLIYD2LLLLQHRGQDAAGIATMDGNRFHMHKANGLVRD

                      70        80        90       100       110       120
                       |         |         |         |         |         |
pseudopu      VFQQRHMQRLVGNIGIGHVRYPTAGSSTS-AEAQPFYVNSPYG-ITLAHNGNLTNVEQLA
azovin        VFQQRHMQRLVGHMGIGHVRYPTAGSSSS-AEAQPFYVNSPYG-ITLAHNGNLTNVDQLS
vibriosp      VFEARHMQRLQGEVGIGHVRYPTAGSSSA-SEAQPFYVNSPFG-ITLAHNGNLTNANEVR
prochloma     AYRTRDMRNLIGKIGLGHVRYATKGSAESVEEAQPFYVNAPYG-IVLIHNGNLTNTRDLE
ORF_PP16590   ------------------------------------------------------------
synesp        AFRTRDMRKLLGNAGIGHVRYATRGAAASEEEVQPFYVNAPYG-ITFVHNGNLTNTHQLE
burksp        VFRTRNMRSLPGTYGIGQVRYPTAGSASSEAEAQPFYVNAPFG-IILAHNGNLTNWKQLK
polysp        VFRTRNMRSLVGNAGIGQVRYPTAGSASSEEEAQPFYVSAPYG-IILAHNGNLTNAPSLR
ralstoeu      VFRTRNMRSLPGAAGIGQVRYPTAGSASSEEEAQPFYVNAPYG-VILAHNGNLTNWEQLR
bordepara     VFRTRNMRALPGTSGVGQVRYPTAGSSASEEEAQPFYVNAPFG-IMFAHNGNLTNWRELR
solusx9       IFTSDVLATLPGPLAIGHTRYSTAGDTVL-LNAQPFSVDCNKGKVAIAHNGNITNATELR
                                                                          
Prim.cons.    VFRTRNMR2LPGNAGIGHVRYPTAGSASSEEEAQPFYVNAPYGKITLAHNGNLTN22QLR

                     130       140       150       160       170       180
                       |         |         |         |         |         |
pseudopu      KEIYESDLRHVNTNSDSEVLLNVFAHELAVR-GKLQPTEEDVFAAVSHVHSRCVGGYAVV
azovin        REIYESDLRHVNTSSDSEVLLNVFAHELAVR-GKLQPTEEDVFAAVSGVHRRCRGGYAVV
vibriosp      QKLFEKDRRHINTTSDSEVLLNVLAHEIDS--VKGNVTTEDVFRAVTNVHRTIRGAYAVT
prochloma     KQLFNIDKRHTNSSSDTEMLLNVLATELQEQIHNQELEPDIIFDAVNSLHKRIQGSYASI
ORF_PP16590   ------------------------------------------------------------
synesp        QDLFKIDRRHTNSTSDTEMLVNVLATEIQSQLTGRDLTPDQLFNAVASLHHRVQGSYAAI
burksp        DEMFRIDRRHLNTNSDSEVLLNVFAHELQLSTTGLELDPASVFKAVAGVHRRLQGSYAIV
polysp        VEMAYRDRRHINTSSDTEVLLNVLADELQKETNSAALDETAMFNAVTGVTSRVKGSYAVV
ralstoeu      EEMFRRDRRHINTHSDTEVLLNVLADELQRASNGMALDPDTIFTAVSGLHRRVRGSYAIA
bordepara     ESLYRADRRHINTNSDSEVLLNVLAHELQSAASGVSLDDDTIFRAVSAVHQRVKGAYAVV
solusx9       KDLERRG-AIFQASSDTEVVLHLMAHSSER----------TLAGALRDALLQLEGAFSLV
                                                                          
Prim.cons.    KELFR2DRRHINTSSD2EVLLNVLAHELQS3T3GL3L2PD2VF3AVSGVHRRV2GSYAVV

                     190       200       210       220       230       240
                       |         |         |         |         |         |
pseudopu      AMITGYGIVGFRDPHGIRPVVFGQRHT--DEGVEYMIASESVALDVLGFTLIRDLAPGEA
azovin        AMITGYGIVGFRDPNAIRPIVFGQRQT--DEGVEYMIASESVALDVLGFSLIRDLAPGEA
vibriosp      AMIIGHGMIAFRDPHGIRPLCLGKREV--NGRAEYMVASESVALDAVGFDFVRDVAPGEA
prochloma     ALLSGHGLLAFRDPFGIRPLVIGKRLSSKTKKEEWMVASESLVLENNDYQVVRDVDPGEA
ORF_PP16590   ------------------------------------------------------------
synesp        ALIAGHGMLAFRDPYGIRPLILGRRLS-EQGREEWIVASESLVIENSGYEIVRDVDPGEA
burksp        SLIAGYGLLAFRDPFGIRPLCIGKLET--EHGTEWMVASESVAVEGIGFEFVRDVQPGEA
polysp        SLIAGYGLLAFRDPFGIRPLCIGRIDT--PQGPEWMVASESVALEGLGFTFVRDVHPGEA
ralstoeu      AQIAGYGMLAVRDPFGIRPLCLGSVET--PTGKEWMVASESVALEGIGYKLERDVAPGEA
bordepara     AQISGYGMLAFRDPHGIRPLCIGRQET--EEGVEWMAASESVALEGSGFAFVRDVEPGEA
solusx9       FLAEDR-VIVARDPHGFRPLAMGEMEVS-GGRKCTVFASETCAFDLIGAVYLHDVEPGEM
                                                                          
Prim.cons.    ALIAGYGMLAFRDP2GIRPLCIG2RETS232GVEWMVASESVALEG2GF2FVRDVAPGEA

                     250       260       270       280       290       300
                       |         |         |         |         |         |
pseudopu      VYITEEGQLFTKQCAEAPKLQPCIFEHVYLARPDSIIDGVSVYKARLRMGEKLADKIMRE
azovin        VYITEHGKLFTRQCAESPKYSPCIFEHVYLARSDSFMDGVSIYKARLRMGEKLAEKIRRE
vibriosp      IYATFDGELYTKQCADNPKLNPCIFEFVYFARPDSFIDKISVYSARVEMGKKLGERIRED
prochloma     IFINLNGEFFSKQCSENPILCPCAFEYVYLARPDSIMNGISVYKARLKMGDYLSETIKES
ORF_PP16590   --------------------------------PDSIMNGISVYKARLKMGDYLSETIKEI
synesp        VFIDVDSNLHQRQCADSPRLIPCAFEYVYLARPDSVMNGISVYESRLRMGDRLAQTIAET
burksp        IFIDPAGNFHSQQCAEQPTLNPCMFEYVYLARPDSCLDGVPVYNVRLRMGDYLAEKIKRE
polysp        IYVDLDGNFYSRQCVPNAVLTPCIFEYVYMARPDSTIDGVTVYNVRMRMGDYLAEKIRKE
ralstoeu      IFIDLDGKLYSKQCAENAVLTPCIFEYVYLARPDSCIDGVPVYDARLRMGDYLAEKIRQE
bordepara     IFVDLDGRMTSRQCADNAQLVPCIFEYVYFARPDSLIDGVSVYDARLRMGEYLADKVARS
solusx9       VIVGPEG-VTRERYAPAQARSQCVFEHVYFARPDSIVFGRAVEESRENLGRLLARECP--
                                              .** :   .: . * .:*  *.      
Prim.cons.    IFIDLDGNL2S2QCAENPKL3PCIFEYVYLARPDSIIDGVSVYKARLRMGDYLAEKIR2E

                     310       320       330       340       350       360
                       |         |         |         |         |         |
pseudopu      RPDHDIDVVIPIPDTSRTAALELANRLGVKFREGFVKNRYIGRTFIMPGQAARKKSVRQK
azovin        RPEHDIDVIIPIPDTSRTSALELANHLGVKFREGFVKNRYIGRTFIMPGQAARKKSVRQK
vibriosp      YANLDIDVVIPIPETSCDIALQIAQAIDIPYRQGFVKNRYVGRTFIMPGQQQRKKSVRRK
prochloma     INTGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQQKRKKSVRQK
ORF_PP16590   ITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQQKRKKSVRQK
synesp        LPAGDIDVVMPIPDSARPSAMQVAKRLGLDYREGFYKNRYVGRTFIMPGQAERKKSVRQK
burksp        LPNVPIDVVMPIPDSSRPAAMQVAAKLGVEYREGFFKNRYVGRTFIMPGQAVRKKSVRQK
polysp        TNVDEIDVVMPIPDSSRPAAMQVAKKLGIDYREGFFKNRYIGRTFIMPGQAVRKKSVRQK
ralstoeu      VSAGDVDVVMPIPDSSRPAAMQVANRLGVNYREGFFKNRYVGRTFIMPGQAVRKKSVRQK
bordepara     MRLGDIDVVMPIPDSSRPAAMQLAHRLGLDYREGLIKNRYVGRTFIMPGQAVRRKSVRQK
solusx9       ---ADADLVVPVPDSGVAAAIGYADESGLPFRQALIRNHYVGRTFIEPSQAIRDFGVKLK
                    *:::*:*::.   *:  *   .: :*:.: :*:*:***** *.*  *  .*: *
Prim.cons.    3P2GDIDVVMPIPDSSRPAAMQVANRLG22YREGFFKNRYVGRTFIMPGQAVRKKSVRQK

                     370       380       390       400       410       420
                       |         |         |         |         |         |
pseudopu      LNAIELEFRGKNVMLVDDSIVRGTTCKQIIQMAREAGAKNVYFCSAAPAVRYPNVYGIDM
azovin        LNAIDLEFRGKNVMLVDDSIVRGTTCKQIIQMAREAGAKKVYFCSAAPAVRYPNVYGIDM
vibriosp      LNAIRSEFKDKNVLLVDDSIVRGTTSEQIIEMARDSGAKKVYMVSAAPEVRFPNVYGIDM
prochloma     LNAMSTEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANKVFFTSAAPPVRFPHVYGINM
ORF_PP16590   LNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANKVSFTSAAPPVRFPHVYGINM
synesp        LNALGTEFAGKNVLIVDDSIVRGTTSREIVQMARSAGANKVTFTSAAPPVRYPNVYGINM
burksp        LNAMSIEFKDKNVLIVDDSIVRGTTSHEIVQMARDAGAKSVIFASAAPPVKFPNVYGIDM
polysp        LNAMRIEFKDKTVLIVDDSIVRGTTSFEIVQMARESGAKKVIFASAAPPVRFPNVYGIDM
ralstoeu      LNAMGVEFKGKNVLIVDDSIVRGTTSFEIVQMARDAGANKVIFASAAPPVKYPNVYGIDM
bordepara     LNAIGMEFKGKNVLLVDDSIVRGTTSREIVDMARAAGANKVYFASAAPPVRFPNVYGIDM
solusx9       LNPVRHLLQGKRVVLVDDSIVRGTTSRKIVRMVRQAGAREVHLRISCPPTISPCFYGVDT
              **.:   : .* *::**********. :*: *.: :**..* :  :.* .  * .**:: 
Prim.cons.    LNAM33EFKGKNVLIVDDSIVRGTTSKEIVQMARDAGA2KVYFASAAPPVRFPNVYGIDM

