ORF PM16700

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160035.1
Annotathon code: ORF_PM16700
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : lombardpetitjea
Annotated on : 2008-03-20 19:24:13
  • LOMBARD jonathan
  • PETITJEAN celine

Synopsis

Genomic Sequence

>AACY01160035.1 ORF_PM16700 genomic DNA
ATATTAAAATGAAAGAACGCAAATTAAGAATGATTATTTCCTCAAAATTTTACCAAGTAATTATTATCTTGACATTGAAACTAATAAAAATAAATCTGCT
AGATTAGACTTTGATAAATTAATTTTTAAATCTAATAAAACGAATTTTTTAATTGACTTTTTAAAATTAGATAAAGATGAATATCTTGAAAATTGTTTTC
GACTAGAAAACTTGCTCGCCTAAGAAGTATATTCATTTTCGACCCAATTTAAATACTCTTGATTTACTGTTCCTGTTACATAAGTACCAGTAAAACAACT
CATCTCCAAATGTTCAACAAGAGAATCACTTATTATAGATTTACGTAAATTTTCAACACTTTGATAAACGAGATTATCAATTTCAAGTTTATCAGCAATT
TCACTTATTGTTCTATCATGAGCTATTAATTCATCTCTATTAGGCATATTAATTCCATAAACATGAGGAAAACGAACTGGAGGAGCAGCTGATGTGAAAG
AAACTTTATTTGCTCCTGCATCTTTAGCCATCTGTACAATTTCTTTTGAAGTAGTACCTCTTACTATCGAATCATCAACTATTAATACATTTTTATTTTT
AAATTCTGCACTCATAGCATTTAACTTTTGTCTTACGGATTTCTTACGTTTCTGTTGACCAGGCATAATAAATGTTCTACCAACATATCTATTTTTAAAA
AAGCCCTCTCTATACTCAATACCTAGCTGTCTTGCAACTTGCATAGCAGCAGGTCGTGAAGAATCAGGAATAGGCATTACAACATCAACATCTCCAGAAG
TAATTATTTCCTTTATTGTTTCAGATAAATAATCTCCCATTTTCAAACGAGCTTTATACACTGAAA

Translation

[3 - 644/866]   indirect strand
>ORF_PM16700 Translation [3-644   indirect strand]
SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSI
VRGTTSKEIVQMAKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISDSLVEHLEMSCFTGTYVTGTV
NQEYLNWVENEYTS

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

                                                 +---------Gviolaceus
                                                 ! 
                                                 !        +--Npunctifor
                                               +-4   +----1 
                                               ! ! +-2    +---Avariabili
                     Cyanobacteria             ! ! ! ! 
               +-------------------------------5 +-3 +--------Terythraeu
               !                               !   ! 
               !                               !   +---------Synechocys
               !                               ! 
               !                               +---------Synechococ2
               ! 
               !       +---------Synechococ      Cyanobacteria - chroococcales
  +------------9       !  
  !            !   +--13       +---Promar1        Cyanobacteria - Prochlorales 
  !            !   !   !  +---10  
  !            !   !   !  !    +ORF_PM1670
  !            !   !   +-14  
  !            !   !      !     +----Promar3      Cyanobacteria - Prochlorales
  !            !   !      !  +-12  
  !            +--11      +-15  +------Promar4    Cyanobacteria - Prochlorales 
  !                !         !  
  !                !         +------Promar2       Cyanobacteria - Prochlorales 
  !                !  
  !                !       +---Bcenocepac    b-proteobacteria - Burkholderiales
  !                !   +---7 
  !                +---8   +--Bphytofirm     b-proteobacteria - Burkholderiales
  !                    ! 
  !                    +------Reutropha      b-proteobacteria - Burkholderiales
  ! 
  6--Yfrederiks                            g-proteobacteria - enterobacteriales
  ! 
  +---Ecoli                                g-proteobacteria - enterobacteriales



Detail des cyanobactéries:

Gloeobacter violaceus --> Gloeobacteria
Nostoc punctiforme --> Nitrosomonadales
Anabaena variabilis  --> Nostocales
Trichodesmium erythraeum  --> oscillatoriales
Synechocystis sp. --> Chroococcales

Annotator commentaries

1. Recherche des ORF avec SMS

- Recherche sur le brin direct (any codon): nous trouvons deux séquences codantes d'environ 200 bases en phase 2 - Recherche sur le brin inverse (any codon): nous trouvons une séquence de 644 bases en phase 3. Nous avons choisi cette séquence d'étude. - Recherche de codons d'initiation et de codons stop: on trouve un codon stop à la fin de la séquence et deux codons d'initiation, une Met et un codon alternatif codant pour une Val. Nous utilisons l’ensemble de la séquence car la Met et la Val peuvent ne pas être le codon d’initiation. Hypothèse : La protéine est incomplète, il manquerait le debut. L’estimation du poids moléculaire (24.40 kDa) est donc non significative.


2. Domaines protéiques avec interpro.

Nous trouvons différents domaines protéiques. «Amidophosphoribosyl transferase » (du 1er au 198ieme aa) englobe les autres domaines interpro dont les désignations sont assez proches voir equivalentes("Purine/pyrimidine phosphoribosyl transferase","Phosphoribosyltransferase").

3. Recherche de protéines homologues avec Blastp

Swissprot : protéines homologues à E-Value relativement fort (7e-65 à 6e-21). NR : Les E-Value des protéines homologues sont entre 1e-109 et 1e-58 environ. Elles ont globalement toutes la même description «Amidophosphoribosyltransferase ». Ceci appui les résultats de recherche des domaines protéiques.

On distingue trois groupes intéressants pour faire l’arbre phylogénétique: l’espèce de cyanobactéries Prochlorococcus marinus, les b-proteobactéries et les cyanobactéries en générale. Nous choisissons comme groupe extérieur deux g-proteobactéries.


4. Alignement multiple avec clustalw (infobiogen)

L’alignement multiple confirme nos deux hypothèses de départ: a. Le début de la protéine manque. b. La séquence correspond à la fin des protéines alignées. Notre codon stop ce trouve au même niveau que ceux des autres séquences homologues.

Globalement l’alignement multiple montre un très fort taux d’homologie entre ces différentes séquences. On trouve des regions d'une vingtaine d'acides aminés extremement bien conservés et une divergence relative au niveau du C-terminal.

5. Les arbres phylogénétiques avec infobiogen

Le test de parcimonie n’offre pas de résultats intéressants.

NJ: notre séquence est très proche des séquences de l’espèce Prochlorococcus marinus (que nous avons notée "Promar").

Les b- proteobacteries apparaissent dans l'arbre comme étant plus proches de l’espèce Prochlorococcus marinus que ne le sont les autres cyanobactéries pour cette séquence. On s'attendrait à ce que les Prochlorococcus marinus soient plus proches des autres cyanobacteries que des b-proteobacteries. Nous avons réalisé un Blast sur la séquence ayant l'E-Value le plus fort (Prochlorococcus marinus). Il confirme les relations observées dans l'arbre.

Ceci peut être expliqué par des relations de paralogie. Le noeud 9 serait un événement de duplication chez un ancêtre commun des b-proteobactéries et des cyanobacteries, suivi d'une divergence entre les deux séquences paralogues.


+-----AA' (Cyanobactéries) ! ! A ---- 9 ---- AA------- AA’-------!(spéciation) (duplication) (divergence)  ! ! ! +-----AA' (b-protéobactéries)

A et A' sont des séquences paralogues dont le processus de duplication s'est produit chez un ancêtre commun aux cyanobactéries et aux b-protéobactéries.

Les séquences A des deux taxons, les A’ des b-protéobactéries et les A’ des Prochloroccocus et Synochoccocus auraient déjà été étudiées, non les séquences A’ d’autres cyanobactéries.

Hypothèse : Notre ORF serait très proche des séquences A’ connues des cyanobactéries, un peu moins proche des A’ des b-protéobactéries (qui sont des orthologues) et plus lointain des homologues A des deux groupes (paralogues), notamment celui des cyanobactéries que l’on étudie préférentiellement. Ceci explique la topologie de notre arbre. Nous pourrions aussi supposer que A’ a été perdue par certaines espèces de cyanobactéries, mais le fait que l’on trouve des Synechoccocus au niveau de deux branches confirme plutôt le fait qu’on ait les deux séquences mais que l’une d’entre elles ne soit pas encore dans les bases de données. Nous pouvons émettre l’hypothèse que notre séquence viendrait d’un individu de l’espèce Prochloroccocus marinus.

6. Etablissement des orthologues et lecture de l'arbre phylogénétique

Les relations de paralogie existe dans le groupe contenant les Prochloroccocus. Les noeuds 12 et 14 serai des duplications. ORF_PM16700 et "Promar1" entretiennent donc des relations de paralogie entre elles. Nous pouvons émettre l’hypothèse que notre séquence viendrait d’un individu de l’espèce Prochloroccocus marinus.


Les paralogues de notre séquence seraient: Promar1 YP_396501.1 pas de symbole de gène (région "purF")

Promar 2 ZP_01006301.1 pas de symbole de gène (région "purF") Promar 3 NP_874398.1 gène "purF" Promar 4 NP_893837.1 gène "purF"

Gloeobacter violaceus NP_925060.1 gène "purF" Synechocystis sp. NP_442062.1 gène "purF" Nostoc punctiforme ZP_00107293.1 pas de symbole de gène (région "purF") Anabaena variabilis YP_324138.1 pas de symbole de gène (région "purF") Trichodesmium erythraeum YP_723231.1 pas de symbole de gène (région "purF") et Synechoccocus sp. 2 JA-3-3Ab YP_473761.1 gène "purF"


Les orthologues de notre séquence seraient: Synechococcus sp. Ralstonia eutropha, Burkholderia phytofirmans et Burkholderia cenocepacia

Yersinia frederiksenii, Escherichia coli.

Symbole du gène : six de ces sequences (paralogues et orthologues) ont pour symbole de gene « purF » ainsi que neuf autres se situent dans la région «PurF »; nous pouvons donc supposer que « purF » est le symbole de notre gène.


7. Processus biologique et fonction moléculaire

Fiche interpro de notre domaine: la protéine associée serait une amidophosphoribosyl transferase, ce qui est confirmé par les fiches des homologues trouvés avec le Blastp NR. Cette enzyme intervient dans la voie de synthèse des nucléotides à partir des purines, où elle limite la vitesse d'avancement de la réaction. Les nucléotides seront utilisés dans le métabolisme de l'ADN, mais aussi de l'ARN, l'ATP, etc.


Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Bcenocepacia        --------------------------------MCGIVGVISQSP-VNQLIYDSLLLLQHR
Bphytofirmans       --------------------------------MCGIVGVVSHSP-VNQLIYDSLLLLQHR
Reutropha           --------------------------------MCGIVGVVSATP-VNQLIYDSLLLLQHR
Promar1             --------------------------------MCGIVGIVSSDD-VNQQIYDSLLLLQHR
ORF_PM16700         ------------------------------------------------------------
Promar3             --------------------------------MCGIVGIFSNHQ-INQLIYDSLLLLQHR
Promar4             --------------------------------MCGIVGIVSNNQ-INQKIYDSLLLLQHR
Promar              --------------------------------MCGIVGIVSTAL-VNQQIYDSLLLLQHR
Synechococcus       --------------------------------MCGIIGMLCVDS-VNQQIYDNLLLLQHR
Yfrederiksenii      --------------------------------MCGIVGIAGFSP-VNQSIYDALTVLQHR
Ecoli               --------------------------------MCGIVGIAGVMP-VNQSIYDALTVLQHR
Gviolaceus          ------------------MTYAAPSAPDKPEEACGVFGILAPGEAVAKLTYFGLFALQHR
Synechococcus2      MAAKAGAEPSSAQAGLQERPAEFWNSQEGPKEACGVFGILAPGEEVAKLTYFGLFALQHR
Npunctiforme        MTSIHSVTSDEYPDPTNNPINSHENQPDKPEEACGVFGIYAPGENVAKLTYFGLYALQHR
Avariabilis         MIPIDSVTPDEYPNQTNNPIDSQENRPDKPEEACGVFGIYAPGENVAKLTYFGLYALQHR
Terythraeum         --------MTDNCSSNTEEFFVHYQKIDKPEEACGVFGIYAPEEDVTKLTYFGLYALQHR
Cynechocystis       -----MFPPSSDLTELNDGQPLSGHHADKPEEACGVFGIYAPEEAVAKLTYFGLYALQHR
                                                                                

Bcenocepacia        GQDAAGIATADGS-NFHMYKANGMVRDVFRTRNMRSLPGTYGIGQVRYPTAGSASSEAEA
Bphytofirmans       GQDAAGIATANGS-NFHMHKANGMVRDVFRTRNMRSLPGTTGIGQVRYPTAGSASSEEEA
Reutropha           GQDAAGIATANGS-TFHMHKANGLVRDVFRTRNMRSLPGAAGIGQVRYPTAGSASSEEEA
Promar1             GQDSTGIATMENT-IFHIHKAKGQVNTAYRTRDMRNLIGKIGLGHVRYATKGSAESVEEA
ORF_PM16700         ------------------------------------------------------------
Promar3             GQDSTGIATMEGS-LFHICKSKGQVKEAYRTRDMRSLLGNIGIGHVRYATKGTADSENEA
Promar4             GQDSTGIATMEGS-VFHLHKSKGQVKEAYRTRDMRILTGNIGIGHVRYATSGEAHREDEA
Promar              GQDSTGIATMDGS-VFHLHKARGQVREAYRTRDMRSLIGNIGLGHVRYATKGAAEREEEA
Synechococcus       GQDSAGIVTMDNH-TFHVHKQRGRVREAFRTRDMRKLLGNAGIGHVRYATRGAAASEEEV
Yfrederiksenii      GQDAAGIVTIDAHNGFRLRKANGLVKDVFETRHMLRLQGNMGIGHVRYPTAGSS-SASEA
Ecoli               GQDAAGIITIDANNCFRLRKANGLVSDVFEARHMQRLQGNMGIGHVRYPTAGSS-SASEA
Gviolaceus          GQESAGIAVLDGD-RLTMHKDMGLVSQVFDEALLNELQGQLAVGHTRYSTTGSSRKVNAQ
Synechococcus2      GQESAGIATFEGA-FCRVHKAMGLVSQVFDPVNLGQLSGDLAVGHTRYSTTGSSRAANAQ
Npunctiforme        GQESAGIATFEGT-QVHLHKDMGLVSQVFNETILDQLPGSLAVGHTRYSTTGSSRKVNAQ
Avariabilis         GQESAGIATFEGT-TVHLHKDMGLVSQVFNESILEELPGDIGVGHTRYSTTGSSRKVNAQ
Terythraeum         GQESAGIATFQGD-KIYIHKGMGLVSQVFNESILEQLPGDIGIGHTRYSTTGSSRIINAQ
Cynechocystis       GQESAGIATFAGT-TVHCHKDMGLVSQVFQESKLNEMVGTLAVGHTRYSTTGSSHRVNAQ
                                                                                