                     430       440       450       460       470       480
                       |         |         |         |         |         |
pseudopu      PSVHELIAHNRTTEQVGELIGADWLVYQDLPDLIDSVGGGKIKIEQFDCAVFNGEYVTGD
azovin        PSAHELIAHGRSTEEVAELIGADWLVYQDLSDLIDAVGGGKVKIDNFDCAVFDGKYVTGD
vibriosp      PSATELIAHGRDNDTICKQIGADALIYQRLEDLVEAVGLGNQDITQFDTSVFNGEYVTGD
prochloma     PNRCELIAHDRTISEIANQLEIDNLVYQSVENLRKSIISESP-IEDLEMSCFTGIYVTGK
ORF_PP16590   PNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISDSL-VEHLEMSCFTGTYVTGT
synesp        PTRAELLAHGRTSDEISDVLGADHVVYQTVENLLESIVENTE-IKDLEMSCFDGHYVTGG
burksp        PTRGELVAHGRTDEDVAKIIGADHLIYQDVDDLRRAVRDINPKLERFEASCFDGNYITGD
polysp        PTRSELVAYGRTDAEINKMIGADQLIYQSVEDMKQAVRDINPNIQQFEASCFDGNYITGD
ralstoeu      PTRSELVAHNRTHEEIAKIIGADKLVYQDVEAMKQAVRDINPALKDFDASCFDGRYITGD
bordepara     PTQKELIATGRTDDEIARTIGADALIYQDLQDMQQAVRDINPRLSRFEASCFDGEYVTGD
solusx9       PTRSELIASNHSVEEIRRFVEADSVGYLSIGSLRKAVGDDEK--HEYCYACYTGDYPTEL
              *.  **:* .:    :   :  * : *  :  :  ::            : : * * *  
Prim.cons.    PTRSELIAHGRTDEEIAK3IGAD4LVYQDVEDLR2AV2DINPKIE2FEASCFDGEYVTGD

                     490       500       510       520
                       |         |         |         |
pseudopu      IDEAYLDRIEQARNDLAKVKNQAVS------AIIDLYNN----
azovin        IDEAYLDRIEKARNDASKARSTAVS------AIIDLYNN----
vibriosp      IDQQYLDFLDGLRNDDAKTQLEIQQD----LANLELHNEGA--
prochloma     VNQEYLNWVENEYKS----------------------------
ORF_PP16590   VNQEYLNWVENEYTS----------------------------
synesp        IDEDYFQWLERNCSS----------------------------
burksp        VTPEYLDAIERARLTPASQADRDTAG-DTERSQMNLQLSVE--
polysp        INDSYLDALEAQRNSTAAKADRQRDSSDFARSQLHLHLATED-
ralstoeu      IDEAYLNRLETAR----SQADRDGTNGDTERSQLHLQRSGGNE
bordepara     ITAEYLARLGQSRDS--SAGDEEAGG-----LQFNMGYAANDA
solusx9       VNIEELITARQKRK-----------------------------
              :    :                                                      
Prim.cons.    IDEEYLDRLEQARNS5A22ADR2VSG2DTER2QL3L3N3GED2                 


BLAST

RID: 1164212036-17833-183894141903.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,180,857 sequences; 1,439,539,050 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports
Query= Translation of ORF number 1 in reading frame 1 on the reverse strand. Length=222 

Distance tree of resultsNew  Related Structures

                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|78778389|ref|YP_396501.1|  amidophosphoribosyltransferase [...   414    2e-114  Gene info
gi|33860564|ref|NP_892125.1|  amidophosphoribosyltransferase [...   404    1e-111  Gene info
gi|84518952|ref|ZP_01006301.1|  amidophosphoribosyltransferase...   361    1e-98 
gi|33239456|ref|NP_874398.1|  amidophosphoribosyltransferase [...   348    2e-94   Gene info
gi|33862277|ref|NP_893837.1|  amidophosphoribosyltransferase [...   343    3e-93   Gene info
gi|72383168|ref|YP_292523.1|  amidophosphoribosyltransferase [...   340    2e-92   Gene info
gi|88854870|ref|ZP_01129536.1|  amidophosphoribosyltransferase...   332    6e-90 
gi|78211562|ref|YP_380341.1|  amidophosphoribosyltransferase [...   330    4e-89   Gene info
gi|28572878|ref|NP_789658.1|  amidophosphoribosyltransferase [...   320    2e-86   Gene info
gi|28493690|ref|NP_787851.1|  amidophosphoribosyltransferase [...   320    3e-86   Gene info
gi|113868568|ref|YP_727057.1|  glutamine phosphoribosylpyropho...   303    4e-81   Gene info
gi|84354023|ref|ZP_00978939.1|  COG0034: Glutamine phosphoribo...   302    9e-81 
gi|118036526|ref|ZP_01507933.1|  amidophosphoribosyltransferas...   301    1e-80 
gi|91777263|ref|YP_552471.1|  Amidophosphoribosyl transferase ...   301    2e-80   Gene info
gi|115358106|ref|YP_775244.1|  amidophosphoribosyltransferase ...   301    2e-80   Gene info
gi|73541985|ref|YP_296505.1|  amidophosphoribosyltransferase [...   300    4e-80   Gene info
gi|78062965|ref|YP_372873.1|  amidophosphoribosyltransferase [...   299    8e-80   Gene info
gi|67547355|ref|ZP_00425259.1|  Amidophosphoribosyl transferas...   297    3e-79 
gi|84360302|ref|ZP_00985009.1|  COG0034: Glutamine phosphoribo...   296    3e-79 
gi|83716414|ref|YP_438885.1|  amidophosphoribosyltransferase [...   296    4e-79   Gene info
gi|83748100|ref|ZP_00945129.1|  PurF [Ralstonia solanacearum U...   295    8e-79 
gi|53722712|ref|YP_111697.1|  amidophosphoribosyltransferase [...   295    1e-78   Gene info
gi|53716183|ref|YP_106277.1|  amidophosphoribosyltransferase [...   293    4e-78   Gene info
gi|118027600|ref|ZP_01499064.1|  amidophosphoribosyltransferas...   293    4e-78 
gi|17546695|ref|NP_520097.1|  amidophosphoribosyltransferase [...   292    7e-78   Gene info
gi|94311396|ref|YP_584606.1|  amidophosphoribosyltransferase [...   291    1e-77   Gene info
gi|30248708|ref|NP_840778.1|  amidophosphoribosyltransferase [...   290    4e-77   Gene info
gi|116269231|ref|ZP_01493476.1|  amidophosphoribosyltransferas...   287    2e-76 
gi|33592513|ref|NP_880157.1|  amidophosphoribosyltransferase [...   279    7e-74   Gene info
gi|33596169|ref|NP_883812.1|  amidophosphoribosyltransferase [...   279    7e-74   Gene info
gi|114331156|ref|YP_747378.1|  amidophosphoribosyltransferase ...   278    9e-74   Gene info
gi|82703027|ref|YP_412593.1|  amidophosphoribosyltransferase [...   278    1e-73   Gene info
gi|83645239|ref|YP_433674.1|  amidophosphoribosyltransferase [...   277    3e-73   Gene info
gi|115422808|emb|CAJ49336.1|  amidophosphoribosyltransferase [Bor   275    1e-72 
gi|109148749|ref|XP_001106024.1|  PREDICTED: similar to Amidop...   272    9e-72   Gene info
gi|84715387|ref|ZP_01022488.1|  Amidophosphoribosyl transferas...   271    1e-71 
gi|47575244|ref|ZP_00245279.1|  COG0034: Glutamine phosphoribo...   271    2e-71 
gi|118053861|ref|ZP_01522404.1|  amidophosphoribosyltransferas...   271    2e-71 
gi|77165148|ref|YP_343673.1|  amidophosphoribosyltransferase [...   270    5e-71   Gene info
gi|88799990|ref|ZP_01115561.1|  amidophosphoribosyltransferase...   269    8e-71 
gi|110593265|ref|ZP_01381618.1|  amidophosphoribosyltransferas...   269    9e-71 
gi|77952241|ref|ZP_00816657.1|  Amidophosphoribosyl transferas...   268    9e-71 
gi|71906515|ref|YP_284102.1|  amidophosphoribosyltransferase [...   268    1e-70   Gene info
gi|91770799|ref|ZP_01272621.1|  Amidophosphoribosyl transferas...   268    2e-70 
gi|74317926|ref|YP_315666.1|  amidophosphoribosyl transferase ...   268    2e-70   Gene info
gi|91787491|ref|YP_548443.1|  amidophosphoribosyltransferase [...   268    2e-70   Gene info
gi|111613731|ref|ZP_01400811.1|  amidophosphoribosyltransferas...   266    4e-70 
gi|56478142|ref|YP_159731.1|  amidophosphoribosyltransferase [...   266    5e-70   Gene info
gi|89901459|ref|YP_523930.1|  amidophosphoribosyltransferase [...   266    5e-70   Gene info
gi|111618296|ref|ZP_01405320.1|  amidophosphoribosyltransferas...   265    1e-69 
gi|78485153|ref|YP_391078.1|  amidophosphoribosyltransferase [...   264    3e-69   Gene info
gi|104780853|ref|YP_607351.1|  amidophosphoribosyltransferase ...   263    4e-69   Gene info
gi|58265148|ref|XP_569730.1|  amidophosphoribosyltransferase [...   263    6e-69   Gene info
gi|50259437|gb|EAL22110.1|  hypothetical protein CNBC2480 [Cry...   263    6e-69 
gi|94498938|ref|ZP_01305476.1|  amidophosphoribosyltransferase...   262    7e-69 
gi|70729451|ref|YP_259189.1|  amidophosphoribosyltransferase [...   262    7e-69   Gene info
gi|77458129|ref|YP_347634.1|  amidophosphoribosyltransferase [...   261    1e-68   Gene info
gi|88812317|ref|ZP_01127567.1|  amidophosphoribosyltransferase...   261    1e-68 
gi|15598304|ref|NP_251798.1|  amidophosphoribosyltransferase [...   261    2e-68   Gene info
gi|66044913|ref|YP_234754.1|  amidophosphoribosyltransferase [...   260    4e-68   Gene info
gi|34497970|ref|NP_902185.1|  amidophosphoribosyltransferase [...   259    5e-68   Gene info
gi|114320398|ref|YP_742081.1|  amidophosphoribosyltransferase ...   259    5e-68   Gene info
gi|53803332|ref|YP_114901.1|  amidophosphoribosyltransferase [...   259    5e-68   Gene info
gi|71733765|ref|YP_273905.1|  amidophosphoribosyltransferase [...   259    9e-68   Gene info
gi|28870966|ref|NP_793585.1|  amidophosphoribosyltransferase [...   258    1e-67   Gene info
gi|94412702|ref|ZP_01292608.1|  hypothetical protein PaerP_010...   257    3e-67 
gi|90416031|ref|ZP_01223964.1|  amidophosphoribosyltransferase...   256    4e-67 
gi|110834316|ref|YP_693175.1|  amidophosphoribosyltransferase ...   256    4e-67   Gene info
gi|93005931|ref|YP_580368.1|  amidophosphoribosyltransferase [...   256    5e-67   Gene info
gi|82739303|ref|ZP_00902110.1|  Amidophosphoribosyl transferas...   256    5e-67 
gi|26988725|ref|NP_744150.1|  amidophosphoribosyltransferase [...   256    5e-67   Gene info
gi|88948575|ref|ZP_01151338.1|  Amidophosphoribosyl transferas...   256    6e-67 
gi|118059000|ref|ZP_01527459.1|  amidophosphoribosyltransferas...   255    9e-67 
gi|71023905|ref|XP_762182.1|  hypothetical protein UM06035.1 [...   255    9e-67   Gene info
gi|67155230|ref|ZP_00416858.1|  Amidophosphoribosyl transferas...   254    2e-66 
gi|91776045|ref|YP_545801.1|  amidophosphoribosyltransferase [...   254    3e-66   Gene info
gi|88705043|ref|ZP_01102755.1|  Amidophosphoribosyltransferase...   253    6e-66 
gi|40063321|gb|AAR38139.1|  amidophosphoribosyltransferase [uncul   253    6e-66 
gi|90021717|ref|YP_527544.1|  Dihydrolipoamide succinyltransfe...   252    9e-66   Gene info
gi|71065839|ref|YP_264566.1|  amidophosphoribosyltransferase [...   252    1e-65   Gene info
gi|71897920|ref|ZP_00680125.1|  Amidophosphoribosyl transferas...   251    2e-65 
gi|92113393|ref|YP_573321.1|  amidophosphoribosyltransferase [...   250    3e-65   Gene info
gi|116505954|gb|EAU88849.1|  hypothetical protein CC1G_01222 [...   250    4e-65 
gi|71902128|ref|ZP_00684159.1|  Amidophosphoribosyl transferas...   248    1e-64 
gi|114772725|ref|ZP_01450067.1|  amidophosphoribosyltransferas...   248    2e-64 
gi|15838543|ref|NP_299231.1|  amidophosphoribosyltransferase [...   248    2e-64   Gene info
gi|28198756|ref|NP_779070.1|  amidophosphoribosyltransferase [...   248    2e-64   Gene info
gi|87121848|ref|ZP_01077734.1|  amidophosphoribosyltransferase...   247    2e-64 
gi|54309808|ref|YP_130828.1|  amidophosphoribosyltransferase [...   247    2e-64   Gene info
gi|90410772|ref|ZP_01218787.1|  amidophosphoribosyltransferase...   247    3e-64 
gi|56460120|ref|YP_155401.1|  amidophosphoribosyltransferase [...   246    4e-64   Gene info
gi|85713092|ref|ZP_01044127.1|  amidophosphoribosyltransferase...   246    4e-64 
gi|116185219|ref|ZP_01475134.1|  hypothetical protein VEx2w_02002   246    5e-64 
gi|91223610|ref|ZP_01258875.1|  amidophosphoribosyltransferase...   246    6e-64 
gi|90579287|ref|ZP_01235097.1|  amidophosphoribosyltransferase...   246    6e-64 
gi|50084505|ref|YP_046015.1|  amidophosphoribosyltransferase [...   245    9e-64   Gene info
gi|89073221|ref|ZP_01159751.1|  amidophosphoribosyltransferase...   245    1e-63 
gi|28898959|ref|NP_798564.1|  amidophosphoribosyltransferase [...   244    2e-63   Gene info
gi|29654220|ref|NP_819912.1|  amidophosphoribosyltransferase [...   244    3e-63   Gene info
gi|94492152|ref|ZP_01299360.1|  hypothetical protein CburD_010...   243    3e-63 