Bcenocepacia        QPFYVNAPFGIILAHNGNLTNWQQLKDEMFRIDRRHINTNSDSEVLLNVFAHELQLSTTG
Bphytofirmans       QPFYVNAPFGIILAHNGNLTNWQQLKDEMFRIDRRHINTNSDTEVMLNVLAHELQLSSSG
Reutropha           QPFYVNAPYGVILAHNGNLTNWEQLREEMFRRDRRHINTHSDTEVLLNVLADELQRASNG
Promar1             QPFYVNAPYGIVLIHNGNLTNTRDLEKQLFNIDKRHTNSSSDTEMLLNVLATELQEQIHN
ORF_PM16700         ------------------------------------------------------------
Promar3             QPFYVNAPYGIILVHNGNLTNTRELEKQLFNIDRRHTNSSSDTEMLLNIFATEIQAQIHG
Promar4             QPFYVNAPYGIILVHNGNLTNTRELEKELFSIDRRHTNSSSDTEMLLNVLATEIQSENYG
Promar              QPFYVNAPYGIILIHNGNLTNTRELDRDLFNIDRRHTNSKSDTEMLLNVLATELQLKIYG
Synechococcus       QPFYVNAPYGITFVHNGNLTNTHQLEQDLFKIDRRHTNSTSDTEMLVNVLATEIQSQLTG
Yfrederiksenii      QPFYVNSPFGITLAHNGNLTNAHQLRKKLFEVSRRHVNTTSDSEILLNIFASELDR-FQH
Ecoli               QPFYVNSPYGITLAHNGNLTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDN-FRH
Gviolaceus          PVVSRTRLGPVVLAHNGNLVNAAQLREELLAREHT-LLATTDSEEIVHAIGEAVDDGKGW
Synechococcus2      PIIVETRLGPLALAHNGNLVNAEELRQELEAADRH-LTGSTDSECIAHAIAQAVNQGQGW
Npunctiforme        PAVLETRLGSLALAHNGNLVNTVQLRQELLEKKYN-LVTTTDSEMIAFAIAEAINAGADW
Avariabilis         PAVLDTRLGKLALAHNGNLVNTVKLREELVNSNCN-LVTTTDSEMIAFAIAQAVNAGADW
Terythraeum         PTVVETRLGQLALAHNGNLVNTAELREMLIECGCS-FNSTTDSEMIALAIATHVKVGKSW
Cynechocystis       PAVLPTRLGPLALAHNGNLVNTNQLREALAERGCEDFVTTTDSEMIAVAIANEVDKGKDW
                                                                                

Bcenocepacia        LELDPASVFKAVSGVHRRLQGSYAIVSLIAGYGLLAFRDPFGIRPLCIGKLET-------
Bphytofirmans       LQLDPAALFKAVSGVHRRVRGSYAIVSLIAGYGLLGFRDPFGIRPLCLGKQET-------
Reutropha           MALDPDTIFTAVSGLHRRVRGSYAIAAQIAGYGMLAVRDPFGIRPLCLGSVET-------
Promar1             QELEPDIIFDAVNSLHKRIQGSYASIALLSGHGLLAFRDPFGIRPLVIGKRLSS------
ORF_PM16700         ------------------------------------------------------------
Promar3             SSLSPEHIFSAIKSLHKRVEGSYAAIALIAGHGLVAFRDPYGIRPLVLGKRIS-------
Promar4             SSLSPEHIFSAISSLHKRVEGTYSAIAMIAGYGLLAFRDPYGIRPLVLGKRVL-------
Promar              SDLTPDQVFDAVTSVHQRVEGSYTSIALIAGHGLLAFRDPFGIRPLVLGKRKS-------
Synechococcus       RDLTPDQLFNAVASLHHRVQGSYAAIALIAGHGMLAFRDPYGIRPLILGRRLS-------
Yfrederiksenii      YPLESDNIFAAVAATHQLIRGAYACVAMIIGHGMVAFRDPNGIRPLVIGKRTLA------
Ecoli               YPLEADNIFAAIAATNRLIRGAYACVAMIIGHGMVAFRDPNGIRPLVLGKRDID------
Gviolaceus          VEGTVHALKRCRGAFSLVIG---------TPAGLMGTRDANGVRPLVIGTLKG-------
Synechococcus2      VEATCQALRRCRGAFSLVIG---------TPEGLIGARDPYGVRPLVLGFLSRNPAKQEL
Npunctiforme        LEGSIQAFHRCEGAFSLVIG---------TPNGVMGVRDTNGIRPLVIGTLA--------
Avariabilis         LDGAIQAFHRCEGAFSLVIG---------TPVGVMGVRDTNGIRPLVIGTLP--------
Terythraeum         LEAAISAFHLCQGAFSLTIA---------TQEGLMGVRDPHGIRPLVIGTLEN-------
Cynechocystis       VEGTIAALTLCAGAYSLVIG---------TPEGIIGVRDPHGIRPLVIGVLE--------
                                                                                

Bcenocepacia        -------------------EHGTEWMVASESVAVEGIGFEFVRDLEPGEAIFIDKAGNFH
Bphytofirmans       -------------------AEGVEWILASESVAIEGIGFEFVRDVAPGEAIFIDIEGNLH
Reutropha           -------------------PTGKEWMVASESVALEGIGYKLERDVAPGEAIFIDLDGKLY
Promar1             ------------------KTKKEEWMVASESLVLENNDYQVVRDVDPGEAIFINLNGEFF
ORF_PM16700         ------------------------------------------------------------
Promar3             ------------------EDNRDEWILASESLVLENNDFQIVRDLDPGEAVFISVNGELH
Promar4             ------------------DNGKTEWIVASESLVLENNDFDVVRDVVPGEAIFISNEGEFY
Promar              ------------------LEGADEWIVASESLVLENGDYEIVRDVDPGEAIFITQNGELY
Synechococcus       ------------------EQGREEWIVASESLVIENSGYEIVRDVDPGEAVFIDVDSNLH
Yfrederiksenii      -------------------DGRNEYMVASESVALDTLGFEFLRDVAPGEAVYITEKGQLF
Ecoli               -------------------ENRTEYMVASESVALDTLGFDFLRDVAPGEAIYITEEGQLF
Gviolaceus          -----------------------RYVLASETCALSIIGAKYLRDVEPGELVFITESG-LE
Synechococcus2      LQPQMLGILCSDGKPNHPEAQPLHCVLASETCALDIIGAEYLRQVEPGELVWISRQG-LQ
Npunctiforme        -------------------GNPVRYVLASETCGLDIIGAEYLRDVEPGELVWITEEG-LA
Avariabilis         -------------------GNPVRYVLSSETCGLDIIGADYLRDVEPGEVVWITEEG-LA
Terythraeum         -------------------TNSKRYVLASETCALDIIGAEYLRDVEPGELVWITEKG-IA
Cynechocystis       -------------------EETPRYVLASETCALDIIGATYVRTVEAGELVHITESG-LV
                                                                                

Bcenocepacia        SQQCAENPTLNPCMFEYVYLARPDSCLDGVPVYNVRLRMGDYLAEKIKRELPNVPIDVVM
Bphytofirmans       SQQCATNPSLNPCIFELVYLARPDSVLDGVPVYNVRLRMGDYLAEKIKRELPDVPIDVVM
Reutropha           SKQCAENAVLTPCIFEYVYLARPDSCIDGVPVYDARLRMGDYLAEKIRQEVSAGDVDVVM
Promar1             SKQCSENPILCPCAFEYVYLARPDSIMNGISVYKARLKMGDYLSETIKESINTGDVDVVM
ORF_PM16700         ------------------------------SVYKARLKMGDYLSETIKEIITSGDVDVVM
Promar3             SQQCSDNPKLFPCSFEYVYLARPDSIMNGISVYEARLRMGDRLANTIKKTLNSGDIDVVM
Promar4             SKQCADNPQLFPCSFEYVYLARPDSVMNGISVYEARLRMGDYLAKTIQEQITSGEIDVVM
Promar              SRQCAKNPRLVPCSFEYVYLARPDSVMSGISVYEARLRMGDRLAETIEKYTPSGDIDVVM
Synechococcus       QRQCADSPRLIPCAFEYVYLARPDSVMNGISVYESRLRMGDRLAQTIAETLPAGDIDVVM
Yfrederiksenii      TRQCAENPKYNPCLFEYVYFARPDSFMDKISVYSARVRMGQKLGAKIAKQWEDLDIDVVI
Ecoli               TRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVI
Gviolaceus          SHHWAK-PEPRMCIFEMIYFARPDSRVNAESLYTYRERLGEILAQ-----EAPVEADVVI
Synechococcus2      SVRWAE-ATPKLCIFEMIYFARPDSCMHGESLYSYRVRLGEQLAK-----EAPAEADWVI
Npunctiforme        SYHWSQQPQRKLCIFEMIYFARPDSIMHNESLYSYRMRLGHQLAK-----ESCVDADIVF
Avariabilis         SYHWSQKPERRLCIFEMIYFARPDSQMHNETLYSYRMRLGRQLAA-----ESYVDADIVF
Terythraeum         SFHWSQKTQKKLCIFEMIYFARPDSMMEGGSLYSYRLRIGRQLAR-----ESFISADMVI
Cynechocystis       SHRLAESADRKLCVFEMIYFSRPDSVVNDESLYTYRMRIGKHLAK-----ESPVDADLVM
                                                  .:*  * .:*  *.            * *:

Bcenocepacia        PIPDSSRPAAMQVAAKLGVEYREGFFKNRYVGRTFIMPGQAVRKKSVRQKLNAMSIEFKD
Bphytofirmans       PIPDSSRPAAMQVAKKLGVEYREGFFKNRYVGRTFIMPGQAVRKKSVRQKLNAMGIEFKG
Reutropha           PIPDSSRPAAMQVANRLGVNYREGFFKNRYVGRTFIMPGQAVRKKSVRQKLNAMGVEFKG
Promar1             PIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSTEFKN
ORF_PM16700         PIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKN
Promar3             PIPDSSRPSAMQVARQLGVEYREGFFKNRYVGRTFIMPGQSQRKKSVRQKLNAMSTEFKG
Promar4             PIPDSSRPSAMQVARQLGLEYREGFFKNRYVGRTFIMPGQAQRKKSVRQKLNAMSSEFKG
Promar              PIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPGQAQRKKSVRQKLNAMGTEFKG
Synechococcus       PIPDSARPSAMQVAKRLGLDYREGFYKNRYVGRTFIMPGQAERKKSVRQKLNALGTEFAG
Yfrederiksenii      PIPETSCDIALEIARILDKPYRQGFVKNRYVGRTFIMPGQQERRKSVRRKLNANRAEFRD
Ecoli               PIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRD
Gviolaceus          PVPDSGTPAAIGYARASGILFQQGLIKNHYVGRTFIQPTQTMREAGIKMKLNPLPDVIEG
Synechococcus2      SVPDSGTPAAIGYARQAGIPYTEGLIKNRYVGRTFIQPTQSMRERGIRMKLNPLEDVLRG
Npunctiforme        GVPDSGIPAAIGFSQASGVAYAEGLIKNRYVGRTFIQPTQTMRESGIRMKLNPLKDVLAG
Avariabilis         GVPDSGIPAAIGFSQASGVAYGEGLIKNRYVGRTFIQPTQSMRESGIKMKLNPLKDVLAG
Terythraeum         GVPDSGIPAAIGFSQESGILYAEGLIKNRYVGRTFIQPTPHMRESGIRMKLNPLKDVLEG
Cynechocystis       GVPDSGIPAAIGFSQASGIPYAEGLIKNRYVGRTFIQPTQHMREHGIRMKLNPLKDVLAG
                     :*::.   *:  :   .  : :*: **:******* *    *. .:: ***.    : .

Bcenocepacia        KHVLIVDDSIVRGTTSHEIVQMARDAGAKSVIFASAAPPVKFPNVYGIDMPTRGELVAHG
Bphytofirmans       KNVLIVDDSIVRGTTSHEIVQMARDAGANKVIFASAAPPVKFPNVYGIDMPTRGELVAHG
Reutropha           KNVLIVDDSIVRGTTSFEIVQMARDAGANKVIFASAAPPVKYPNVYGIDMPTRSELVAHN
Promar1             KNVLIVDDSIVRGTTSKEIVQMAKDAGANKVFFTSAAPPVRFPHVYGINMPNRCELIAHD
ORF_PM16700         KNVLIVDDSIVRGTTSKEIVQMAKDAGANKVSFTSAAPPVRFPHVYGINMPNRDELIAHD
Promar3             KNILIVDDSIVRGTTSREIVQMARLAGANKVTFTSAAPPIRFPHVYGINMPSKDELIAYD
Promar4             KNVLLVDDSIVRGTTSREIVQMAKLAGANKVTFTSAAPPIRFPHVYGINMPSKMELIAHD
Promar              KNVLIVDDSIVRGTTSKEIVQMARVAGANKVTFTSAAPPVRYSHVYGINMPNRHELIAYN
Synechococcus       KNVLIVDDSIVRGTTSREIVQMARSAGANKVTFTSAAPPVRYPNVYGINMPTRAELLAHG
Yfrederiksenii      KNVLLVDDSIVRGTTSEQIVEMARDAGAKKVYFASAAPEIRFPNVYGIDMPSVNELIAHG
Ecoli               KNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHG
Gviolaceus          KRIVIVDDSIVRGTTSRKIVQALRDSGAREVHMRISSPPVTHPCFYGIDTDSQDQLIAAT
Synechococcus2      QRIVIVDDSIVRGTTSQKIVKALRQAGATEVHMRISSPPVTHPCFYGIDTDSQDQLIAAR
Npunctiforme        KRVIIVDDSIVRGTTSRKLVKTLREAGAVEVHMRISSPPVTHPCFYGIDTDSQDQLIAAT
Avariabilis         KRVIIVDDSIVRGTTSRKLVKALRDAGAAEVHMRISSPPVTHPCFYGIDTDTQDQLIAAT
Terythraeum         KRVIIVDDSIVRGNTSKKIVKALRDNGATEVHMRISSPPVTHPCFYGIDTDNQEQLIGAT
Cynechocystis       KRIIIVDDSIVRGTTSRKIVRALREAGATEVHMRISSPPVTHPCFYGIDTDSQDQLIAAR
                    :.:::********.** :::.  :  ** .* :  ::* : .. .***:  .  :*:.  