gi|15641019|ref|NP_230650.1|  amidophosphoribosyltransferase [...   243    4e-63   Gene info
gi|75816364|ref|ZP_00746837.1|  COG0034: Glutamine phosphoribo...   243    4e-63 
gi|118072509|ref|ZP_01540698.1|  amidophosphoribosyltransferas...   243    5e-63 
gi|77975505|ref|ZP_00831040.1|  COG0034: Glutamine phosphoribo...   242    8e-63 
gi|77960842|ref|ZP_00824697.1|  COG0034: Glutamine phosphoribo...   242    1e-62 
gi|77957376|ref|ZP_00821434.1|  COG0034: Glutamine phosphoribo...   242    1e-62 
gi|88796026|ref|ZP_01111711.1|  amidophosphoribosyltransferase...   241    2e-62 
gi|77976973|ref|ZP_00832436.1|  COG0034: Glutamine phosphoribo...   241    2e-62 
gi|95927605|ref|ZP_01310360.1|  hypothetical protein CburR_010005   241    2e-62 
gi|118069547|ref|ZP_01537791.1|  amidophosphoribosyltransferas...   241    2e-62 
gi|16122976|ref|NP_406289.1|  amidophosphoribosyltransferase [...   241    2e-62   Gene info
gi|71281500|ref|YP_270461.1|  amidophosphoribosyltransferase [...   240    3e-62   Gene info
gi|32035795|ref|ZP_00135644.1|  COG0034: Glutamine phosphoribo...   240    3e-62 
gi|86137553|ref|ZP_01056130.1|  amidophosphoribosyltransferase...   240    3e-62 
gi|21230422|ref|NP_636339.1|  amidophosphoribosyltransferase [...   240    4e-62   Gene info
gi|59712298|ref|YP_205074.1|  amidophosphoribosyltransferase [...   240    4e-62   Gene info
gi|68547940|ref|ZP_00587463.1|  Amidophosphoribosyl transferas...   239    5e-62 
gi|117621358|ref|YP_856401.1|  amidophosphoribosyltransferase ...   239    5e-62 
gi|99081628|ref|YP_613782.1|  amidophosphoribosyltransferase [...   239    6e-62   Gene info
gi|86148374|ref|ZP_01066667.1|  amidophosphoribosyltransferase...   239    6e-62 
gi|16273127|ref|NP_439363.1|  amidophosphoribosyltransferase [...   239    6e-62   Gene info
gi|16761287|ref|NP_456904.1|  amidophosphoribosyltransferase [...   239    7e-62   Gene info
gi|56412741|ref|YP_149816.1|  amidophosphoribosyltransferase [...   239    7e-62   Gene info
gi|58583298|ref|YP_202314.1|  amidophosphoribosyltransferase [...   239    7e-62   Gene info
gi|16765689|ref|NP_461304.1|  amidophosphoribosyltransferase [...   239    8e-62   Gene info
gi|27365340|ref|NP_760868.1|  amidophosphoribosyltransferase [...   239    9e-62   Gene info
gi|84625129|ref|YP_452501.1|  amidophosphoribosyltransferase [...   239    9e-62   Gene info
gi|21241797|ref|NP_641379.1|  amidophosphoribosyltransferase [...   239    9e-62   Gene info
gi|78046617|ref|YP_362792.1|  amidophosphoribosyltransferase [...   239    9e-62   Gene info
gi|113969772|ref|YP_733565.1|  amidophosphoribosyltransferase ...   239    1e-61   Gene info
gi|117919931|ref|YP_869123.1|  amidophosphoribosyltransferase ...   239    1e-61 
gi|68540763|ref|ZP_00580513.1|  Amidophosphoribosyl transferas...   238    1e-61 
gi|24374586|ref|NP_718629.1|  amidophosphoribosyltransferase [...   238    1e-61   Gene info
gi|109897930|ref|YP_661185.1|  amidophosphoribosyltransferase ...   238    1e-61   Gene info
gi|53732452|ref|ZP_00154387.2|  COG0034: Glutamine phosphoribo...   238    1e-61 
gi|77815343|ref|ZP_00814579.1|  Amidophosphoribosyl transferas...   238    1e-61 
gi|113950971|ref|ZP_01436574.1|  amidophosphoribosyltransferas...   238    1e-61 
gi|37527053|ref|NP_930397.1|  amidophosphoribosyltransferase [...   238    1e-61   Gene info
gi|88860436|ref|ZP_01135074.1|  amidophosphoribosyltransferase...   238    1e-61 
gi|85059591|ref|YP_455293.1|  amidophosphoribosyltransferase [...   238    2e-61   Gene info
gi|78367182|ref|ZP_00837455.1|  Amidophosphoribosyl transferas...   238    2e-61 
gi|115315466|ref|YP_764189.1|  amidophosphoribosyltransferase ...   238    2e-61   Gene info
gi|84394303|ref|ZP_00993027.1|  amidophosphoribosyltransferase...   238    2e-61 
gi|90408624|ref|ZP_01216778.1|  amidophosphoribosyltransferase...   238    2e-61 
gi|82777723|ref|YP_404072.1|  amidophosphoribosyltransferase [...   237    2e-61   Gene info
gi|56708727|ref|YP_170623.1|  amidophosphoribosyltransferase [...   237    2e-61   Gene info
gi|89257116|ref|YP_514478.1|  Amidophosphoribosyltransferase [...   237    3e-61   Gene info
gi|75196355|ref|ZP_00706425.1|  COG0034: Glutamine phosphoribo...   237    3e-61 
gi|82544793|ref|YP_408740.1|  amidophosphoribosyltransferase [...   237    3e-61   Gene info
gi|50121975|ref|YP_051142.1|  amidophosphoribosyltransferase [...   236    5e-61   Gene info
gi|62261175|gb|AAX77965.1|  unknown protein [synthetic construct]   236    5e-61 
gi|15802859|ref|NP_288886.1|  amidophosphoribosyltransferase [...   236    5e-61   Gene info
gi|110806277|ref|YP_689797.1|  amidophosphoribosyltransferase ...   236    6e-61   Gene info
gi|42631509|ref|ZP_00157047.1|  COG0034: Glutamine phosphoribo...   236    6e-61 
gi|68249753|ref|YP_248865.1|  amidophosphoribosyltransferase [...   236    7e-61   Gene info
gi|113461059|ref|YP_719126.1|  amidophosphoribosyltransferase ...   236    7e-61   Gene info
gi|1943557|pdb|1ECF|A  Chain A, Escherichia Coli Glutamine Pho...   236    7e-61   Related structures
gi|16130247|ref|NP_416815.1|  amidophosphoribosyltransferase [...   236    7e-61   Gene info
gi|59800714|ref|YP_207426.1|  amidophosphoribosyltransferase [...   235    9e-61   Gene info
gi|91792847|ref|YP_562498.1|  amidophosphoribosyltransferase [...   235    9e-61   Gene info
gi|15793861|ref|NP_283683.1|  amidophosphoribosyltransferase [...   235    1e-60   Gene info
gi|3122656|sp|Q12698|PUR1_SACKL  Amidophosphoribosyltransferas...   235    1e-60 
gi|15676588|ref|NP_273732.1|  amidophosphoribosyltransferase [...   235    1e-60   Gene info
gi|114562576|ref|YP_750089.1|  amidophosphoribosyltransferase ...   234    2e-60   Gene info
gi|89093249|ref|ZP_01166199.1|  amidophosphoribosyltransferase...   234    3e-60 
gi|77360994|ref|YP_340569.1|  amidophosphoribosyltransferase [...   233    4e-60   Gene info
gi|42593|emb|CAA30971.1|  amidophosphoribosyltransferase [Escheri   233    4e-60 
gi|42591|emb|CAA23613.1|  unnamed protein product [Escherichia...   233    5e-60 
gi|7716501|gb|AAF68406.1|AF237920_1  amidophosphoribosyltransfera   233    5e-60 
gi|50295058|ref|XP_449940.1|  hypothetical protein CAGL0M13717...   233    5e-60   Gene info
gi|15602566|ref|NP_245638.1|  amidophosphoribosyltransferase [...   232    9e-60   Gene info
gi|171009|gb|AAA34403.1|  amidophosphoribosyltransferase >gi|1...   232    9e-60 
gi|6323958|ref|NP_014029.1|  Phosphoribosylpyrophosphate amido...   232    9e-60   Gene info
gi|52425058|ref|YP_088195.1|  amidophosphoribosyltransferase [...   232    9e-60   Gene info
gi|45200763|ref|NP_986333.1|  AGL334Wp [Eremothecium gossypii]...   232    1e-59   Gene info
gi|23006165|ref|ZP_00048613.1|  COG0034: Glutamine phosphoribo...   231    1e-59 
gi|147418|gb|AAA24453.1|  amidophosphoribosyltransferase (EC 2.4.   231    2e-59 
gi|106883744|ref|ZP_01351137.1|  amidophosphoribosyltransferas...   230    3e-59 
gi|116060642|emb|CAL57120.1|  unnamed protein product [Ostreococc   227    3e-58 
gi|50425793|ref|XP_461493.1|  hypothetical protein DEHA0F28204...   226    4e-58   Gene info
gi|50546909|ref|XP_500924.1|  hypothetical protein [Yarrowia l...   226    4e-58   Gene info
gi|68478758|ref|XP_716541.1|  amidophosphoribosyltransferase [...   224    2e-57   Gene info
gi|607831|gb|AAA83434.1|  glutamine phosphoribosylpyrophosphate a   222    7e-57 
gi|19115873|ref|NP_594961.1|  hypothetical protein SPAC4D7.08c...   216    5e-55   Gene info
gi|67540934|ref|XP_664241.1|  hypothetical protein AN6637.2 [A...   211    2e-53   Gene info
gi|83771785|dbj|BAE61915.1|  unnamed protein product [Aspergillus   211    3e-53 
gi|32491062|ref|NP_871316.1|  amidophosphoribosyltransferase [...   209    8e-53   Gene info
gi|85099761|ref|XP_960840.1|  hypothetical protein [Neurospora...   208    1e-52   Gene info
gi|21622360|emb|CAD36991.1|  probable amidophosphoribosyltransfer   208    2e-52 
gi|115386468|ref|XP_001209775.1|  amidophosphoribosyltransfera...   207    3e-52   Gene info
gi|50303009|ref|XP_451442.1|  unnamed protein product [Kluyver...   206    9e-52   Gene info
gi|94676955|ref|YP_588812.1|  amidophosphoribosyltransferase [...   205    9e-52   Gene info
gi|70984376|ref|XP_747702.1|  amidophosphoribosyltransferase [...   205    1e-51   Gene info
gi|90297904|gb|EAS27535.1|  hypothetical protein CIMG_10140 [Cocc   201    2e-50 
gi|111063652|gb|EAT84772.1|  hypothetical protein SNOG_07306 [Pha   197    3e-49 
gi|75432606|ref|ZP_00733113.1|  Amidophosphoribosyltransferase...   196    5e-49 
gi|46121801|ref|XP_385454.1|  hypothetical protein FG05278.1 [...   196    6e-49   Gene info
gi|54297595|ref|YP_123964.1|  amidophosphoribosyltransferase [...   193    5e-48   Gene info
gi|52841902|ref|YP_095701.1|  amidophosphoribosyltransferase [...   193    6e-48   Gene info
gi|54294563|ref|YP_126978.1|  amidophosphoribosyltransferase [...   191    2e-47   Gene info
gi|39945272|ref|XP_362173.1|  hypothetical protein MG04618.4 [Mag   191    3e-47   UniGene infoGene info