Bcenocepacia        RTDEEVAKIIGADHLIYQDVDDLRRAVRDINPKLEHFEASCFDGNYITGAVTPEYLDAIE
Bphytofirmans       RSDDEVARMIGADHLVYQDVDALKQAVRDINPALKEFEASCFDGNYVTGDVTTEYLDRIE
Reutropha           RTHEEIAKIIGADKLVYQDVEAMKQAVRDINPALKDFDASCFDGRYITGDIDEAYLNRLE
Promar1             RTISEIANQLEIDNLVYQSVENLRKSIISE-SPIEDLEMSCFTGIYVTGKVNQEYLNWVE
ORF_PM16700         RTISEIADKLEIDNLVYQSVENLRKSIISD-SLVEHLEMSCFTGTYVTGTV---------
Promar3             RSILEIQNILLVDQLVYQEVGDLKTAILDD-SKIEDLDMSCFTGHYVTGTVTNEYLNWVE
Promar4             KSIDQIQETLLADGLVYQKISDLEQSILKG-SQVKNLDLSCFNGEYVTGKVTEEYLAWVG
Promar              RTIPEISSELSTDHMVYQEVADLEAAIVEG-SGVSELELSCFTGEYITGTVTSEYLDWIE
Synechococcus       RTSDEISDVLGADHVVYQTVENLLESIVEN-TEIKDLEMSCFDGHYVTGGIDEDYFQWLE
Yfrederiksenii      REVDEIRQLIGADALIFQDLTDLIEAVREDNPDIIQFECSVFNGVYVTKDVDQSYLEYLE
Ecoli               REVDEIRQIIGADGLIFQDLNDLNEAVRAENPDIQQFECSVFNGVYVTKDVDQGYLDFLD
Gviolaceus          KSVDEIARHIEVDSLAYLSVEGMLKATRTD---GQGFCTACFTGDYPIPIPDAIRRTKLV
Synechococcus2      YSVAEIAEKIGVDSLAYLSWEGMLAATGRD---PNSFCSACFTGHYPIPVPEGLKRSKLA
Npunctiforme        KSVAEIAKQLEVDSLAYLSWEGMLEATRED---TNSFCSACFTGDYPVAIPEQVKRSKLS
Avariabilis         KSVEEIAKQLEVESLAYLSWDGMLEATRED---KNSFCSACFTGDYPVTIPEQVKRSKLI
Terythraeum         KSVAEIAEQIGVDSLAYLSWEGMLKSTQED---PNSFCSACFTGNYPIPLPEKLKRSKLI
Cynechocystis       LTVAEIAEQIEVDSLAYLSQEGMLLCTGED---ISHFCSACFNGRYPITVPDAVRRSKLM
                        ::   :  : : :     :  .          :  : * * *              

Bcenocepacia        RARLAPASQADRDTAGDTER------SQMNLQLSVE--
Bphytofirmans       TARLAPSSQSDRDAASDAIDGGAPARSQLHLQLSVG--
Reutropha           TARSQADRDGTN---------GDTERSQLHLQRSGGNE
Promar1             NEYKS---------------------------------
ORF_PM16700         --------------------------------------
Promar3             TEYIS---------------------------------
Promar4             SKYSS---------------------------------
Promar              RTQLS---------------------------------
Synechococcus       RNCSS---------------------------------
Yfrederiksenii      SLRNDDAQALRNHNEAENLEMHNEG-------------
Ecoli               TLRNDDAKAVQRQNEVENLEMHNEG-------------
Gviolaceus          LEKTAAS-------------------------------
Synechococcus2      LETAASRKNR----------------------------
Npunctiforme        LEKVVV--------------------------------
Avariabilis         LEKVVV--------------------------------
Terythraeum         LENQVKV-------------------------------
Cynechocystis       LENITA--------------------------------

BLAST

BLASTp Swiss prot

BLASTP 2.2.15 [Oct-15-2006]
Database: Non-redundant SwissProt sequences
           217,875 sequences; 82,042,039 total letters

Sequences producing significant alignments:                        (Bits)  Value

gi|12231030|sp|Q51342|PUR1_PSEAE  Amidophosphoribosyltransfera...   245    7e-65
gi|1172750|sp|P43854|PUR1_HAEIN  Amidophosphoribosyltransferas...   228    9e-60
gi|84029594|sp|P0AG16|PUR1_ECOLI  Amidophosphoribosyltransfera...   227    2e-59
gi|3122656|sp|Q12698|PUR1_SACKL  Amidophosphoribosyltransferas...   222    9e-58
gi|13431813|sp|Q9L6B8|PUR1_PASMU  Amidophosphoribosyltransfera...   221    1e-57
gi|1346913|sp|P04046|PUR1_YEAST  Amidophosphoribosyltransferas...   219    6e-57  Gene info
gi|1172751|sp|P41390|PUR1_SCHPO  Amidophosphoribosyltransferas...   204    1e-52
gi|6647708|sp|O57979|PUR1_PYRHO  Amidophosphoribosyltransferas...   166    6e-41
gi|6647717|sp|Q55621|PUR1_SYNY3  Amidophosphoribosyltransferas...   163    4e-40  Gene info
gi|6647702|sp|O26742|PUR1_METTH  Amidophosphoribosyltransferas...   158    2e-38  Gene info
gi|21759385|sp|Q9V253|PUR1_PYRAB  Amidophosphoribosyltransfera...   156    5e-38
gi|6647705|sp|O29388|PUR1_ARCFU  Probable amidophosphoribosylt...   155    8e-38
gi|2499942|sp|Q55038|PUR1_SYNP7  Amidophosphoribosyltransferas...   155    8e-38  Gene info
gi|2499943|sp|Q57657|PUR1_METJA  Probable amidophosphoribosylt...   151    1e-36
gi|131607|sp|P00497|PUR1_BACSU  Amidophosphoribosyltransferase...   147    2e-35
gi|131608|sp|P28173|PUR1_CHICK  Amidophosphoribosyltransferase...   140    4e-33  Gene info
gi|54038922|sp|P99164|PUR1_STAAN  Amidophosphoribosyltransfera...   139    7e-33  Gene info
gi|38605357|sp|Q8NX91|PUR1_STAAW  Amidophosphoribosyltransfera...   139    7e-33  Gene info
gi|81651371|sp|Q6GI14|PUR1_STAAR  Amidophosphoribosyltransfera...   139    1e-32  Gene info
gi|548638|sp|Q06203|PUR1_HUMAN  Amidophosphoribosyltransferase...   138    1e-32  Gene info
gi|38605286|sp|Q8CT30|PUR1_STAES  Amidophosphoribosyltransfera...   134    2e-31  Gene info
gi|1709918|sp|P52418|PUR1_SOYBN  Amidophosphoribosyltransferas...   134    2e-31  Gene info
gi|548640|sp|P35433|PUR1_RAT  Amidophosphoribosyltransferase p...   133    5e-31  Gene info
gi|54038915|sp|P65830|PUR1_MYCBO  Amidophosphoribosyltransfera...   132    8e-31
gi|76800651|sp|Q27601|PUR1_DROME  Amidophosphoribosyltransfera...   132    8e-31  Gene info
gi|1709919|sp|P52419|PUR1_VIGAC  Amidophosphoribosyltransferas...   129    6e-30
gi|6647716|sp|Q50028|PUR1_MYCLE  Amidophosphoribosyltransferas...   129    9e-30
gi|2499941|sp|P77935|PUR1_RHIET  Amidophosphoribosyltransferas...  99.8    6e-21
gi|21362798|sp|P58862|PYEL1_METAC  PyrE-like protein 1             47.0    4e-05
gi|23821981|sp|Q8PVD0|PYEL_METMA  PyrE-like protein                45.1    2e-04
gi|25453082|sp|Q8KCQ2|KPRS_CHLTE  Ribose-phosphate pyrophospho...  39.3    0.009
gi|21362802|sp|Q59040|PYREL_METJA  PyrE-like protein               37.7    0.031
gi|21362837|sp|Q9HS16|PYREL_HALSA  PyrE-like protein               36.6    0.060
gi|24418491|sp|O59586|KPRS_PYRHO  Ribose-phosphate pyrophospho...  35.4    0.12 
gi|21362799|sp|P58863|PYEL2_METAC  PyrE-like protein 2             35.0    0.17 
gi|24418490|sp|O52958|KPRS_PYRKO  Ribose-phosphate pyrophospho...  35.0    0.18   Gene info
gi|24418508|sp|Q8U458|KPRS_PYRFU  Ribose-phosphate pyrophospho...  33.9    0.43 
gi|24418521|sp|Q973F3|KPRS_SULTO  Ribose-phosphate pyrophospho...  33.5    0.57 
gi|56404776|sp|Q6F6Z6|PYRE_ACIAD  Orotate phosphoribosyltransfera  33.1    0.69   Gene info
gi|24418516|sp|Q8ZU24|KPRS_PYRAE  Ribose-phosphate pyrophospho...  33.1    0.69 
gi|38257984|sp|Q88BD7|PYRE_PSESM  Orotate phosphoribosyltransfera  32.7    0.89 
gi|21362786|sp|O29861|PYREL_ARCFU  PyrE-like protein               32.7    0.98 
gi|30173247|sp|Q8CSW7|PYRE_STAES  Orotate phosphoribosyltransfera  32.3    1.1    Gene info
gi|21362829|sp|Q9A810|PYRE_CAUCR  Orotate phosphoribosyltransfera  32.3    1.2  
gi|21362790|sp|O93849|PYRE_COCPO  Orotate phosphoribosyltransf...  32.3    1.2  
gi|81674932|sp|Q5HPY6|PYRE_STAEQ  Orotate phosphoribosyltransfera  32.3    1.3    Gene info
gi|21362841|sp|Q9PGZ3|PYRE_XYLFA  Orotate phosphoribosyltransfera  32.0    1.5  
gi|32129951|sp|Q87F16|PYRE_XYLFT  Orotate phosphoribosyltransfera  31.6    1.9    Gene info
gi|24418859|sp|P47304|KPRS_MYCGE  Ribose-phosphate pyrophospho...  31.6    2.1  
gi|38604837|sp|Q8CQV4|HPRT_STAES  Hypoxanthine-guanine phospho...  31.6    2.1    Gene info
gi|131729|sp|P18904|PYRE_SORMA  Orotate phosphoribosyltransferase  31.6    2.2  
gi|3334307|sp|O42767|PYRE_METAN  Orotate phosphoribosyltransferas  31.2    2.3  
gi|24418507|sp|Q8TUT6|KPRS_METKA  Ribose-phosphate pyrophospho...  31.2    2.4  
gi|24418538|sp|Q9EWS0|KPRH_STRCO  Putative ribose-phosphate py...  31.2    2.5  
gi|21362791|sp|O94331|PYRE_SCHPO  Orotate phosphoribosyltransfera  31.2    2.5  
gi|548650|sp|P35788|PYRE_COLGR  Orotate phosphoribosyltransferase  31.2    2.8  
gi|267215|sp|P14346|UL52_SHV21  Helicase/primase complex prote...  30.8    3.1  
gi|61216102|sp|Q05546|TENR_RAT  Tenascin-R precursor (TN-R) (R...  30.8    3.6    Gene info
gi|38257342|sp|Q8G6B5|APT_BIFLO  Adenine phosphoribosyltransferas  30.4    4.1  
gi|41017644|sp|Q7NQ92|PYRE_CHRVO  Orotate phosphoribosyltransfera  30.4    4.1  
gi|131730|sp|P21846|PYRE_TRIRE  Orotate phosphoribosyltransferase  30.4    4.5  
gi|585831|sp|P37763|RFBC_NEIGO  dTDP-4-dehydrorhamnose 3,5-epi...  30.4    4.5  
gi|25090565|sp|Q8K9U8|HPRT_BUCAP  Hypoxanthine phosphoribosyltran  30.4    4.5  
gi|23822003|sp|Q8P469|PYRE_XANCP  Orotate phosphoribosyltransfera  30.4    4.5  
gi|1172791|sp|P41923|PYRE_YARLI  Orotate phosphoribosyltransferas  30.4    4.6  
gi|24418550|sp|Q9UY08|KPRS_PYRAB  Ribose-phosphate pyrophospho...  30.0    5.4  
gi|11386795|sp|P57291|HPRT_BUCAI  Hypoxanthine phosphoribosyltran  30.0    5.7  
gi|56405381|sp|Q8VR31|PYRE_METCA  Orotate phosphoribosyltransfera  30.0    5.8  
gi|401671|sp|P31773|COMF_HAEIN  Competence protein F (DNA tran...  30.0    5.8  
gi|23822006|sp|Q8PFS5|PYRE_XANAC  Orotate phosphoribosyltransfera  30.0    5.8  
gi|115502256|sp|O15021|MAST4_HUMAN  Microtubule-associated serine  30.0    6.0  
gi|11387045|sp|Q9ZJX0|PYRE_HELPJ  Orotate phosphoribosyltransfera  30.0    6.2    Gene info
gi|2499948|sp|P56162|PYRE_HELPY  Orotate phosphoribosyltransferas  29.6    6.7  
gi|7388035|sp|Q9WYG6|PYRE_THEMA  Orotate phosphoribosyltransferas  29.6    6.8  
gi|131727|sp|P08309|PYRE_PODAN  Orotate phosphoribosyltransferase  29.6    7.1  
gi|30179844|sp|Q8Y342|PYRE_RALSO  Orotate phosphoribosyltransfera  29.6    7.2  
gi|22653654|sp|Q9X1A4|APT_THEMA  Adenine phosphoribosyltransferas  29.6    7.5  
gi|1346312|sp|P47696|HPRT_MYCGE  Hypoxanthine-guanine phosphor...  29.6    7.9  
gi|731827|sp|P40513|MAM33_YEAST  Mitochondrial acidic protein MAM  29.3    8.7    Gene info
gi|54037317|sp|P65828|HPRT_STAAW  Hypoxanthine-guanine phospho...  29.3    8.7    Gene info
gi|123502|sp|P09383|HPRT_SCHMA  Hypoxanthine-guanine phosphori...  29.3    9.6  



>gi|12231030|sp|Q51342|PUR1_PSEAE  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATase) (GPATase)
Length=501

 Score =  245 bits (626),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 117/210 (55%), Positives = 161/210 (76%), Gaps = 1/210 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVYKARL+MG+ L++ I       D+DVV+PIPD+SR AA+++A +LG+++REGF KNRY
Sbjct  269  SVYKARLRMGEKLADKILRERPDHDIDVVIPIPDTSRTAALELANRLGVKFREGFVKNRY  328

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            +GRTFIMPGQ  RKKSVRQKLNA+  EF+ KNV++VDDSIVRGTT K+I+QMA++AGA  
Sbjct  329  IGRTFIMPGQAARKKSVRQKLNAIELEFRGKNVMLVDDSIVRGTTCKQIIQMAREAGAKN  388

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V F SAAP VR+P+VYGI+MP+  ELIAH+R+  +++  +  D LVYQ + +L  ++   
Sbjct  389  VYFCSAAPAVRYPNVYGIDMPSAHELIAHNRSTEDVSKLIGADWLVYQDLPDLIDAVGGG  448

Query  181  SL-VEHLEMSCFTGTYVTGTVNQEYLNWVE  209
             + ++H + + F G YVTG VN+ YLN +E
Sbjct  449  KIKIDHFDCAVFDGEYVTGDVNEAYLNRIE  478


>gi|1172750|sp|P43854|PUR1_HAEIN  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
Length=505

 Score =  228 bits (582),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 114/214 (53%), Positives = 160/214 (74%), Gaps = 3/214 (1%)

Query  1    SVYKARLKMGDYLSETI-KEIITSGD-VDVVMPIPDSSRPAAMQVARQLGIEYREGFFKN  58
            SVY AR+ MG+ L + I KE     D +DVV+P+P++S   A+Q+AR LG  YR+GF KN
Sbjct  270  SVYAARVHMGEKLGQKIAKEWADEIDNIDVVIPVPETSTDIALQIARVLGKPYRQGFVKN  329

Query  59   RYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGA  118
            RYVGRTFIMPGQ +R  SVR+KLN + AEFK+KNVL+VDDSIVRGTTS++IV+MA+ AGA
Sbjct  330  RYVGRTFIMPGQAQRISSVRRKLNTIKAEFKDKNVLLVDDSIVRGTTSEQIVEMARSAGA  389

Query  119  NKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSI-  177
             K+ F SAAP +R+P+VYGI+MP+RDELIA+ R + EIA+ + +D L++Q +  L +S+ 
Sbjct  390  KKIYFASAAPEIRYPNVYGIDMPSRDELIAYGRNVDEIAELIGVDKLIFQDLTALTESVQ  449

Query  178  ISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVENE  211
            + +  ++  + S FTG Y+TG ++ EYL  +  +
Sbjct  450  LENPAIQGFDCSVFTGEYITGDISPEYLEKIATQ  483


>gi|84029594|sp|P0AG16|PUR1_ECOLI  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
 gi|84029595|sp|P0AG17|PUR1_SHIFL  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
Length=505

 Score =  227 bits (578),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 113/210 (53%), Positives = 155/210 (73%), Gaps = 1/210 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY AR+ MG  L E I       D+DVV+PIP++S   A+++AR LG  YR+GF KNRY
Sbjct  271  SVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRY  330

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQQ R+KSVR+KLNA  AEF++KNVL+VDDSIVRGTTS++I++MA++AGA K
Sbjct  331  VGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKK  390

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V   SAAP +RFP+VYGI+MP+  ELIAH R + EI   +  D L++Q + +L  ++ ++
Sbjct  391  VYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAE  450

Query  181  SL-VEHLEMSCFTGTYVTGTVNQEYLNWVE  209
            +  ++  E S F G YVT  V+Q YL++++
Sbjct  451  NPDIQQFECSVFNGVYVTKDVDQGYLDFLD  480


>gi|3122656|sp|Q12698|PUR1_SACKL  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE)
Length=510

 Score =  222 bits (565),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 109/209 (52%), Positives = 150/209 (71%), Gaps = 2/209 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY  RL+MG  L+E +K+++   ++DVV+ +PD++R  A+Q A  L   YRE F KNRY
Sbjct  277  SVYHTRLQMGIKLAENVKKVVDPDEIDVVVSVPDTARTCALQCANHLNKPYREAFVKNRY  336

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMP Q++R  SVR+KLN M  EFK+K VLIVDDSIVRGTTSKEI+ MAK++GA K
Sbjct  337  VGRTFIMPNQKERVSSVRRKLNPMDFEFKDKRVLIVDDSIVRGTTSKEIINMAKESGATK  396

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V F SAAP +RF H+YGI++ +  +L+A++RT  E+A +L  + ++YQS+E+L     +D
Sbjct  397  VYFASAAPAIRFNHIYGIDLADTKQLVAYNRTTDEVAQELGCEKVIYQSLEDLVDCCKTD  456

Query  181  SLVEHLEMSCFTGTYVTGTVNQEYLNWVE  209
              ++  E+  FTG YVTG V   YL  +E
Sbjct  457  K-IDKFEVGVFTGNYVTG-VEDGYLQELE  483


>gi|13431813|sp|Q9L6B8|PUR1_PASMU  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
Length=504

 Score =  221 bits (564),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 110/208 (52%), Positives = 154/208 (74%), Gaps = 2/208 (0%)

Query  1    SVYKARLKMGDYLSETI-KEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNR  59
            SVY AR+ MG  L E I +E     D+DVV+P+P++S   A+++AR L   YR+GF KNR
Sbjct  270  SVYAARVHMGQRLGEKIAREWADVDDIDVVIPVPETSNDIALRIARVLNKPYRQGFVKNR  329

Query  60   YVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGAN  119
            YVGRTFIMPGQ  R  SVR+KLN +++EFK+KNVL+VDDSIVRGTTS++IV+MA+ AGA 
Sbjct  330  YVGRTFIMPGQALRVSSVRRKLNTIASEFKDKNVLLVDDSIVRGTTSEQIVEMARAAGAK  389

Query  120  KVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIIS  179
            K+ F SAAP +R+P+VYGI+MP ++ELIA+ R + EIA  + +D L++Q ++ L  S+  
Sbjct  390  KIYFASAAPEIRYPNVYGIDMPTKNELIAYGRDVDEIAKLIGVDKLIFQDLDALTGSVQQ  449

Query  180  DS-LVEHLEMSCFTGTYVTGTVNQEYLN  206
            ++  ++  + S FTG YVTG +  EYL+
Sbjct  450  ENPSIQDFDCSVFTGVYVTGDITPEYLD  477


>gi|1346913|sp|P04046|PUR1_YEAST Gene info Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE)
Length=510

 Score =  219 bits (557),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 2/214 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY  RL MG  L+E I + +   D+DVV+P+PD++R  A++ A  LG  YREGF KNRY
Sbjct  277  SVYHTRLAMGSKLAENILKQLKPEDIDVVIPVPDTARTCALECANVLGKPYREGFVKNRY  336

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMP Q++R  SVR+KLN M +EFK K VLIVDDSIVRGTTSKEIV MAK++GA K
Sbjct  337  VGRTFIMPNQRERVSSVRRKLNPMESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATK  396

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V F SAAP +R+ H+YGI++ +   LIA++RT  E+A+ +  + ++YQS+E+L     +D
Sbjct  397  VYFASAAPAIRYNHIYGIDLTDTKNLIAYNRTDEEVAEVIGCERVIYQSLEDLIDCCKTD  456

Query  181  SLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS  214
             + +  E   FTG YVTG V   Y+  +E +  S
Sbjct  457  KITK-FEDGVFTGNYVTG-VEDGYIQELEEKRES  488


>gi|1172751|sp|P41390|PUR1_SCHPO  Amidophosphoribosyltransferase (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE)
Length=533

 Score =  204 bits (520),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 105/212 (49%), Positives = 147/212 (69%), Gaps = 5/212 (2%)

Query  1    SVYKARLKMGDYLSETIKEIITSG---DVDVVMPIPDSSRPAAMQVARQLGIEYREGFFK  57
            SVY++RL MG+ L+ TI +         +D V+P+PDS+R +A+ +A+   + Y E F K
Sbjct  284  SVYQSRLNMGEKLAHTIMKRFGPDYMEKIDAVIPVPDSARTSALALAQTAQLPYVEAFIK  343

Query  58   NRYVGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAG  117
            NRY+GRTFIMPGQQ R+KSVR+KLN    EF +KNVLIVDDSIVRGTTS+EIVQMA+++G
Sbjct  344  NRYIGRTFIMPGQQIRRKSVRRKLNVQPQEFFDKNVLIVDDSIVRGTTSREIVQMARESG  403

Query  118  ANKVSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSI  177
            A  V   S AP +  PHVYGI++ +  +LIA+ +T  E+A+ +  D ++YQ++E+L  S 
Sbjct  404  AKNVYLASCAPMITHPHVYGIDLADCKDLIAYGKTEDEVAEAISADGVIYQTLEDLLDSC  463

Query  178  ISDSLVEHLEMSCFTGTYVTGTVNQEYLNWVE  209
             +  L E  E+  FTG Y TG  ++EYL  +E
Sbjct  464  RTAELTE-FEVGLFTGEYTTGA-SKEYLVHLE  493


>gi|6647708|sp|O57979|PUR1_PYRHO  Amidophosphoribosyltransferase precursor (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
Length=449

 Score =  166 bits (420),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 90/195 (46%), Positives = 124/195 (63%), Gaps = 11/195 (5%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY AR +MG  L+       +  + DVV+ +PDS R AA+  A + GI Y EG  KNRY
Sbjct  257  SVYWARYRMGVELARE-----SPAEGDVVIAVPDSGRTAALGFAHESGIPYMEGLIKNRY  311

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            +GRTFIMP    R+  VR KL+ +    K + +++VDDSIVRGTT K IV+M +DAGA +
Sbjct  312  IGRTFIMP--SGREIKVRLKLSPVKEVIKGRRIVLVDDSIVRGTTMKNIVKMLRDAGARE  369

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V    A+PP+R+P   GI++P R ELIA  ++I EI  ++  D+L Y SVE L+++I +D
Sbjct  370  VHVRIASPPIRYPCYMGIDIPTRHELIAAWKSIEEIKKEIGADSLAYLSVEGLKRAIGTD  429

Query  181  SLVEHLEMSCFTGTY  195
             L     M+C TG Y
Sbjct  430  KLC----MACLTGNY  440


>gi|6647717|sp|Q55621|PUR1_SYNY3 Gene info Amidophosphoribosyltransferase precursor (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
Length=495

 Score =  163 bits (412),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 83/195 (42%), Positives = 123/195 (63%), Gaps = 7/195 (3%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            S+Y  R+++G +L++      +  D D+VM +PDS  PAA+  ++  GI Y EG  KNRY
Sbjct  288  SLYTYRMRIGKHLAKE-----SPVDADLVMGVPDSGIPAAIGFSQASGIPYAEGLIKNRY  342

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFI P Q  R+  +R KLN +      K ++IVDDSIVRGTTS++IV+  ++AGA +
Sbjct  343  VGRTFIQPTQHMREHGIRMKLNPLKDVLAGKRIIIVDDSIVRGTTSRKIVRALREAGATE  402

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V    ++PPV  P  YGI+  ++D+LIA   T++EIA+++E+D+L Y S E +      D
Sbjct  403  VHMRISSPPVTHPCFYGIDTDSQDQLIAARLTVAEIAEQIEVDSLAYLSQEGMLLCTGED  462

Query  181  SLVEHLEMSCFTGTY  195
              + H   +CF G Y
Sbjct  463  --ISHFCSACFNGRY  475


>gi|6647702|sp|O26742|PUR1_METTH Gene info Amidophosphoribosyltransferase precursor (Glutamine phosphoribosylpyrophosphate 
amidotransferase) (ATASE) (GPATase)
Length=474

 Score =  158 bits (399),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 77/177 (43%), Positives = 116/177 (65%), Gaps = 5/177 (2%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            +VY+ RL +G+ L           + DVV+P+PDSS PAA+  +R  GI Y EG  KNRY
Sbjct  268  NVYRVRLNIGEALYRE-----HPANADVVVPVPDSSIPAAIGYSRASGIPYGEGLIKNRY  322

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMP Q++R+ +V+ K+N + +E + K ++++DDSIVRGTTS+ ++ + +DAGA +
Sbjct  323  VGRTFIMPTQEERETAVKLKMNPIRSELEGKRIVLIDDSIVRGTTSRALIDIIRDAGAEE  382

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSI  177
            +      PP++ P  YGI M  + ELIA  R + EI   + +D+L Y S+E+L + I
Sbjct  383  IHLRIGCPPIKSPCYYGIAMATKKELIASTRNVEEIRRIIGVDSLGYLSIESLVECI  439





Blastp NR


BLASTP 2.2.15 [Oct-15-2006]
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,181,732 sequences; 1,439,766,456 total letters