gi|14590171|ref|NP_142236.1|  amidophosphoribosyltransferase [...   181    2e-44   Gene info
gi|20095085|ref|NP_614932.1|  Glutamine phosphoribosylpyrophos...   176    5e-43   Gene info
gi|114569756|ref|YP_756436.1|  amidophosphoribosyltransferase ...   176    7e-43   Gene info
gi|113933292|ref|ZP_01419194.1|  amidophosphoribosyltransferas...   174    3e-42 
gi|86604998|ref|YP_473761.1|  amidophosphoribosyltransferase [...   173    6e-42   Gene info
gi|86609578|ref|YP_478340.1|  amidophosphoribosyltransferase [...   172    1e-41   Gene info
gi|16331334|ref|NP_442062.1|  amidophosphoribosyltransferase [...   172    1e-41   Gene info
gi|84489915|ref|YP_448147.1|  PurF [Methanosphaera stadtmanae ...   171    2e-41   Gene info
gi|37521683|ref|NP_925060.1|  amidophosphoribosyltransferase [...   171    2e-41   Gene info
gi|16125904|ref|NP_420468.1|  amidophosphoribosyltransferase [...   171    3e-41   Gene info
gi|106891884|ref|ZP_01359064.1|  amidophosphoribosyltransferas...   170    4e-41 
gi|14520439|ref|NP_125914.1|  amidophosphoribosyltransferase [...   170    4e-41   Gene info
gi|18976526|ref|NP_577883.1|  amidophosphoribosyltransferase [...   170    5e-41   Gene info
gi|82499069|ref|ZP_00884521.1|  Amidophosphoribosyl transferas...   170    5e-41 
gi|11498479|ref|NP_069707.1|  amidophosphoribosyltransferase (...   169    9e-41   Gene info
gi|83945268|ref|ZP_00957617.1|  amidophosphoribosyltransferase...   169    1e-40 
gi|23125356|ref|ZP_00107293.1|  COG0034: Glutamine phosphoribo...   167    2e-40 
gi|15678673|ref|NP_275788.1|  amidophosphoribosyltransferase [...   167    3e-40   Gene info
gi|118060986|ref|ZP_01529400.1|  amidophosphoribosyltransferas...   167    3e-40 
gi|113477170|ref|YP_723231.1|  amidophosphoribosyltransferase ...   165    2e-39   Gene info
gi|114797301|ref|YP_759445.1|  amidophosphoribosyltransferase ...   164    2e-39   Gene info
gi|57640146|ref|YP_182624.1|  amidophosphoribosyltransferase [...   164    2e-39   Gene info
gi|56751502|ref|YP_172203.1|  amidophosphoribosyltransferase [...   164    3e-39   Gene info
gi|116672277|ref|YP_833210.1|  amidophosphoribosyltransferase ...   164    3e-39   Gene info
gi|82748214|ref|ZP_00910701.1|  Amidophosphoribosyl transferas...   164    4e-39 
gi|42524405|ref|NP_969785.1|  amidophosphoribosyltransferase [...   164    4e-39   Gene info
gi|15668376|ref|NP_247172.1|  amidophosphoribosyltransferase (...   163    6e-39   Gene info
gi|15805256|ref|NP_293944.1|  amidophosphoribosyltransferase [...   162    7e-39   Gene info
gi|113954725|ref|YP_729243.1|  amidophosphoribosyltransferase ...   162    7e-39   Gene info
gi|39936154|ref|NP_948430.1|  amidophosphoribosyltransferase [...   162    8e-39   Gene info
gi|28211591|ref|NP_782535.1|  amidophosphoribosyltransferase [...   162    8e-39   Gene info
gi|46578578|ref|YP_009386.1|  amidophosphoribosyltransferase [...   162    8e-39   Gene info
gi|116753550|ref|YP_842668.1|  amidophosphoribosyltransferase ...   162    9e-39   Gene info
gi|89359358|ref|ZP_01197179.1|  Amidophosphoribosyl transferas...   162    1e-38 
gi|21226443|ref|NP_632365.1|  Amidophosphoribosyltransferase [...   162    1e-38   Gene info
gi|17231143|ref|NP_487691.1|  amidophosphoribosyltransferase [...   162    1e-38   Gene info
gi|106895414|ref|ZP_01362509.1|  Amidophosphoribosyl transfera...   162    1e-38 
gi|115375209|ref|ZP_01462475.1|  amidophosphoribosyltransferas...   162    2e-38 
gi|20092009|ref|NP_618084.1|  amidophosphoribosyltransferase [...   162    2e-38   Gene info
gi|117923581|ref|YP_864198.1|  amidophosphoribosyltransferase ...   161    2e-38 
gi|42527908|ref|NP_973006.1|  amidophosphoribosyltransferase [...   161    2e-38   Gene info
gi|78778065|ref|YP_394380.1|  Amidophosphoribosyl transferase ...   161    2e-38   Gene info
gi|55377640|ref|YP_135490.1|  amidophosphoribosyl transferase ...   160    3e-38   Gene info
gi|116625015|ref|YP_827171.1|  amidophosphoribosyltransferase ...   160    5e-38   Gene info
gi|110800675|ref|YP_695127.1|  amidophosphoribosyltransferase ...   159    6e-38   Gene info
gi|91774102|ref|YP_566794.1|  amidophosphoribosyltransferase [...   159    7e-38   Gene info
gi|114567293|ref|YP_754447.1|  hypothetical protein Swol_1778 ...   159    7e-38   Gene info
gi|52079133|ref|YP_077924.1|  amidophosphoribosyltransferase [...   159    7e-38   Gene info
gi|77685291|ref|ZP_00800695.1|  Amidophosphoribosyl transferas...   159    8e-38 
gi|110803721|ref|YP_697999.1|  amidophosphoribosyltransferase ...   159    8e-38   Gene info
gi|18309665|ref|NP_561599.1|  amidophosphoribosyltransferase [...   159    8e-38   Gene info
gi|52784501|ref|YP_090330.1|  amidophosphoribosyltransferase [...   159    1e-37   Gene info
gi|73670934|ref|YP_306949.1|  amidophosphoribosyltransferase [...   159    1e-37   Gene info
gi|27262336|gb|AAN87449.1|  Amidophosphoribosyltransferase [Helio   159    1e-37 
gi|87301555|ref|ZP_01084395.1|  amidophosphoribosyltransferase...   158    1e-37 
gi|75909842|ref|YP_324138.1|  amidophosphoribosyltransferase [...   158    2e-37   Gene info
gi|2624597|pdb|1AO0|A  Chain A, Glutamine Phosphoribosylpyroph...   158    2e-37   Related structures
gi|46199458|ref|YP_005125.1|  amidophosphoribosyltransferase [...   158    2e-37   Gene info
gi|576138|pdb|1GPH|1  Chain 1, Glutamine Phosphoribosylpyropho...   158    2e-37   Related structures
gi|16077717|ref|NP_388531.1|  amidophosphoribosyltransferase [...   158    2e-37   Gene info
gi|32265987|ref|NP_860019.1|  amidophosphoribosyltransferase [...   158    2e-37   Gene info
gi|88945227|ref|ZP_01148441.1|  Amidophosphoribosyl transferas...   158    2e-37 
gi|116074279|ref|ZP_01471541.1|  amidophosphoribosyltransferas...   158    2e-37 
gi|84497679|ref|ZP_00996501.1|  amidophosphoribosyltransferase...   157    2e-37 
gi|110601449|ref|ZP_01389635.1|  amidophosphoribosyltransferas...   157    2e-37 
gi|89101008|ref|ZP_01173851.1|  amidophosphoribosyltransferase...   157    3e-37 
gi|89054198|ref|YP_509649.1|  amidophosphoribosyltransferase [...   157    3e-37   Gene info
gi|118046992|ref|ZP_01515635.1|  amidophosphoribosyltransferas...   157    3e-37 
gi|116495230|ref|YP_806964.1|  Glutamine phosphoribosylpyropho...   157    3e-37   Gene info
gi|88937238|ref|ZP_01142816.1|  Amidophosphoribosyl transferas...   157    3e-37 
gi|15894671|ref|NP_348020.1|  amidophosphoribosyltransferase [...   157    4e-37   Gene info
gi|83952050|ref|ZP_00960782.1|  amidophosphoribosyltransferase...   157    4e-37 
gi|116873202|ref|YP_849983.1|  amidophosphoribosyltransferase ...   157    4e-37   Gene info
gi|94989534|ref|YP_597634.1|  Amidophosphoribosyltransferase [...   157    4e-37   Gene info
gi|39996736|ref|NP_952687.1|  amidophosphoribosyltransferase [...   156    5e-37   Gene info
gi|22299227|ref|NP_682474.1|  amidophosphoribosyltransferase [...   156    5e-37   Gene info
gi|15613193|ref|NP_241496.1|  amidophosphoribosyltransferase [...   156    5e-37   Gene info
gi|94984171|ref|YP_603535.1|  amidophosphoribosyltransferase [...   156    5e-37   Gene info
gi|108757527|ref|YP_629363.1|  amidophosphoribosyltransferase ...   156    6e-37   Gene info
gi|91977465|ref|YP_570124.1|  amidophosphoribosyltransferase [...   156    7e-37   Gene info
gi|16803808|ref|NP_465293.1|  amidophosphoribosyltransferase [...   155    9e-37   Gene info
gi|16800946|ref|NP_471214.1|  amidophosphoribosyltransferase [...   155    9e-37   Gene info
gi|46907998|ref|YP_014387.1|  amidophosphoribosyltransferase [...   155    9e-37   Gene info
gi|83369610|ref|ZP_00914463.1|  Amidophosphoribosyl transferas...   155    9e-37 
gi|71836918|ref|ZP_00676685.1|  Amidophosphoribosyl transferas...   155    1e-36 
gi|67921899|ref|ZP_00515415.1|  Amidophosphoribosyl transferas...   155    1e-36 
gi|22536211|ref|NP_687062.1|  amidophosphoribosyltransferase [...   155    1e-36   Gene info
gi|78355381|ref|YP_386830.1|  amidophosphoribosyltransferase [...   155    1e-36   Gene info
gi|23098201|ref|NP_691667.1|  amidophosphoribosyltransferase [...   155    1e-36   Gene info
gi|4097534|gb|AAD12627.1|  phosphoribosylpyrophosphate amidotr...   155    1e-36 
gi|117929279|ref|YP_873830.1|  amidophosphoribosyltransferase ...   155    1e-36 
gi|88809360|ref|ZP_01124868.1|  amidophosphoribosyltransferase...   155    1e-36 
gi|89070873|ref|ZP_01158112.1|  amidophosphoribosyltransferase...   155    1e-36 
gi|98662546|dbj|GAA00575.1|  unnamed protein product [Pelotomacul   155    1e-36 
gi|89209624|ref|ZP_01188019.1|  Amidophosphoribosyl transferas...   155    1e-36 
gi|116512322|ref|YP_809538.1|  Glutamine phosphoribosylpyropho...   155    1e-36   Gene info
gi|111219629|ref|YP_710423.1|  Amidophosphoribosyltransferase ...   155    1e-36   Gene info
gi|33864543|ref|NP_896102.1|  amidophosphoribosyltransferase [...   155    1e-36   Gene info
gi|83374112|ref|ZP_00918888.1|  Amidophosphoribosyl transferas...   155    2e-36 
gi|71368088|ref|ZP_00658597.1|  Amidophosphoribosyl transferas...   155    2e-36 
gi|77463011|ref|YP_352515.1|  amidophosphoribosyltransferase [...   155    2e-36   Gene info
gi|58337818|ref|YP_194403.1|  phosphoribosylpyrophosphate amid...   155    2e-36   Gene info
gi|90419480|ref|ZP_01227390.1|  amidophosphoribosyltransferase...   155    2e-36 
gi|56962805|ref|YP_174531.1|  amidophosphoribosyltransferase [...   154    2e-36   Gene info
gi|87199780|ref|YP_497037.1|  amidophosphoribosyltransferase [...   154    2e-36   Gene info
gi|15674270|ref|NP_268443.1|  amidophosphoribosyltransferase [...   154    2e-36   Gene info
gi|76800092|ref|ZP_00781978.1|  amidophosphoribosyltransferase...   154    2e-36 
gi|55820135|ref|YP_138577.1|  amidophosphoribosyltransferase [...   154    2e-36   Gene info
gi|84684694|ref|ZP_01012594.1|  amidophosphoribosyltransferase...   154    2e-36 
gi|116627000|ref|YP_819619.1|  Glutamine phosphoribosylpyropho...   154    2e-36   Gene info
gi|76258324|ref|ZP_00765980.1|  Amidophosphoribosyl transferas...   154    3e-36 
gi|94993420|ref|YP_601518.1|  Amidophosphoribosyltransferase [...   154    3e-36   Gene info
gi|30260468|ref|NP_842845.1|  amidophosphoribosyltransferase [...   154    3e-36   Gene info
gi|77405228|ref|ZP_00782325.1|  amidophosphoribosyltransferase...   154    3e-36 
gi|21909557|ref|NP_663825.1|  amidophosphoribosyltransferase [...   154    3e-36   Gene info
gi|62426071|ref|ZP_00381200.1|  COG0034: Glutamine phosphoribo...   154    3e-36 
gi|19745221|ref|NP_606357.1|  amidophosphoribosyltransferase [...   154    3e-36   Gene info
gi|89896676|ref|YP_520163.1|  hypothetical protein DSY3930 [De...   154    3e-36   Gene info
gi|42779405|ref|NP_976652.1|  amidophosphoribosyltransferase [...   154    3e-36   Gene info
gi|87123345|ref|ZP_01079196.1|  Glutamine amidotransferase cla...   154    3e-36 
gi|15673510|ref|NP_267684.1|  amidophosphoribosyltransferase [...   154    3e-36   Gene info
gi|56418799|ref|YP_146117.1|  phosphoribosylpyrophosphate amid...   154    4e-36   Gene info
gi|30018538|ref|NP_830169.1|  amidophosphoribosyltransferase [...   154    4e-36   Gene info
gi|76788351|ref|YP_328752.1|  amidophosphoribosyltransferase [...   154    4e-36   Gene info
gi|83942630|ref|ZP_00955091.1|  amidophosphoribosyltransferase...   154    4e-36 
gi|110619945|emb|CAJ35223.1|  amidophosphoribosyltransferase [...   153    4e-36 
gi|78183588|ref|YP_376022.1|  amidophosphoribosyltransferase [...   153    5e-36   Gene info
gi|94971647|ref|YP_593695.1|  amidophosphoribosyltransferase [...   153    5e-36   Gene info
gi|16082247|ref|NP_394698.1|  amidophosphoribosyltransferase [...   153    5e-36   Gene info
gi|32028920|ref|ZP_00132023.1|  COG0034: Glutamine phosphoribo...   153    5e-36 
gi|75759927|ref|ZP_00739998.1|  Amidophosphoribosyltransferase...   153    6e-36 
gi|113940024|ref|ZP_01425867.1|  amidophosphoribosyltransferas...   153    6e-36 
gi|81096494|ref|ZP_00874836.1|  Amidophosphoribosyl transferas...   153    6e-36 
gi|69933332|ref|ZP_00628534.1|  Amidophosphoribosyl transferas...   153    6e-36 
gi|71902690|ref|YP_279493.1|  amidophosphoribosyltransferase [...   153    6e-36   Gene info
gi|78043394|ref|YP_359921.1|  amidophosphoribosyltransferase [...   152    8e-36   Gene info
gi|25010100|ref|NP_734495.1|  amidophosphoribosyltransferase [...   152    8e-36   Gene info
gi|57241396|ref|ZP_00369342.1|  amidophosphoribosyltransferase...   152    8e-36 
gi|68054851|ref|ZP_00539001.1|  Amidophosphoribosyl transferas...   152    9e-36 
gi|6580771|gb|AAF18277.1|  amidophosphoribosyltransferase [Zymomo   152    9e-36 
gi|88607063|ref|YP_505814.1|  amidophosphoribosyltransferase [...   152    9e-36   Gene info
gi|76796710|ref|ZP_00779065.1|  Amidophosphoribosyl transferas...   152    1e-35 
gi|78223146|ref|YP_384893.1|  Amidophosphoribosyl transferase ...   152    1e-35   Gene info
gi|85703139|ref|ZP_01034243.1|  amidophosphoribosyltransferase...   152    1e-35 
gi|89204804|ref|ZP_01183380.1|  Amidophosphoribosyl transferas...   152    1e-35 
gi|20807294|ref|NP_622465.1|  amidophosphoribosyltransferase [...   152    1e-35   Gene info
gi|109672299|ref|ZP_01374538.1|  hypothetical protein Ccon1_01...   152    1e-35 
gi|114766120|ref|ZP_01445124.1|  amidophosphoribosyltransferas...   152    1e-35 
gi|110603479|ref|ZP_01391556.1|  amidophosphoribosyltransferas...   151    2e-35 
gi|34556883|ref|NP_906698.1|  amidophosphoribosyltransferase [...   151    2e-35   Gene info
gi|47219329|emb|CAG10958.1|  unnamed protein product [Tetraodon n   151    2e-35 
gi|110668790|ref|YP_658601.1|  amidophosphoribosyltransferase ...   151    2e-35   Gene info
gi|89200081|ref|ZP_01178837.1|  Amidophosphoribosyl transferas...   151    2e-35 
gi|56552453|ref|YP_163292.1|  amidophosphoribosyltransferase [...   151    2e-35   Gene info
gi|85374230|ref|YP_458292.1|  amidophosphoribosyltransferase [...   151    2e-35   Gene info
gi|90576309|ref|ZP_01232774.1|  hypothetical protein CdifQ_020...   151    2e-35 
gi|12082197|dbj|BAB20824.1|  glutamine phosphoribosylpyophosph...   151    2e-35 
gi|94268752|ref|ZP_01291273.1|  Amidophosphoribosyl transferas...   151    2e-35 
gi|42520914|ref|NP_966829.1|  amidophosphoribosyltransferase [...   151    2e-35   Gene info
gi|94987655|ref|YP_595756.1|  amidophosphoribosyltransferase [...   151    2e-35   Gene info
gi|85666619|ref|ZP_01028843.1|  hypothetical protein Badol_010...   151    3e-35 
gi|103487026|ref|YP_616587.1|  amidophosphoribosyltransferase ...   151    3e-35   Gene info
gi|116329421|ref|YP_799141.1|  Amidophosphoribosyltransferase ...   150    3e-35   Gene info
gi|116329975|ref|YP_799693.1|  Amidophosphoribosyltransferase ...   150    3e-35   Gene info
gi|84502655|ref|ZP_01000774.1|  amidophosphoribosyltransferase...   150    3e-35 
gi|57168337|ref|ZP_00367471.1|  amidophosphoribosyltransferase...   150    3e-35 
gi|15899991|ref|NP_344595.1|  amidophosphoribosyltransferase [...   150    3e-35   Gene info
gi|77918930|ref|YP_356745.1|  amidophosphoribosyltransferase [...   150    3e-35   Gene info
gi|77408739|ref|ZP_00785470.1|  amidophosphoribosyltransferase...   150    3e-35 
gi|88939646|ref|ZP_01145093.1|  amidophosphoribosyltransferase...   150    4e-35 
gi|116071805|ref|ZP_01469073.1|  amidophosphoribosyltransferas...   150    4e-35 
gi|58696713|ref|ZP_00372260.1|  amidophosphoribosyltransferase...   150    4e-35 
gi|51893992|ref|YP_076683.1|  phosphoribosylpyrophosphate amid...   150    4e-35   Gene info
gi|15902091|ref|NP_357641.1|  amidophosphoribosyltransferase [...   150    4e-35   Gene info
gi|94265671|ref|ZP_01289411.1|  Amidophosphoribosyl transferas...   150    4e-35 
gi|114769308|ref|ZP_01446934.1|  amidophosphoribosyltransferas...   150    5e-35 
gi|81428274|ref|YP_395274.1|  Amidophosphoribosyltransferase [...   150    5e-35   Gene info
gi|72064467|ref|XP_780199.1|  PREDICTED: hypothetical protein ...   150    5e-35   Gene info
gi|48477741|ref|YP_023447.1|  amidophosphoribosyltransferase [...   150    5e-35   Gene info
gi|56697519|ref|YP_167887.1|  amidophosphoribosyltransferase [...   150    6e-35   Gene info
gi|113877760|ref|ZP_01417034.1|  amidophosphoribosyltransferas...   150    6e-35 
gi|90961644|ref|YP_535560.1|  Amidophosphoribosyltransferase [...   150    6e-35   Gene info
gi|24659598|ref|NP_523949.2|  Phosphoribosylamidotransferase 2...   149    6e-35   UniGene infoGene info
gi|85708823|ref|ZP_01039889.1|  amidophosphoribosyltransferase...   149    6e-35 
gi|114327134|ref|YP_744291.1|  amidophosphoribosyltransferase ...   149    7e-35   Gene info
gi|94498265|ref|ZP_01304825.1|  amidophosphoribosyltransferase...   149    7e-35 
gi|24216790|ref|NP_714271.1|  Amidophosphoribosyltransferase [...   149    7e-35   Gene info
gi|106887133|ref|ZP_01354451.1|  amidophosphoribosyltransferas...   149    8e-35 
gi|84515506|ref|ZP_01002868.1|  amidophosphoribosyltransferase...   149    8e-35 
gi|69292660|ref|ZP_00619511.1|  Amidophosphoribosyl transferas...   149    9e-35 
gi|24659604|ref|NP_729191.1|  Phosphoribosylamidotransferase 2...   149    9e-35   UniGene infoGene info
gi|51244111|ref|YP_063995.1|  amidophosphoribosyltransferase [...   149    9e-35   Gene info
gi|94987380|ref|YP_595313.1|  Glutamine phosphoribosylpyrophos...   149    1e-34   Gene info
gi|131608|sp|P28173|PUR1_CHICK  Amidophosphoribosyltransferase...   149    1e-34   Gene info
gi|118090470|ref|XP_001232005.1|  PREDICTED: phosphoribosyl py...   149    1e-34 
gi|91092280|ref|XP_968163.1|  PREDICTED: similar to CG10078-PB...   149    1e-34   UniGene infoGene info
gi|86738817|ref|YP_479217.1|  amidophosphoribosyltransferase [...   149    1e-34   Gene info
gi|108803838|ref|YP_643775.1|  amidophosphoribosyltransferase ...   149    1e-34   Gene info
gi|56417304|ref|YP_154378.1|  amidophosphoribosyltransferase [...   149    1e-34   Gene info
gi|68231527|ref|ZP_00570694.1|  Amidophosphoribosyl transferas...   149    1e-34 