Sequences producing significant alignments:                        (Bits)  Value

gi|78778389|ref|YP_396501.1|  amidophosphoribosyltransferase [...   397    2e-109  Gene info
gi|33860564|ref|NP_892125.1|  amidophosphoribosyltransferase [...   388    9e-107  Gene info
gi|84518952|ref|ZP_01006301.1|  amidophosphoribosyltransferase...   345    1e-93 
gi|33239456|ref|NP_874398.1|  amidophosphoribosyltransferase [...   331    1e-89   Gene info
gi|33862277|ref|NP_893837.1|  amidophosphoribosyltransferase [...   329    7e-89   Gene info
gi|72383168|ref|YP_292523.1|  amidophosphoribosyltransferase [...   324    2e-87   Gene info
gi|88854870|ref|ZP_01129536.1|  amidophosphoribosyltransferase...   315    7e-85 
gi|78211562|ref|YP_380341.1|  amidophosphoribosyltransferase [...   313    3e-84   Gene info
gi|28572878|ref|NP_789658.1|  amidophosphoribosyltransferase [...   304    2e-81   Gene info
gi|28493690|ref|NP_787851.1|  amidophosphoribosyltransferase [...   304    2e-81   Gene info
gi|113868568|ref|YP_727057.1|  glutamine phosphoribosylpyropho...   293    4e-78   Gene info
gi|84354023|ref|ZP_00978939.1|  COG0034: Glutamine phosphoribo...   291    1e-77 
gi|115358106|ref|YP_775244.1|  amidophosphoribosyltransferase ...   290    2e-77   Gene info
gi|118036526|ref|ZP_01507933.1|  amidophosphoribosyltransferas...   290    3e-77 
gi|73541985|ref|YP_296505.1|  amidophosphoribosyltransferase [...   290    4e-77   Gene info
gi|91777263|ref|YP_552471.1|  Amidophosphoribosyl transferase ...   289    5e-77   Gene info
gi|78062965|ref|YP_372873.1|  amidophosphoribosyltransferase [...   288    1e-76   Gene info
gi|84360302|ref|ZP_00985009.1|  COG0034: Glutamine phosphoribo...   287    3e-76 
gi|67547355|ref|ZP_00425259.1|  Amidophosphoribosyl transferas...   286    3e-76 
gi|83716414|ref|YP_438885.1|  amidophosphoribosyltransferase [...   286    6e-76   Gene info
gi|53722712|ref|YP_111697.1|  amidophosphoribosyltransferase [...   285    1e-75   Gene info
gi|83748100|ref|ZP_00945129.1|  PurF [Ralstonia solanacearum U...   284    2e-75 
gi|53716183|ref|YP_106277.1|  amidophosphoribosyltransferase [...   283    4e-75   Gene info
gi|17546695|ref|NP_520097.1|  amidophosphoribosyltransferase [...   283    6e-75   Gene info
gi|94311396|ref|YP_584606.1|  amidophosphoribosyltransferase [...   281    1e-74   Gene info
gi|118027600|ref|ZP_01499064.1|  amidophosphoribosyltransferas...   281    1e-74 
gi|30248708|ref|NP_840778.1|  amidophosphoribosyltransferase [...   277    2e-73   Gene info
gi|116269231|ref|ZP_01493476.1|  amidophosphoribosyltransferas...   276    3e-73 
gi|114331156|ref|YP_747378.1|  amidophosphoribosyltransferase ...   268    1e-70   Gene info
gi|33596169|ref|NP_883812.1|  amidophosphoribosyltransferase [...   267    2e-70   Gene info
gi|33592513|ref|NP_880157.1|  amidophosphoribosyltransferase [...   267    3e-70   Gene info
gi|82703027|ref|YP_412593.1|  amidophosphoribosyltransferase [...   265    7e-70   Gene info
gi|115422808|emb|CAJ49336.1|  amidophosphoribosyltransferase [Bor   264    2e-69 
gi|83645239|ref|YP_433674.1|  amidophosphoribosyltransferase [...   262    8e-69   Gene info
gi|77165148|ref|YP_343673.1|  amidophosphoribosyltransferase [...   261    2e-68   Gene info
gi|47575244|ref|ZP_00245279.1|  COG0034: Glutamine phosphoribo...   258    1e-67 
gi|118053861|ref|ZP_01522404.1|  amidophosphoribosyltransferas...   258    2e-67 
gi|109148749|ref|XP_001106024.1|  PREDICTED: similar to Amidop...   257    2e-67   Gene info
gi|84715387|ref|ZP_01022488.1|  Amidophosphoribosyl transferas...   257    2e-67 
gi|71906515|ref|YP_284102.1|  amidophosphoribosyltransferase [...   257    3e-67   Gene info
gi|88799990|ref|ZP_01115561.1|  amidophosphoribosyltransferase...   255    8e-67 
gi|91770799|ref|ZP_01272621.1|  Amidophosphoribosyl transferas...   255    9e-67 
gi|91787491|ref|YP_548443.1|  amidophosphoribosyltransferase [...   254    1e-66   Gene info
gi|78485153|ref|YP_391078.1|  amidophosphoribosyltransferase [...   254    1e-66   Gene info
gi|77952241|ref|ZP_00816657.1|  Amidophosphoribosyl transferas...   254    2e-66 
gi|110593265|ref|ZP_01381618.1|  amidophosphoribosyltransferas...   254    2e-66 
gi|111613731|ref|ZP_01400811.1|  amidophosphoribosyltransferas...   253    3e-66 
gi|56478142|ref|YP_159731.1|  amidophosphoribosyltransferase [...   253    3e-66   Gene info
gi|74317926|ref|YP_315666.1|  amidophosphoribosyl transferase ...   253    4e-66   Gene info
gi|114320398|ref|YP_742081.1|  amidophosphoribosyltransferase ...   252    7e-66   Gene info
gi|88812317|ref|ZP_01127567.1|  amidophosphoribosyltransferase...   252    9e-66 
gi|94498938|ref|ZP_01305476.1|  amidophosphoribosyltransferase...   252    9e-66 
gi|89901459|ref|YP_523930.1|  amidophosphoribosyltransferase [...   252    1e-65   Gene info
gi|111618296|ref|ZP_01405320.1|  amidophosphoribosyltransferas...   251    1e-65 
gi|58265148|ref|XP_569730.1|  amidophosphoribosyltransferase [...   251    1e-65   Gene info
gi|50259437|gb|EAL22110.1|  hypothetical protein CNBC2480 [Cry...   251    1e-65 
gi|104780853|ref|YP_607351.1|  amidophosphoribosyltransferase ...   250    3e-65   Gene info
gi|70729451|ref|YP_259189.1|  amidophosphoribosyltransferase [...   249    5e-65   Gene info
gi|53803332|ref|YP_114901.1|  amidophosphoribosyltransferase [...   249    7e-65   Gene info
gi|77458129|ref|YP_347634.1|  amidophosphoribosyltransferase [...   249    8e-65   Gene info
gi|34497970|ref|NP_902185.1|  amidophosphoribosyltransferase [...   248    2e-64   Gene info
gi|66044913|ref|YP_234754.1|  amidophosphoribosyltransferase [...   246    4e-64   Gene info
gi|90416031|ref|ZP_01223964.1|  amidophosphoribosyltransferase...   246    7e-64 
gi|15598304|ref|NP_251798.1|  amidophosphoribosyltransferase [...   245    9e-64   Gene info
gi|28870966|ref|NP_793585.1|  amidophosphoribosyltransferase [...   245    9e-64   Gene info
gi|71733765|ref|YP_273905.1|  amidophosphoribosyltransferase [...   245    1e-63   Gene info
gi|91776045|ref|YP_545801.1|  amidophosphoribosyltransferase [...   244    2e-63   Gene info
gi|67155230|ref|ZP_00416858.1|  Amidophosphoribosyl transferas...   244    2e-63 
gi|93005931|ref|YP_580368.1|  amidophosphoribosyltransferase [...   243    3e-63   Gene info
gi|88705043|ref|ZP_01102755.1|  Amidophosphoribosyltransferase...   243    3e-63 
gi|88948575|ref|ZP_01151338.1|  Amidophosphoribosyl transferas...   243    3e-63 
gi|26988725|ref|NP_744150.1|  amidophosphoribosyltransferase [...   243    4e-63   Gene info
gi|82739303|ref|ZP_00902110.1|  Amidophosphoribosyl transferas...   243    4e-63 
gi|110834316|ref|YP_693175.1|  amidophosphoribosyltransferase ...   243    4e-63   Gene info
gi|94412702|ref|ZP_01292608.1|  hypothetical protein PaerP_010...   242    9e-63 
gi|40063321|gb|AAR38139.1|  amidophosphoribosyltransferase [uncul   242    1e-62 
gi|71023905|ref|XP_762182.1|  hypothetical protein UM06035.1 [...   242    1e-62   Gene info
gi|71897920|ref|ZP_00680125.1|  Amidophosphoribosyl transferas...   241    2e-62 
gi|118059000|ref|ZP_01527459.1|  amidophosphoribosyltransferas...   240    3e-62 
gi|92113393|ref|YP_573321.1|  amidophosphoribosyltransferase [...   239    5e-62   Gene info
gi|71065839|ref|YP_264566.1|  amidophosphoribosyltransferase [...   239    6e-62   Gene info
gi|71902128|ref|ZP_00684159.1|  Amidophosphoribosyl transferas...   238    9e-62 
gi|87121848|ref|ZP_01077734.1|  amidophosphoribosyltransferase...   238    1e-61 
gi|15838543|ref|NP_299231.1|  amidophosphoribosyltransferase [...   238    1e-61   Gene info
gi|28198756|ref|NP_779070.1|  amidophosphoribosyltransferase [...   238    1e-61   Gene info
gi|116505954|gb|EAU88849.1|  hypothetical protein CC1G_01222 [...   238    2e-61 
gi|90579287|ref|ZP_01235097.1|  amidophosphoribosyltransferase...   238    2e-61 
gi|116185219|ref|ZP_01475134.1|  hypothetical protein VEx2w_02002   238    2e-61 
gi|90021717|ref|YP_527544.1|  Dihydrolipoamide succinyltransfe...   237    2e-61   Gene info
gi|54309808|ref|YP_130828.1|  amidophosphoribosyltransferase [...   237    2e-61   Gene info
gi|91223610|ref|ZP_01258875.1|  amidophosphoribosyltransferase...   237    2e-61 
gi|90410772|ref|ZP_01218787.1|  amidophosphoribosyltransferase...   237    2e-61 
gi|89073221|ref|ZP_01159751.1|  amidophosphoribosyltransferase...   237    3e-61 
gi|114772725|ref|ZP_01450067.1|  amidophosphoribosyltransferas...   236    4e-61 
gi|85713092|ref|ZP_01044127.1|  amidophosphoribosyltransferase...   236    7e-61 
gi|28898959|ref|NP_798564.1|  amidophosphoribosyltransferase [...   236    7e-61   Gene info
gi|56460120|ref|YP_155401.1|  amidophosphoribosyltransferase [...   235    1e-60   Gene info
gi|118072509|ref|ZP_01540698.1|  amidophosphoribosyltransferas...   235    1e-60 
gi|15641019|ref|NP_230650.1|  amidophosphoribosyltransferase [...   234    2e-60   Gene info
gi|75816364|ref|ZP_00746837.1|  COG0034: Glutamine phosphoribo...   234    2e-60 
gi|50084505|ref|YP_046015.1|  amidophosphoribosyltransferase [...   233    4e-60   Gene info
gi|68547940|ref|ZP_00587463.1|  Amidophosphoribosyl transferas...   232    1e-59 
gi|29654220|ref|NP_819912.1|  amidophosphoribosyltransferase [...   231    1e-59   Gene info
gi|77975505|ref|ZP_00831040.1|  COG0034: Glutamine phosphoribo...   231    1e-59 
gi|117621358|ref|YP_856401.1|  amidophosphoribosyltransferase ...   231    1e-59 
gi|94492152|ref|ZP_01299360.1|  hypothetical protein CburD_010...   231    1e-59 
gi|71281500|ref|YP_270461.1|  amidophosphoribosyltransferase [...   231    1e-59   Gene info
gi|59712298|ref|YP_205074.1|  amidophosphoribosyltransferase [...   231    2e-59   Gene info
gi|95927605|ref|ZP_01310360.1|  hypothetical protein CburR_010005   231    2e-59 
gi|77957376|ref|ZP_00821434.1|  COG0034: Glutamine phosphoribo...   231    2e-59 
gi|77960842|ref|ZP_00824697.1|  COG0034: Glutamine phosphoribo...   231    2e-59 
gi|86148374|ref|ZP_01066667.1|  amidophosphoribosyltransferase...   231    2e-59 
gi|88860436|ref|ZP_01135074.1|  amidophosphoribosyltransferase...   231    2e-59 
gi|68540763|ref|ZP_00580513.1|  Amidophosphoribosyl transferas...   231    2e-59 
gi|77976973|ref|ZP_00832436.1|  COG0034: Glutamine phosphoribo...   231    2e-59 
gi|56412741|ref|YP_149816.1|  amidophosphoribosyltransferase [...   231    2e-59   Gene info
gi|16761287|ref|NP_456904.1|  amidophosphoribosyltransferase [...   230    3e-59   Gene info
gi|113950971|ref|ZP_01436574.1|  amidophosphoribosyltransferas...   230    3e-59 
gi|118069547|ref|ZP_01537791.1|  amidophosphoribosyltransferas...   230    3e-59 
gi|16765689|ref|NP_461304.1|  amidophosphoribosyltransferase [...   230    3e-59   Gene info
gi|77815343|ref|ZP_00814579.1|  Amidophosphoribosyl transferas...   230    3e-59 
gi|27365340|ref|NP_760868.1|  amidophosphoribosyltransferase [...   230    3e-59   Gene info
gi|24374586|ref|NP_718629.1|  amidophosphoribosyltransferase [...   230    3e-59   Gene info
gi|113969772|ref|YP_733565.1|  amidophosphoribosyltransferase ...   230    3e-59   Gene info
gi|117919931|ref|YP_869123.1|  amidophosphoribosyltransferase ...   230    3e-59 
gi|21230422|ref|NP_636339.1|  amidophosphoribosyltransferase [...   230    3e-59   Gene info