gi|13476498|ref|NP_108068.1|  amidophosphoribosyltransferase [...   149    1e-34   Gene info
gi|110680427|ref|YP_683434.1|  amidophosphoribosyltransferase ...   148    1e-34   Gene info
gi|15790489|ref|NP_280313.1|  PurF [Halobacterium sp. NRC-1] >...   148    1e-34   Gene info
gi|83590877|ref|YP_430886.1|  amidophosphoribosyltransferase [...   148    2e-34   Gene info
gi|70607346|ref|YP_256216.1|  glutamine amidophosphoribosyltra...   148    2e-34   Gene info
gi|83591744|ref|YP_425496.1|  Amidophosphoribosyl transferase ...   148    2e-34   Gene info
gi|118135105|gb|ABK62149.1|  amidophosphoribosyltransferase [Clos   147    2e-34 
gi|114704687|ref|ZP_01437595.1|  amidophosphoribosyltransferas...   147    2e-34 
gi|46190818|ref|ZP_00120962.2|  COG0034: Glutamine phosphoribo...   147    3e-34 
gi|15791583|ref|NP_281406.1|  amidophosphoribosyltransferase [...   147    3e-34   Gene info
gi|109690998|ref|ZP_01378068.1|  hypothetical protein Cjejd_01...   147    3e-34 
gi|86153607|ref|ZP_01071810.1|  amidophosphoribosyltransferase...   147    3e-34 
gi|15217112|gb|AAK92511.1|AF401037_1  phosphoribosylpyrophosph...   147    3e-34 
gi|23465689|ref|NP_696292.1|  amidophosphoribosyltransferase p...   147    3e-34   Gene info
gi|31789371|gb|AAP58488.1|  putative amidophosphoribosyltransf...   147    3e-34 
gi|50955761|ref|YP_063049.1|  amidophosphoribosyltransferase [...   147    3e-34   Gene info
gi|76619824|ref|XP_586663.2|  PREDICTED: similar to phosphorib...   147    3e-34   Gene info
gi|69246319|ref|ZP_00603892.1|  Amidophosphoribosyl transferas...   147    4e-34 
gi|95930096|ref|ZP_01312835.1|  amidophosphoribosyltransferase...   147    4e-34 
gi|24378560|ref|NP_720515.1|  amidophosphoribosyltransferase [...   147    4e-34   Gene info
gi|50843417|ref|YP_056644.1|  amidophosphoribosyltransferase [...   147    4e-34   Gene info
gi|114844768|ref|ZP_01455206.1|  amidophosphoribosyltransferas...   147    4e-34 
gi|116493199|ref|YP_804934.1|  Glutamine phosphoribosylpyropho...   147    4e-34   Gene info
gi|67873329|ref|ZP_00503608.1|  Amidophosphoribosyl transferas...   147    5e-34 
gi|56718733|gb|AAW28080.1|  chloroplast amidophosphoribosyltra...   147    5e-34 
gi|469195|dbj|BAA06024.1|  amidophosphoribosyltransferase [Arabid   146    5e-34   UniGene info
gi|15236185|ref|NP_195200.1|  ATASE2 (GLN PHOSPHORIBOSYL PYROP...   146    6e-34   UniGene infoGene info
gi|56207700|emb|CAI21321.1|  novel protein similar to vertebra...   146    6e-34   Gene info
gi|54641590|gb|EAL30340.1|  GA10055-PA [Drosophila pseudoobscura]   146    6e-34 
gi|28379217|ref|NP_786109.1|  amidophosphoribosyltransferase p...   146    6e-34   Gene info
gi|110633337|ref|YP_673545.1|  amidophosphoribosyltransferase ...   146    7e-34   Gene info
gi|76802790|ref|YP_330885.1|  amidophosphoribosyltransferase [...   146    7e-34   Gene info
gi|17223791|gb|AAL14833.1|  amidophosphoribosyltransferase [Droso   146    7e-34 
gi|57237201|ref|YP_178213.1|  amidophosphoribosyltransferase [...   146    8e-34   Gene info
gi|73663029|ref|YP_301810.1|  phosphoribosylpyrophosphate amid...   145    9e-34   Gene info
gi|86151435|ref|ZP_01069650.1|  amidophosphoribosyltransferase...   145    9e-34 
gi|58040073|ref|YP_192037.1|  amidophosphoribosyltransferase [...   145    9e-34   Gene info
gi|82750681|ref|YP_416422.1|  phosphoribosylpyrophosphate amid...   145    1e-33   Gene info
gi|21282682|ref|NP_645770.1|  phosphoribosylpyrophosphate amid...   145    1e-33   Gene info
gi|15924060|ref|NP_371594.1|  phosphoribosylpyrophosphate amid...   145    1e-33   Gene info
gi|114777606|ref|ZP_01452587.1|  amidophosphoribosyltransferas...   145    1e-33 
gi|116251312|ref|YP_767150.1|  putative amidophosphoribosyltra...   145    2e-33   Gene info
gi|49483234|ref|YP_040458.1|  putative amidophosphoribosyltran...   145    2e-33   Gene info
gi|68442595|ref|XP_700773.1|  PREDICTED: similar to phosphorib...   145    2e-33   Gene info
gi|38052001|gb|AAH60430.1|  MGC68694 protein [Xenopus laevis]       144    3e-33   UniGene infoGene info
gi|111035796|emb|CAL29423.1|  amidophosphoribosyltransferase [...   144    3e-33 
gi|29830678|ref|NP_825312.1|  amidophosphoribosyltransferase [...   144    3e-33   Gene info
gi|116130735|gb|EAA06481.3|  ENSANGP00000019430 [Anopheles gambia   144    3e-33 
gi|29376328|ref|NP_815482.1|  amidophosphoribosyltransferase [...   144    4e-33   Gene info
gi|58381034|ref|XP_310956.2|  ENSANGP00000019430 [Anopheles gambi   144    4e-33   Gene info
gi|57974672|ref|XP_566224.1|  ENSANGP00000026283 [Anopheles gambi   144    4e-33   Gene info
gi|45361473|ref|NP_989313.1|  hypothetical protein LOC394937 [...   144    4e-33   UniGene infoGene info
gi|57505628|ref|ZP_00371555.1|  amidophosphoribosyltransferase...   143    4e-33 
gi|104774301|ref|YP_619281.1|  Amidophosphoribosyltransferase ...   143    4e-33   Gene info
gi|88604289|ref|YP_504467.1|  amidophosphoribosyltransferase [...   143    5e-33   Gene info
gi|109074759|ref|XP_001085606.1|  PREDICTED: similar to phosph...   143    5e-33   Gene info
gi|62897077|dbj|BAD96479.1|  phosphoribosyl pyrophosphate amid...   143    5e-33   UniGene infoGene info
gi|29570798|ref|NP_002694.3|  phosphoribosyl pyrophosphate ami...   143    5e-33   UniGene infoGene info
gi|66820753|ref|XP_643947.1|  amidophosphoribosyltransferase [...   143    6e-33   Gene info
gi|108880885|gb|EAT45110.1|  amidophosphoribosyltransferase [A...   143    6e-33 
gi|15964877|ref|NP_385230.1|  amidophosphoribosyltransferase [...   143    6e-33   Gene info
gi|404861|gb|AAC27345.1|  glutamine PRPP amidotransferase [Homo s   142    8e-33   UniGene infoGene info
gi|72163146|ref|YP_290803.1|  amidophosphoribosyltransferase [...   142    9e-33   Gene info
gi|114594661|ref|XP_001140991.1|  PREDICTED: phosphoribosyl py...   142    1e-32   Gene info
gi|49474081|ref|YP_032123.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|31789476|gb|AAP58589.1|  putative amidophosphoribosyl trans...   142    1e-32 
gi|68535423|ref|YP_250128.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|92090041|ref|ZP_01274951.1|  Amidophosphoribosyl transferas...   142    1e-32 
gi|89091486|ref|ZP_01164487.1|  Amidophosphoribosyl transferas...   142    2e-32 
gi|116617836|ref|YP_818207.1|  Glutamine phosphoribosylpyropho...   142    2e-32   Gene info
gi|78696555|ref|ZP_00861064.1|  Amidophosphoribosyl transferas...   142    2e-32 
gi|21222488|ref|NP_628267.1|  amidophosphoribosyltransferase [...   142    2e-32   Gene info
gi|114594663|ref|XP_001140907.1|  PREDICTED: phosphoribosyl py...   141    2e-32   Gene info
gi|27467686|ref|NP_764323.1|  phosphoribosylpyrophosphate amid...   141    2e-32   Gene info
gi|92870676|gb|ABE79947.1|  Purine/pyrimidine phosphoribosyl t...   141    2e-32 
gi|14324573|dbj|BAB59500.1|  amidophosphoribosyl transferase [The   141    2e-32   Gene info
gi|13541185|ref|NP_110873.1|  amidophosphoribosyltransferase [The   141    2e-32   Gene info
gi|73975309|ref|XP_854170.1|  PREDICTED: similar to phosphorib...   141    2e-32   UniGene infoGene info
gi|58584513|ref|YP_198086.1|  Glutamine phosphoribosylpyrophos...   141    2e-32   Gene info
gi|85716395|ref|ZP_01047367.1|  amidophosphoribosyl transferas...   140    3e-32 
gi|1709918|sp|P52418|PUR1_SOYBN  Amidophosphoribosyltransferas...   140    3e-32   Gene info
gi|73749099|ref|YP_308338.1|  amidophosphoribosyltransferase [...   140    3e-32   Gene info
gi|15897546|ref|NP_342151.1|  Amidophosphoribosyltransferase (...   140    3e-32   Gene info
gi|74195118|dbj|BAE28301.1|  unnamed protein product [Mus musculu   140    4e-32   UniGene infoGene info
gi|84701849|ref|ZP_01016424.1|  amidophosphoribosyltransferase...   140    4e-32 
gi|27379171|ref|NP_770700.1|  amidophosphoribosyltransferase [...   140    4e-32   Gene info
gi|86749572|ref|YP_486068.1|  amidophosphoribosyltransferase [...   140    4e-32   Gene info
gi|88932935|ref|ZP_01138617.1|  Amidophosphoribosyl transferas...   140    4e-32 
gi|83751152|ref|ZP_00947566.1|  COG0034: Glutamine phosphoribo...   140    5e-32 
gi|37983539|gb|AAR06289.1|  5-phosphoribosyl-1-pyrophosphate a...   140    5e-32 
gi|94374541|ref|XP_001002879.1|  PREDICTED: similar to Amidoph...   140    5e-32   Gene info
gi|116514386|ref|YP_813292.1|  Glutamine phosphoribosylpyropho...   140    5e-32   Gene info
gi|92117816|ref|YP_577545.1|  amidophosphoribosyltransferase [...   140    5e-32   Gene info
gi|15227244|ref|NP_179247.1|  ATASE (GLN PHOSPHORIBOSYL PYROPH...   140    5e-32   UniGene infoGene info
gi|469193|dbj|BAA06023.1|  amidophosphoribosyltransferase [Arabid   140    6e-32   UniGene info
gi|15607948|ref|NP_215323.1|  amidophosphoribosyltransferase [...   140    6e-32   Gene info
gi|94374539|ref|XP_001002886.1|  PREDICTED: similar to Amidoph...   140    6e-32   Gene info
gi|25029032|ref|NP_739086.1|  amidophosphoribosyltransferase [...   140    6e-32   Gene info
gi|85860900|ref|YP_463102.1|  amidophosphoribosyltransferase [...   139    7e-32   Gene info