gi|16122976|ref|NP_406289.1|  amidophosphoribosyltransferase [...   230    4e-59   Gene info
gi|88796026|ref|ZP_01111711.1|  amidophosphoribosyltransferase...   229    5e-59 
gi|78367182|ref|ZP_00837455.1|  Amidophosphoribosyl transferas...   229    5e-59 
gi|37527053|ref|NP_930397.1|  amidophosphoribosyltransferase [...   229    6e-59   Gene info
gi|58583298|ref|YP_202314.1|  amidophosphoribosyltransferase [...   229    6e-59   Gene info
gi|85059591|ref|YP_455293.1|  amidophosphoribosyltransferase [...   229    7e-59   Gene info
gi|21241797|ref|NP_641379.1|  amidophosphoribosyltransferase [...   229    8e-59   Gene info
gi|84625129|ref|YP_452501.1|  amidophosphoribosyltransferase [...   229    8e-59   Gene info
gi|84394303|ref|ZP_00993027.1|  amidophosphoribosyltransferase...   229    8e-59 
gi|78046617|ref|YP_362792.1|  amidophosphoribosyltransferase [...   229    8e-59   Gene info
gi|82777723|ref|YP_404072.1|  amidophosphoribosyltransferase [...   229    8e-59   Gene info
gi|75196355|ref|ZP_00706425.1|  COG0034: Glutamine phosphoribo...   228    1e-58 
gi|16273127|ref|NP_439363.1|  amidophosphoribosyltransferase [...   228    1e-58   Gene info
gi|82544793|ref|YP_408740.1|  amidophosphoribosyltransferase [...   228    1e-58   Gene info
gi|32035795|ref|ZP_00135644.1|  COG0034: Glutamine phosphoribo...   228    1e-58 
gi|86137553|ref|ZP_01056130.1|  amidophosphoribosyltransferase...   228    2e-58 
gi|15802859|ref|NP_288886.1|  amidophosphoribosyltransferase [...   228    2e-58   Gene info
gi|91792847|ref|YP_562498.1|  amidophosphoribosyltransferase [...   228    2e-58   Gene info
gi|50121975|ref|YP_051142.1|  amidophosphoribosyltransferase [...   227    2e-58   Gene info
gi|53732452|ref|ZP_00154387.2|  COG0034: Glutamine phosphoribo...   227    2e-58 
gi|110806277|ref|YP_689797.1|  amidophosphoribosyltransferase ...   227    2e-58   Gene info
gi|1943557|pdb|1ECF|A  Chain A, Escherichia Coli Glutamine Pho...   227    3e-58   Related structures
gi|99081628|ref|YP_613782.1|  amidophosphoribosyltransferase [...   227    3e-58   Gene info
gi|16130247|ref|NP_416815.1|  amidophosphoribosyltransferase [...   227    3e-58   Gene info
gi|109897930|ref|YP_661185.1|  amidophosphoribosyltransferase ...   227    3e-58   Gene info
gi|114562576|ref|YP_750089.1|  amidophosphoribosyltransferase ...   227    3e-58   Gene info
gi|77360994|ref|YP_340569.1|  amidophosphoribosyltransferase [...   226    4e-58   Gene info
gi|42631509|ref|ZP_00157047.1|  COG0034: Glutamine phosphoribo...   225    1e-57 
gi|113461059|ref|YP_719126.1|  amidophosphoribosyltransferase ...   225    1e-57   Gene info
gi|68249753|ref|YP_248865.1|  amidophosphoribosyltransferase [...   225    1e-57   Gene info
gi|42593|emb|CAA30971.1|  amidophosphoribosyltransferase [Escheri   224    1e-57 
gi|90408624|ref|ZP_01216778.1|  amidophosphoribosyltransferase...   224    2e-57 
gi|42591|emb|CAA23613.1|  unnamed protein product [Escherichia...   224    2e-57 
gi|89093249|ref|ZP_01166199.1|  amidophosphoribosyltransferase...   224    2e-57 
gi|59800714|ref|YP_207426.1|  amidophosphoribosyltransferase [...   224    3e-57   Gene info
gi|15793861|ref|NP_283683.1|  amidophosphoribosyltransferase [...   223    3e-57   Gene info
gi|15676588|ref|NP_273732.1|  amidophosphoribosyltransferase [...   223    4e-57   Gene info
gi|607831|gb|AAA83434.1|  glutamine phosphoribosylpyrophosphate a   223    5e-57 
gi|147418|gb|AAA24453.1|  amidophosphoribosyltransferase (EC 2.4.   223    6e-57 
gi|7716501|gb|AAF68406.1|AF237920_1  amidophosphoribosyltransfera   222    7e-57 
gi|23006165|ref|ZP_00048613.1|  COG0034: Glutamine phosphoribo...   222    8e-57 
gi|3122656|sp|Q12698|PUR1_SACKL  Amidophosphoribosyltransferas...   222    1e-56 
gi|45200763|ref|NP_986333.1|  AGL334Wp [Eremothecium gossypii]...   222    1e-56   Gene info
gi|15602566|ref|NP_245638.1|  amidophosphoribosyltransferase [...   221    1e-56   Gene info
gi|115315466|ref|YP_764189.1|  amidophosphoribosyltransferase ...   221    1e-56   Gene info
gi|89257116|ref|YP_514478.1|  Amidophosphoribosyltransferase [...   221    2e-56   Gene info
gi|52425058|ref|YP_088195.1|  amidophosphoribosyltransferase [...   221    2e-56   Gene info
gi|56708727|ref|YP_170623.1|  amidophosphoribosyltransferase [...   221    2e-56   Gene info
gi|62261175|gb|AAX77965.1|  unknown protein [synthetic construct]   220    3e-56 
gi|50295058|ref|XP_449940.1|  hypothetical protein CAGL0M13717...   219    6e-56   Gene info
gi|106883744|ref|ZP_01351137.1|  amidophosphoribosyltransferas...   219    7e-56 
gi|171009|gb|AAA34403.1|  amidophosphoribosyltransferase >gi|1...   219    7e-56 
gi|6323958|ref|NP_014029.1|  Phosphoribosylpyrophosphate amido...   219    8e-56   Gene info
gi|116060642|emb|CAL57120.1|  unnamed protein product [Ostreococc   214    1e-54 
gi|50425793|ref|XP_461493.1|  hypothetical protein DEHA0F28204...   214    2e-54   Gene info
gi|50546909|ref|XP_500924.1|  hypothetical protein [Yarrowia l...   212    9e-54   Gene info
gi|68478758|ref|XP_716541.1|  amidophosphoribosyltransferase [...   212    1e-53   Gene info
gi|19115873|ref|NP_594961.1|  hypothetical protein SPAC4D7.08c...   204    2e-51   Gene info
gi|32491062|ref|NP_871316.1|  amidophosphoribosyltransferase [...   199    1e-49   Gene info
gi|67540934|ref|XP_664241.1|  hypothetical protein AN6637.2 [A...   198    2e-49   Gene info
gi|83771785|dbj|BAE61915.1|  unnamed protein product [Aspergillus   197    2e-49 
gi|75432606|ref|ZP_00733113.1|  Amidophosphoribosyltransferase...   196    7e-49 
gi|94676955|ref|YP_588812.1|  amidophosphoribosyltransferase [...   195    1e-48   Gene info
gi|115386468|ref|XP_001209775.1|  amidophosphoribosyltransfera...   194    2e-48   Gene info
gi|85099761|ref|XP_960840.1|  hypothetical protein [Neurospora...   194    2e-48   Gene info
gi|21622360|emb|CAD36991.1|  probable amidophosphoribosyltransfer   194    2e-48 
gi|70984376|ref|XP_747702.1|  amidophosphoribosyltransferase [...   192    7e-48   Gene info
gi|50303009|ref|XP_451442.1|  unnamed protein product [Kluyver...   192    9e-48   Gene info
gi|90297904|gb|EAS27535.1|  hypothetical protein CIMG_10140 [Cocc   188    1e-46 
gi|54297595|ref|YP_123964.1|  amidophosphoribosyltransferase [...   185    1e-45   Gene info
gi|52841902|ref|YP_095701.1|  amidophosphoribosyltransferase [...   185    1e-45   Gene info
gi|111063652|gb|EAT84772.1|  hypothetical protein SNOG_07306 [Pha   185    1e-45 
gi|54294563|ref|YP_126978.1|  amidophosphoribosyltransferase [...   184    3e-45   Gene info
gi|46121801|ref|XP_385454.1|  hypothetical protein FG05278.1 [...   183    5e-45   Gene info
gi|39945272|ref|XP_362173.1|  hypothetical protein MG04618.4 [Mag   181    3e-44   UniGene infoGene info
gi|20095085|ref|NP_614932.1|  Glutamine phosphoribosylpyrophos...   167    4e-40   Gene info
gi|114569756|ref|YP_756436.1|  amidophosphoribosyltransferase ...   166    5e-40   Gene info
gi|14590171|ref|NP_142236.1|  amidophosphoribosyltransferase [...   166    7e-40   Gene info
gi|84489915|ref|YP_448147.1|  PurF [Methanosphaera stadtmanae ...   166    7e-40   Gene info
gi|37521683|ref|NP_925060.1|  amidophosphoribosyltransferase [...   164    2e-39   Gene info
gi|16331334|ref|NP_442062.1|  amidophosphoribosyltransferase [...   163    5e-39   Gene info
gi|86604998|ref|YP_473761.1|  amidophosphoribosyltransferase [...   163    6e-39   Gene info
gi|42524405|ref|NP_969785.1|  amidophosphoribosyltransferase [...   162    7e-39   Gene info
gi|86609578|ref|YP_478340.1|  amidophosphoribosyltransferase [...   162    7e-39   Gene info
gi|113933292|ref|ZP_01419194.1|  amidophosphoribosyltransferas...   162    1e-38 
gi|82499069|ref|ZP_00884521.1|  Amidophosphoribosyl transferas...   161    2e-38 
gi|18976526|ref|NP_577883.1|  amidophosphoribosyltransferase [...   160    4e-38   Gene info
gi|106891884|ref|ZP_01359064.1|  amidophosphoribosyltransferas...   160    5e-38 
gi|16125904|ref|NP_420468.1|  amidophosphoribosyltransferase [...   159    1e-37   Gene info
gi|23125356|ref|ZP_00107293.1|  COG0034: Glutamine phosphoribo...   158    2e-37 
gi|116672277|ref|YP_833210.1|  amidophosphoribosyltransferase ...   158    2e-37   Gene info
gi|15678673|ref|NP_275788.1|  amidophosphoribosyltransferase [...   158    2e-37   Gene info
gi|113954725|ref|YP_729243.1|  amidophosphoribosyltransferase ...   157    3e-37   Gene info
gi|118060986|ref|ZP_01529400.1|  amidophosphoribosyltransferas...   157    5e-37 
gi|55377640|ref|YP_135490.1|  amidophosphoribosyl transferase ...   156    5e-37   Gene info
gi|114797301|ref|YP_759445.1|  amidophosphoribosyltransferase ...   156    6e-37   Gene info
gi|14520439|ref|NP_125914.1|  amidophosphoribosyltransferase [...   156    7e-37   Gene info
gi|83945268|ref|ZP_00957617.1|  amidophosphoribosyltransferase...   155    9e-37 
gi|11498479|ref|NP_069707.1|  amidophosphoribosyltransferase (...   155    1e-36   Gene info
gi|56751502|ref|YP_172203.1|  amidophosphoribosyltransferase [...   155    1e-36   Gene info
gi|78778065|ref|YP_394380.1|  Amidophosphoribosyl transferase ...   155    1e-36   Gene info
gi|17231143|ref|NP_487691.1|  amidophosphoribosyltransferase [...   155    1e-36   Gene info
gi|46578578|ref|YP_009386.1|  amidophosphoribosyltransferase [...   155    2e-36   Gene info
gi|15805256|ref|NP_293944.1|  amidophosphoribosyltransferase [...   155    2e-36   Gene info
gi|116753550|ref|YP_842668.1|  amidophosphoribosyltransferase ...   154    2e-36   Gene info
gi|28211591|ref|NP_782535.1|  amidophosphoribosyltransferase [...   154    2e-36   Gene info
gi|113477170|ref|YP_723231.1|  amidophosphoribosyltransferase ...   154    2e-36   Gene info
gi|82748214|ref|ZP_00910701.1|  Amidophosphoribosyl transferas...   154    2e-36 
gi|39936154|ref|NP_948430.1|  amidophosphoribosyltransferase [...   153    4e-36   Gene info
gi|89359358|ref|ZP_01197179.1|  Amidophosphoribosyl transferas...   153    4e-36 
gi|87301555|ref|ZP_01084395.1|  amidophosphoribosyltransferase...   153    5e-36 
gi|21226443|ref|NP_632365.1|  Amidophosphoribosyltransferase [...   153    5e-36   Gene info
gi|32028920|ref|ZP_00132023.1|  COG0034: Glutamine phosphoribo...   153    5e-36 
gi|57640146|ref|YP_182624.1|  amidophosphoribosyltransferase [...   153    6e-36   Gene info
gi|20092009|ref|NP_618084.1|  amidophosphoribosyltransferase [...   152    7e-36   Gene info
gi|32265987|ref|NP_860019.1|  amidophosphoribosyltransferase [...   152    9e-36   Gene info
gi|42527908|ref|NP_973006.1|  amidophosphoribosyltransferase [...   152    1e-35   Gene info
gi|116074279|ref|ZP_01471541.1|  amidophosphoribosyltransferas...   152    1e-35 
gi|115375209|ref|ZP_01462475.1|  amidophosphoribosyltransferas...   152    1e-35 
gi|75909842|ref|YP_324138.1|  amidophosphoribosyltransferase [...   152    1e-35   Gene info
gi|15668376|ref|NP_247172.1|  amidophosphoribosyltransferase (...   151    2e-35   Gene info
gi|114567293|ref|YP_754447.1|  hypothetical protein Swol_1778 ...   151    2e-35   Gene info
gi|110601449|ref|ZP_01389635.1|  amidophosphoribosyltransferas...   151    2e-35 
gi|94984171|ref|YP_603535.1|  amidophosphoribosyltransferase [...   151    2e-35   Gene info
gi|116625015|ref|YP_827171.1|  amidophosphoribosyltransferase ...   151    2e-35   Gene info
gi|88937238|ref|ZP_01142816.1|  Amidophosphoribosyl transferas...   150    3e-35 
gi|117923581|ref|YP_864198.1|  amidophosphoribosyltransferase ...   150    4e-35 
gi|118046992|ref|ZP_01515635.1|  amidophosphoribosyltransferas...   150    4e-35 
gi|91774102|ref|YP_566794.1|  amidophosphoribosyltransferase [...   150    4e-35   Gene info
gi|39996736|ref|NP_952687.1|  amidophosphoribosyltransferase [...   150    5e-35   Gene info
gi|88809360|ref|ZP_01124868.1|  amidophosphoribosyltransferase...   150    5e-35 
gi|106895414|ref|ZP_01362509.1|  Amidophosphoribosyl transfera...   150    5e-35 
gi|73670934|ref|YP_306949.1|  amidophosphoribosyltransferase [...   149    6e-35   Gene info
gi|77685291|ref|ZP_00800695.1|  Amidophosphoribosyl transferas...   149    7e-35 
gi|71836918|ref|ZP_00676685.1|  Amidophosphoribosyl transferas...   149    7e-35 
gi|33864543|ref|NP_896102.1|  amidophosphoribosyltransferase [...   149    7e-35   Gene info
gi|111219629|ref|YP_710423.1|  Amidophosphoribosyltransferase ...   149    9e-35   Gene info
gi|15613193|ref|NP_241496.1|  amidophosphoribosyltransferase [...   149    9e-35   Gene info
gi|117929279|ref|YP_873830.1|  amidophosphoribosyltransferase ...   149    9e-35 
gi|84497679|ref|ZP_00996501.1|  amidophosphoribosyltransferase...   149    1e-34 
gi|22299227|ref|NP_682474.1|  amidophosphoribosyltransferase [...   149    1e-34   Gene info
gi|108757527|ref|YP_629363.1|  amidophosphoribosyltransferase ...   148    1e-34   Gene info
gi|87123345|ref|ZP_01079196.1|  Glutamine amidotransferase cla...   148    2e-34 
gi|78183588|ref|YP_376022.1|  amidophosphoribosyltransferase [...   148    2e-34   Gene info
gi|110803721|ref|YP_697999.1|  amidophosphoribosyltransferase ...   148    2e-34   Gene info
gi|110800675|ref|YP_695127.1|  amidophosphoribosyltransferase ...   148    2e-34   Gene info
gi|78355381|ref|YP_386830.1|  amidophosphoribosyltransferase [...   148    2e-34   Gene info
gi|18309665|ref|NP_561599.1|  amidophosphoribosyltransferase [...   148    2e-34   Gene info
gi|71368088|ref|ZP_00658597.1|  Amidophosphoribosyl transferas...   147    2e-34 
gi|2624597|pdb|1AO0|A  Chain A, Glutamine Phosphoribosylpyroph...   147    2e-34   Related structures
gi|16077717|ref|NP_388531.1|  amidophosphoribosyltransferase [...   147    2e-34   Gene info
gi|23098201|ref|NP_691667.1|  amidophosphoribosyltransferase [...   147    2e-34   Gene info
gi|116873202|ref|YP_849983.1|  amidophosphoribosyltransferase ...   147    2e-34   Gene info
gi|576138|pdb|1GPH|1  Chain 1, Glutamine Phosphoribosylpyropho...   147    3e-34   Related structures
gi|67921899|ref|ZP_00515415.1|  Amidophosphoribosyl transferas...   147    3e-34 
gi|83952050|ref|ZP_00960782.1|  amidophosphoribosyltransferase...   147    3e-34 
gi|89054198|ref|YP_509649.1|  amidophosphoribosyltransferase [...   147    3e-34   Gene info
gi|76258324|ref|ZP_00765980.1|  Amidophosphoribosyl transferas...   147    3e-34 
gi|90419480|ref|ZP_01227390.1|  amidophosphoribosyltransferase...   147    3e-34 
gi|56962805|ref|YP_174531.1|  amidophosphoribosyltransferase [...   147    3e-34   Gene info
gi|52079133|ref|YP_077924.1|  amidophosphoribosyltransferase [...   147    4e-34   Gene info
gi|91977465|ref|YP_570124.1|  amidophosphoribosyltransferase [...   147    4e-34   Gene info
gi|116495230|ref|YP_806964.1|  Glutamine phosphoribosylpyropho...   147    4e-34   Gene info
gi|90576309|ref|ZP_01232774.1|  hypothetical protein CdifQ_020...   147    4e-34 
gi|52784501|ref|YP_090330.1|  amidophosphoribosyltransferase [...   146    5e-34   Gene info
gi|4097534|gb|AAD12627.1|  phosphoribosylpyrophosphate amidotr...   146    5e-34 
gi|46199458|ref|YP_005125.1|  amidophosphoribosyltransferase [...   146    5e-34   Gene info
gi|88607063|ref|YP_505814.1|  amidophosphoribosyltransferase [...   146    5e-34   Gene info
gi|89209624|ref|ZP_01188019.1|  Amidophosphoribosyl transferas...   146    5e-34 
gi|116512322|ref|YP_809538.1|  Glutamine phosphoribosylpyropho...   146    6e-34   Gene info
gi|15894671|ref|NP_348020.1|  amidophosphoribosyltransferase [...   146    6e-34   Gene info
gi|16803808|ref|NP_465293.1|  amidophosphoribosyltransferase [...   146    6e-34   Gene info
gi|16800946|ref|NP_471214.1|  amidophosphoribosyltransferase [...   146    6e-34   Gene info
gi|88945227|ref|ZP_01148441.1|  Amidophosphoribosyl transferas...   146    6e-34 
gi|46907998|ref|YP_014387.1|  amidophosphoribosyltransferase [...   146    6e-34   Gene info
gi|27262336|gb|AAN87449.1|  Amidophosphoribosyltransferase [Helio   146    7e-34 
gi|94989534|ref|YP_597634.1|  Amidophosphoribosyltransferase [...   146    7e-34   Gene info
gi|78223146|ref|YP_384893.1|  Amidophosphoribosyl transferase ...   145    9e-34   Gene info
gi|83369610|ref|ZP_00914463.1|  Amidophosphoribosyl transferas...   145    9e-34 
gi|113940024|ref|ZP_01425867.1|  amidophosphoribosyltransferas...   145    1e-33 
gi|89070873|ref|ZP_01158112.1|  amidophosphoribosyltransferase...   145    1e-33 
gi|94971647|ref|YP_593695.1|  amidophosphoribosyltransferase [...   145    1e-33   Gene info
gi|55820135|ref|YP_138577.1|  amidophosphoribosyltransferase [...   145    1e-33   Gene info
gi|89101008|ref|ZP_01173851.1|  amidophosphoribosyltransferase...   145    1e-33 
gi|34556883|ref|NP_906698.1|  amidophosphoribosyltransferase [...   145    1e-33   Gene info
gi|116627000|ref|YP_819619.1|  Glutamine phosphoribosylpyropho...   145    1e-33   Gene info
gi|42779405|ref|NP_976652.1|  amidophosphoribosyltransferase [...   145    1e-33   Gene info
gi|83374112|ref|ZP_00918888.1|  Amidophosphoribosyl transferas...   145    1e-33 
gi|116071805|ref|ZP_01469073.1|  amidophosphoribosyltransferas...   145    1e-33 
gi|15673510|ref|NP_267684.1|  amidophosphoribosyltransferase [...   145    1e-33   Gene info
gi|77463011|ref|YP_352515.1|  amidophosphoribosyltransferase [...   145    1e-33   Gene info
gi|6580771|gb|AAF18277.1|  amidophosphoribosyltransferase [Zymomo   145    2e-33 
gi|30018538|ref|NP_830169.1|  amidophosphoribosyltransferase [...   145    2e-33   Gene info
gi|30260468|ref|NP_842845.1|  amidophosphoribosyltransferase [...   145    2e-33   Gene info
gi|22536211|ref|NP_687062.1|  amidophosphoribosyltransferase [...   145    2e-33   Gene info
gi|98662546|dbj|GAA00575.1|  unnamed protein product [Pelotomacul   145    2e-33 
gi|24659598|ref|NP_523949.2|  Phosphoribosylamidotransferase 2...   144    2e-33   UniGene infoGene info
gi|116329975|ref|YP_799693.1|  Amidophosphoribosyltransferase ...   144    2e-33   Gene info
gi|84684694|ref|ZP_01012594.1|  amidophosphoribosyltransferase...   144    2e-33 
gi|116329421|ref|YP_799141.1|  Amidophosphoribosyltransferase ...   144    2e-33   Gene info
gi|75759927|ref|ZP_00739998.1|  Amidophosphoribosyltransferase...   144    2e-33 
gi|24659604|ref|NP_729191.1|  Phosphoribosylamidotransferase 2...   144    3e-33   UniGene infoGene info
gi|89896676|ref|YP_520163.1|  hypothetical protein DSY3930 [De...   144    3e-33   Gene info
gi|87199780|ref|YP_497037.1|  amidophosphoribosyltransferase [...   144    3e-33   Gene info
gi|110619945|emb|CAJ35223.1|  amidophosphoribosyltransferase [...   144    3e-33 
gi|56552453|ref|YP_163292.1|  amidophosphoribosyltransferase [...   144    3e-33   Gene info
gi|76800092|ref|ZP_00781978.1|  amidophosphoribosyltransferase...   144    4e-33 
gi|77918930|ref|YP_356745.1|  amidophosphoribosyltransferase [...   144    4e-33   Gene info
gi|15674270|ref|NP_268443.1|  amidophosphoribosyltransferase [...   143    4e-33   Gene info
gi|94993420|ref|YP_601518.1|  Amidophosphoribosyltransferase [...   143    4e-33   Gene info
gi|85708823|ref|ZP_01039889.1|  amidophosphoribosyltransferase...   143    4e-33 
gi|83942630|ref|ZP_00955091.1|  amidophosphoribosyltransferase...   143    5e-33 
gi|24216790|ref|NP_714271.1|  Amidophosphoribosyltransferase [...   143    5e-33   Gene info
gi|77405228|ref|ZP_00782325.1|  amidophosphoribosyltransferase...   143    5e-33 
gi|69292660|ref|ZP_00619511.1|  Amidophosphoribosyl transferas...   143    5e-33 
gi|19745221|ref|NP_606357.1|  amidophosphoribosyltransferase [...   143    5e-33   Gene info
gi|21909557|ref|NP_663825.1|  amidophosphoribosyltransferase [...   143    5e-33   Gene info
gi|86738817|ref|YP_479217.1|  amidophosphoribosyltransferase [...   143    5e-33   Gene info
gi|56418799|ref|YP_146117.1|  phosphoribosylpyrophosphate amid...   143    6e-33   Gene info
gi|110668790|ref|YP_658601.1|  amidophosphoribosyltransferase ...   143    6e-33   Gene info
gi|69933332|ref|ZP_00628534.1|  Amidophosphoribosyl transferas...   143    6e-33 
gi|76788351|ref|YP_328752.1|  amidophosphoribosyltransferase [...   143    7e-33   Gene info
gi|89204804|ref|ZP_01183380.1|  Amidophosphoribosyl transferas...   143    7e-33 
gi|110603479|ref|ZP_01391556.1|  amidophosphoribosyltransferas...   142    7e-33 
gi|91092280|ref|XP_968163.1|  PREDICTED: similar to CG10078-PB...   142    7e-33   UniGene infoGene info
gi|51893992|ref|YP_076683.1|  phosphoribosylpyrophosphate amid...   142    8e-33   Gene info
gi|15790489|ref|NP_280313.1|  PurF [Halobacterium sp. NRC-1] >...   142    8e-33   Gene info
gi|89200081|ref|ZP_01178837.1|  Amidophosphoribosyl transferas...   142    8e-33 
gi|109672299|ref|ZP_01374538.1|  hypothetical protein Ccon1_01...   142    8e-33 
gi|57241396|ref|ZP_00369342.1|  amidophosphoribosyltransferase...   142    8e-33 
gi|47219329|emb|CAG10958.1|  unnamed protein product [Tetraodon n   142    9e-33 
gi|16082247|ref|NP_394698.1|  amidophosphoribosyltransferase [...   142    9e-33   Gene info
gi|85703139|ref|ZP_01034243.1|  amidophosphoribosyltransferase...   142    1e-32 
gi|58337818|ref|YP_194403.1|  phosphoribosylpyrophosphate amid...   142    1e-32   Gene info
gi|85666619|ref|ZP_01028843.1|  hypothetical protein Badol_010...   142    1e-32 
gi|76796710|ref|ZP_00779065.1|  Amidophosphoribosyl transferas...   142    1e-32 
gi|94268752|ref|ZP_01291273.1|  Amidophosphoribosyl transferas...   142    1e-32 
gi|76802790|ref|YP_330885.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|68231527|ref|ZP_00570694.1|  Amidophosphoribosyl transferas...   142    1e-32 
gi|20807294|ref|NP_622465.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|84515506|ref|ZP_01002868.1|  amidophosphoribosyltransferase...   142    1e-32 
gi|42520914|ref|NP_966829.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|71902690|ref|YP_279493.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|106887133|ref|ZP_01354451.1|  amidophosphoribosyltransferas...   142    1e-32 
gi|25010100|ref|NP_734495.1|  amidophosphoribosyltransferase [...   142    1e-32   Gene info
gi|114766120|ref|ZP_01445124.1|  amidophosphoribosyltransferas...   142    1e-32 
gi|62426071|ref|ZP_00381200.1|  COG0034: Glutamine phosphoribo...   142    2e-32 
gi|54641590|gb|EAL30340.1|  GA10055-PA [Drosophila pseudoobscura]   141    2e-32 
gi|58696713|ref|ZP_00372260.1|  amidophosphoribosyltransferase...   141    2e-32 
gi|17223791|gb|AAL14833.1|  amidophosphoribosyltransferase [Droso   141    2e-32 
gi|94265671|ref|ZP_01289411.1|  Amidophosphoribosyl transferas...   141    2e-32 