gi|78778389|ref|YP_396501.1| Gene info amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9312]
 gi|78711888|gb|ABB49065.1| Gene info amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9312]
Length=486

 Score =  414 bits (1064),  Expect = 2e-114, Method: Composition-based stats.
 Identities = 207/222 (93%), Positives = 212/222 (95%), Gaps = 0/222 (0%)

Query  1    PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYR  60
            PDSIMNGISVYKARLKMGDYLSETIKE I +GDVDVVMPIPDSSRPAAMQVARQLGIEYR
Sbjct  265  PDSIMNGISVYKARLKMGDYLSETIKESINTGDVDVVMPIPDSSRPAAMQVARQLGIEYR  324

Query  61   EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQM  120
            EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMS EFKNKNVLIVDDSIVRGTTSKEIVQM
Sbjct  325  EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSTEFKNKNVLIVDDSIVRGTTSKEIVQM  384

Query  121  AKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVEN  180
            AKDAGANKV FTSAAPPVRFPHVYGINMPNR ELIAHDRTISEIA++LEIDNLVYQSVEN
Sbjct  385  AKDAGANKVFFTSAAPPVRFPHVYGINMPNRCELIAHDRTISEIANQLEIDNLVYQSVEN  444

Query  181  LRKSIISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS  222
            LRKSIIS+S +E LEMSCFTG YVTG VNQEYLNWVENEY S
Sbjct  445  LRKSIISESPIEDLEMSCFTGIYVTGKVNQEYLNWVENEYKS  486


>gi|33860564|ref|NP_892125.1| Gene info amidophosphoribosyltransferase [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gi|33633506|emb|CAE18463.1| Gene info Glutamine amidotransferase class-II:Phosphoribosyl transferase 
[Prochlorococcus marinus subsp. pastoris str. CCMP1986]
Length=486

 Score =  404 bits (1039),  Expect = 1e-111, Method: Composition-based stats.
 Identities = 197/222 (88%), Positives = 211/222 (95%), Gaps = 0/222 (0%)

Query  1    PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYR  60
            PDS+MNGISVY+ARLKMGDYL+ETIK+ I  GDVDVVMPIPDSSRPAAMQVARQLGIEYR
Sbjct  265  PDSVMNGISVYQARLKMGDYLAETIKQSIQCGDVDVVMPIPDSSRPAAMQVARQLGIEYR  324

Query  61   EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQM  120
            EGFFKNRYVGRTFIMPG QKRK+SVRQKLNAMS EFKNKNVLIVDDSIVRGTTSK+IVQM
Sbjct  325  EGFFKNRYVGRTFIMPGHQKRKQSVRQKLNAMSTEFKNKNVLIVDDSIVRGTTSKQIVQM  384

Query  121  AKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVEN  180
            AKDAGANKV FTSAAPPVR+PHVYGINMPNRDELIAHDR+I EIA+KLEID+LVYQSVEN
Sbjct  385  AKDAGANKVFFTSAAPPVRYPHVYGINMPNRDELIAHDRSIIEIAEKLEIDHLVYQSVEN  444

Query  181  LRKSIISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS  222
            LRKSII+DS ++ LEMSCFTG+YVTGTVNQEYL WVENEY S
Sbjct  445  LRKSIINDSPIQELEMSCFTGSYVTGTVNQEYLKWVENEYNS  486


>gi|84518952|ref|ZP_01006301.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9211]
 gi|84513701|gb|EAQ10039.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9211]
Length=485

 Score =  361 bits (927),  Expect = 1e-98, Method: Composition-based stats.
 Identities = 172/222 (77%), Positives = 198/222 (89%), Gaps = 0/222 (0%)

Query  1    PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYR  60
            PDSIMNGISVY+ARL+MGD L+ TIK+ + SGD+DVVMPIPDSSRP+AMQVARQLG+EYR
Sbjct  264  PDSIMNGISVYEARLRMGDRLANTIKKTLNSGDIDVVMPIPDSSRPSAMQVARQLGVEYR  323

Query  61   EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQM  120
            EGFFKNRYVGRTFIMPGQ +RKKSVRQKLNAMS EFK KN+LIVDDSIVRGTTS+EIVQM
Sbjct  324  EGFFKNRYVGRTFIMPGQSQRKKSVRQKLNAMSTEFKGKNILIVDDSIVRGTTSREIVQM  383

Query  121  AKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVEN  180
            A+ AGANKV+FTSAAPP+RFPHVYGINMP++DELIA+DR+I EI + L +D LVYQ V +
Sbjct  384  ARLAGANKVTFTSAAPPIRFPHVYGINMPSKDELIAYDRSILEIQNILLVDQLVYQEVGD  443

Query  181  LRKSIISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS  222
            L+ +I+ DS +E L+MSCFTG YVTGTV  EYLNWVE EY S
Sbjct  444  LKTAILDDSKIEDLDMSCFTGHYVTGTVTNEYLNWVETEYIS  485


>gi|33239456|ref|NP_874398.1| Gene info amidophosphoribosyltransferase [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gi|33236981|gb|AAP99050.1| Gene info Glutamine phosphoribosylpyrophosphate amidotransferase [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
Length=485

 Score =  348 bits (892),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 165/222 (74%), Positives = 199/222 (89%), Gaps = 0/222 (0%)

Query  1    PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYR  60
            PDS+MNGISVY+ARL+MGDYL++TI+E ITSG++DVVMPIPDSSRP+AMQVARQLG+EYR
Sbjct  264  PDSVMNGISVYEARLRMGDYLAKTIQEQITSGEIDVVMPIPDSSRPSAMQVARQLGLEYR  323

Query  61   EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQM  120
            EGFFKNRYVGRTFIMPGQ +RKKSVRQKLNAMS+EFK KNVL+VDDSIVRGTTS+EIVQM
Sbjct  324  EGFFKNRYVGRTFIMPGQAQRKKSVRQKLNAMSSEFKGKNVLLVDDSIVRGTTSREIVQM  383

Query  121  AKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVEN  180
            AK AGANKV+FTSAAPP+RFPHVYGINMP++ ELIAHD++I +I + L  D LVYQ + +
Sbjct  384  AKLAGANKVTFTSAAPPIRFPHVYGINMPSKMELIAHDKSIDQIQETLLADGLVYQKISD  443

Query  181  LRKSIISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS  222
            L +SI+  S V++L++SCF G YVTG V +EYL WV ++Y+S
Sbjct  444  LEQSILKGSQVKNLDLSCFNGEYVTGKVTEEYLAWVGSKYSS  485


>gi|33862277|ref|NP_893837.1| Gene info amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9313]
 gi|33640390|emb|CAE20179.1| Gene info Glutamine amidotransferase class-II:Phosphoribosyl transferase 
[Prochlorococcus marinus str. MIT 9313]
Length=485

 Score =  343 bits (880),  Expect = 3e-93, Method: Composition-based stats.
 Identities = 165/217 (76%), Positives = 190/217 (87%), Gaps = 0/217 (0%)

Query  1    PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYR  60
            PDS+M+GISVY+ARL+MGD L+ETI++   SGD+DVVMPIPDSSRPAAMQVARQLGIEYR
Sbjct  264  PDSVMSGISVYEARLRMGDRLAETIEKYTPSGDIDVVMPIPDSSRPAAMQVARQLGIEYR  323

Query  61   EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQM  120
            EGFFKNRYVGRTFIMPGQ +RKKSVRQKLNAM  EFK KNVLIVDDSIVRGTTSKEIVQM
Sbjct  324  EGFFKNRYVGRTFIMPGQAQRKKSVRQKLNAMGTEFKGKNVLIVDDSIVRGTTSKEIVQM  383

Query  121  AKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVEN  180
            A+ AGANKV+FTSAAPPVR+ HVYGINMPNR ELIA++RTI EI+ +L  D++VYQ V +
Sbjct  384  ARVAGANKVTFTSAAPPVRYSHVYGINMPNRHELIAYNRTIPEISSELSTDHMVYQEVAD  443

Query  181  LRKSIISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVE  217
            L  +I+  S V  LE+SCFTG Y+TGTV  EYL+W+E
Sbjct  444  LEAAIVEGSGVSELELSCFTGEYITGTVTSEYLDWIE  480

ORF finding

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 6 to base 221.
AATGAAAGAACGCAAATTAAGAATGATTATTTCCTCAAAATTTTACCAAGTAATTATTAT
CTTGACATTGAAACTAATAAAAATAAATCTGCTAGATTAGACTTTGATAAATTAATTTTT
AAATCTAATAAAACGAATTTTTTAATTGACTTTTTAAAATTAGATAAAGATGAATATCTT
GAAAATTGTTTTCGACTAGAAAACTTGCTCGCCTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
NERTQIKNDYFLKILPSNYYLDIETNKNKSARLDFDKLIFKSNKTNFLIDFLKLDKDEYL
ENCFRLENLLA*

>ORF number 2 in reading frame 3 on the direct strand extends from base 465 to base 656.
GGAAAACGAACTGGAGGAGCAGCTGATGTGAAAGAAACTTTATTTGCTCCTGCATCTTTA
GCCATCTGTACAATTTCTTTTGAAGTAGTACCTCTTACTATCGAATCATCAACTATTAAT
ACATTTTTATTTTTAAATTCTGCACTCATAGCATTTAACTTTTGTCTTACGGATTTCTTA
CGTTTCTGTTGA

>Translation of ORF number 2 in reading frame 3 on the direct strand.
GKRTGGAADVKETLFAPASLAICTISFEVVPLTIESSTINTFLFLNSALIAFNFCLTDFL
RFC*

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 669.
CCAGATTCAATTATGAATGGAATTTCAGTGTATAAAGCTCGTTTGAAAATGGGAGATTAT
TTATCTGAAACAATAAAGGAAATAATTACTTCTGGAGATGTTGATGTTGTAATGCCTATT
CCTGATTCTTCACGACCTGCTGCTATGCAAGTTGCAAGACAGCTAGGTATTGAGTATAGA
GAGGGCTTTTTTAAAAATAGATATGTTGGTAGAACATTTATTATGCCTGGTCAACAGAAA
CGTAAGAAATCCGTAAGACAAAAGTTAAATGCTATGAGTGCAGAATTTAAAAATAAAAAT
GTATTAATAGTTGATGATTCGATAGTAAGAGGTACTACTTCAAAAGAAATTGTACAGATG
GCTAAAGATGCAGGAGCAAATAAAGTTTCTTTCACATCAGCTGCTCCTCCAGTTCGTTTT
CCTCATGTTTATGGAATTAATATGCCTAATAGAGATGAATTAATAGCTCATGATAGAACA
ATAAGTGAAATTGCTGATAAACTTGAAATTGATAATCTCGTTTATCAAAGTGTTGAAAAT
TTACGTAAATCTATAATAAGTGATTCTCTTGTTGAACATTTGGAGATGAGTTGTTTTACT
GGTACTTATGTAACAGGAACAGTAAATCAAGAGTATTTAAATTGGGTCGAAAATGAATAT
ACTTCTTAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
PDSIMNGISVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYR
EGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQM
AKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVEN
LRKSIISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.