gi|83591744|ref|YP_425496.1|  Amidophosphoribosyl transferase ...   141    2e-32   Gene info
gi|13476498|ref|NP_108068.1|  amidophosphoribosyltransferase [...   141    2e-32   Gene info
gi|113877760|ref|ZP_01417034.1|  amidophosphoribosyltransferas...   141    2e-32 
gi|108803838|ref|YP_643775.1|  amidophosphoribosyltransferase ...   141    2e-32   Gene info
gi|72064467|ref|XP_780199.1|  PREDICTED: hypothetical protein ...   141    2e-32   Gene info
gi|85374230|ref|YP_458292.1|  amidophosphoribosyltransferase [...   141    2e-32   Gene info
gi|84502655|ref|ZP_01000774.1|  amidophosphoribosyltransferase...   141    2e-32 
gi|81428274|ref|YP_395274.1|  Amidophosphoribosyltransferase [...   141    2e-32   Gene info
gi|81096494|ref|ZP_00874836.1|  Amidophosphoribosyl transferas...   141    2e-32 
gi|95930096|ref|ZP_01312835.1|  amidophosphoribosyltransferase...   141    3e-32 
gi|50955761|ref|YP_063049.1|  amidophosphoribosyltransferase [...   140    3e-32   Gene info
gi|15899991|ref|NP_344595.1|  amidophosphoribosyltransferase [...   140    3e-32   Gene info
gi|31789371|gb|AAP58488.1|  putative amidophosphoribosyltransf...   140    3e-32 
gi|57168337|ref|ZP_00367471.1|  amidophosphoribosyltransferase...   140    3e-32 
gi|76619824|ref|XP_586663.2|  PREDICTED: similar to phosphorib...   140    3e-32   Gene info
gi|68054851|ref|ZP_00539001.1|  Amidophosphoribosyl transferas...   140    3e-32 
gi|94987380|ref|YP_595313.1|  Glutamine phosphoribosylpyrophos...   140    3e-32   Gene info
gi|51244111|ref|YP_063995.1|  amidophosphoribosyltransferase [...   140    4e-32   Gene info
gi|15902091|ref|NP_357641.1|  amidophosphoribosyltransferase [...   140    4e-32   Gene info
gi|94987655|ref|YP_595756.1|  amidophosphoribosyltransferase [...   140    4e-32   Gene info
gi|114844768|ref|ZP_01455206.1|  amidophosphoribosyltransferas...   140    5e-32 
gi|56718733|gb|AAW28080.1|  chloroplast amidophosphoribosyltra...   140    5e-32 
gi|56697519|ref|YP_167887.1|  amidophosphoribosyltransferase [...   140    5e-32   Gene info
gi|114704687|ref|ZP_01437595.1|  amidophosphoribosyltransferas...   140    5e-32 
gi|15236185|ref|NP_195200.1|  ATASE2 (GLN PHOSPHORIBOSYL PYROP...   140    5e-32   UniGene infoGene info
gi|469195|dbj|BAA06024.1|  amidophosphoribosyltransferase [Arabid   140    5e-32   UniGene info
gi|131608|sp|P28173|PUR1_CHICK  Amidophosphoribosyltransferase...   140    5e-32   Gene info
gi|114769308|ref|ZP_01446934.1|  amidophosphoribosyltransferas...   140    6e-32 
gi|118090470|ref|XP_001232005.1|  PREDICTED: phosphoribosyl py...   140    6e-32   Gene info
gi|78043394|ref|YP_359921.1|  amidophosphoribosyltransferase [...   140    6e-32   Gene info
gi|77408739|ref|ZP_00785470.1|  amidophosphoribosyltransferase...   139    6e-32 
gi|48477741|ref|YP_023447.1|  amidophosphoribosyltransferase [...   139    6e-32   Gene info
gi|103487026|ref|YP_616587.1|  amidophosphoribosyltransferase ...   139    7e-32   Gene info
gi|50843417|ref|YP_056644.1|  amidophosphoribosyltransferase [...   139    7e-32   Gene info
gi|83590877|ref|YP_430886.1|  amidophosphoribosyltransferase [...   139    8e-32   Gene info
gi|88604289|ref|YP_504467.1|  amidophosphoribosyltransferase [...   139    8e-32   Gene info
gi|56417304|ref|YP_154378.1|  amidophosphoribosyltransferase [...   139    8e-32   Gene info
gi|46190818|ref|ZP_00120962.2|  COG0034: Glutamine phosphoribo...   139    9e-32 
gi|12082197|dbj|BAB20824.1|  glutamine phosphoribosylpyophosph...   139    9e-32 
gi|15924060|ref|NP_371594.1|  phosphoribosylpyrophosphate amid...   139    1e-31   Gene info
gi|21282682|ref|NP_645770.1|  phosphoribosylpyrophosphate amid...   139    1e-31   Gene info
gi|82750681|ref|YP_416422.1|  phosphoribosylpyrophosphate amid...   139    1e-31   Gene info
gi|23465689|ref|NP_696292.1|  amidophosphoribosyltransferase p...   139    1e-31   Gene info
gi|110633337|ref|YP_673545.1|  amidophosphoribosyltransferase ...   139    1e-31   Gene info
gi|94498265|ref|ZP_01304825.1|  amidophosphoribosyltransferase...   139    1e-31 
gi|29830678|ref|NP_825312.1|  amidophosphoribosyltransferase [...   139    1e-31   Gene info
gi|56207700|emb|CAI21321.1|  novel protein similar to vertebra...   139    1e-31   Gene info
gi|70607346|ref|YP_256216.1|  glutamine amidophosphoribosyltra...   139    1e-31   Gene info
gi|49483234|ref|YP_040458.1|  putative amidophosphoribosyltran...   139    1e-31   Gene info
gi|73663029|ref|YP_301810.1|  phosphoribosylpyrophosphate amid...   138    1e-31   Gene info
gi|111035796|emb|CAL29423.1|  amidophosphoribosyltransferase [...   138    1e-31 
gi|15217112|gb|AAK92511.1|AF401037_1  phosphoribosylpyrophosph...   138    1e-31 
gi|110680427|ref|YP_683434.1|  amidophosphoribosyltransferase ...   138    2e-31   Gene info
gi|109074759|ref|XP_001085606.1|  PREDICTED: similar to phosph...   138    2e-31   Gene info
gi|62897077|dbj|BAD96479.1|  phosphoribosyl pyrophosphate amid...   138    2e-31   UniGene infoGene info
gi|29570798|ref|NP_002694.3|  phosphoribosyl pyrophosphate ami...   138    2e-31   UniGene infoGene info
gi|88939646|ref|ZP_01145093.1|  amidophosphoribosyltransferase...   138    2e-31 
gi|58381034|ref|XP_310956.2|  ENSANGP00000019430 [Anopheles gambi   138    2e-31   Gene info
gi|116130735|gb|EAA06481.3|  ENSANGP00000019430 [Anopheles gambia   138    2e-31 
gi|57974672|ref|XP_566224.1|  ENSANGP00000026283 [Anopheles gambi   138    2e-31   Gene info
gi|116493199|ref|YP_804934.1|  Glutamine phosphoribosylpyropho...   138    2e-31   Gene info
gi|69246319|ref|ZP_00603892.1|  Amidophosphoribosyl transferas...   137    2e-31 
gi|404861|gb|AAC27345.1|  glutamine PRPP amidotransferase [Homo s   137    2e-31   UniGene infoGene info
gi|109690998|ref|ZP_01378068.1|  hypothetical protein Cjejd_01...   137    2e-31 
gi|86153607|ref|ZP_01071810.1|  amidophosphoribosyltransferase...   137    2e-31 
gi|15791583|ref|NP_281406.1|  amidophosphoribosyltransferase [...   137    2e-31   Gene info
gi|68442595|ref|XP_700773.1|  PREDICTED: similar to phosphorib...   137    3e-31   Gene info
gi|108880885|gb|EAT45110.1|  amidophosphoribosyltransferase [A...   137    3e-31 
gi|114594661|ref|XP_001140991.1|  PREDICTED: phosphoribosyl py...   137    3e-31   Gene info
gi|24378560|ref|NP_720515.1|  amidophosphoribosyltransferase [...   137    3e-31   Gene info
gi|90961644|ref|YP_535560.1|  Amidophosphoribosyltransferase [...   137    3e-31   Gene info
gi|114327134|ref|YP_744291.1|  amidophosphoribosyltransferase ...   137    4e-31   Gene info
gi|114594663|ref|XP_001140907.1|  PREDICTED: phosphoribosyl py...   136    6e-31   Gene info
gi|116251312|ref|YP_767150.1|  putative amidophosphoribosyltra...   136    6e-31   Gene info
gi|28379217|ref|NP_786109.1|  amidophosphoribosyltransferase p...   136    6e-31   Gene info
gi|21222488|ref|NP_628267.1|  amidophosphoribosyltransferase [...   136    6e-31   Gene info
gi|58040073|ref|YP_192037.1|  amidophosphoribosyltransferase [...   136    7e-31   Gene info
gi|31789476|gb|AAP58589.1|  putative amidophosphoribosyl trans...   136    7e-31 
gi|67873329|ref|ZP_00503608.1|  Amidophosphoribosyl transferas...   136    7e-31 
gi|72163146|ref|YP_290803.1|  amidophosphoribosyltransferase [...   136    8e-31   Gene info
gi|57237201|ref|YP_178213.1|  amidophosphoribosyltransferase [...   136    8e-31   Gene info
gi|86151435|ref|ZP_01069650.1|  amidophosphoribosyltransferase...   136    8e-31 
gi|118135105|gb|ABK62149.1|  amidophosphoribosyltransferase [Clos   135    9e-31 
gi|92870676|gb|ABE79947.1|  Purine/pyrimidine phosphoribosyl t...   135    1e-30 
gi|38052001|gb|AAH60430.1|  MGC68694 protein [Xenopus laevis]       135    1e-30   UniGene infoGene info
gi|74195118|dbj|BAE28301.1|  unnamed protein product [Mus musculu   135    1e-30   UniGene infoGene info
gi|73975309|ref|XP_854170.1|  PREDICTED: similar to phosphorib...   135    1e-30   UniGene infoGene info
gi|94374541|ref|XP_001002879.1|  PREDICTED: similar to Amidoph...   135    1e-30   Gene info
gi|66820753|ref|XP_643947.1|  amidophosphoribosyltransferase [...   135    2e-30   Gene info
gi|29376328|ref|NP_815482.1|  amidophosphoribosyltransferase [...   135    2e-30   Gene info
gi|94374539|ref|XP_001002886.1|  PREDICTED: similar to Amidoph...   135    2e-30   Gene info
gi|45361473|ref|NP_989313.1|  hypothetical protein LOC394937 [...   135    2e-30   UniGene infoGene info
gi|27467686|ref|NP_764323.1|  phosphoribosylpyrophosphate amid...   134    2e-30   Gene info
gi|114777606|ref|ZP_01452587.1|  amidophosphoribosyltransferas...   134    2e-30 
gi|76799877|ref|ZP_00781901.1|  amidophosphoribosyltransferase...   134    2e-30 
gi|58584513|ref|YP_198086.1|  Glutamine phosphoribosylpyrophos...   134    2e-30   Gene info
gi|1709918|sp|P52418|PUR1_SOYBN  Amidophosphoribosyltransferas...   134    2e-30   Gene info
gi|15964877|ref|NP_385230.1|  amidophosphoribosyltransferase [...   134    2e-30   Gene info
gi|37983539|gb|AAR06289.1|  5-phosphoribosyl-1-pyrophosphate a...   134    3e-30 
gi|74188893|dbj|BAE39220.1|  unnamed protein product [Mus musc...   134    3e-30   UniGene infoGene info
gi|82896915|ref|XP_929613.1|  PREDICTED: similar to Amidophosp...   134    3e-30   Gene info
gi|116806242|emb|CAL26544.1|  CG2867 [Drosophila simulans]          134    4e-30 
gi|17223789|gb|AAL14832.1|  amidophosphoribosyltransferase [Droso   134    4e-30 
gi|57505628|ref|ZP_00371555.1|  amidophosphoribosyltransferase...   134    4e-30 
gi|74137661|dbj|BAE35859.1|  unnamed protein product [Mus musculu   133    4e-30   UniGene infoGene info
gi|85860900|ref|YP_463102.1|  amidophosphoribosyltransferase [...   133    4e-30   Gene info
gi|84701849|ref|ZP_01016424.1|  amidophosphoribosyltransferase...   133    5e-30 
gi|86749572|ref|YP_486068.1|  amidophosphoribosyltransferase [...   133    5e-30   Gene info
gi|15897546|ref|NP_342151.1|  Amidophosphoribosyltransferase (...   133    5e-30   Gene info
gi|15227244|ref|NP_179247.1|  ATASE (GLN PHOSPHORIBOSYL PYROPH...   133    6e-30   UniGene infoGene info
gi|469193|dbj|BAA06023.1|  amidophosphoribosyltransferase [Arabid   133    6e-30   UniGene info
gi|15606420|ref|NP_213800.1|  amidophosphoribosyltransferase [...   133    6e-30   Gene info
gi|68535423|ref|YP_250128.1|  amidophosphoribosyltransferase [...   133    7e-30   Gene info
gi|62660274|ref|XP_579602.1|  PREDICTED: similar to Amidophosp...   133    7e-30   Gene info
gi|57233809|ref|YP_182123.1|  amidophosphoribosyltransferase [...   132    7e-30   Gene info
gi|49474081|ref|YP_032123.1|  amidophosphoribosyltransferase [...   132    8e-30   Gene info
gi|3213199|gb|AAC39084.1|  prophosphoribosylamidotransferase [Dro   132    9e-30 
gi|83816100|ref|YP_445031.1|  amidophosphoribosyltransferase [...   132    9e-30   Gene info
gi|116806220|emb|CAL26533.1|  CG2867 [Drosophila melanogaster]...   132    1e-29 
gi|15607948|ref|NP_215323.1|  amidophosphoribosyltransferase [...   132    1e-29   Gene info
gi|73749099|ref|YP_308338.1|  amidophosphoribosyltransferase [...   132    1e-29   Gene info
gi|15644003|ref|NP_229052.1|  amidophosphoribosyltransferase [...   132    1e-29   Gene info
gi|28573187|ref|NP_524271.2|  Phosphoribosylamidotransferase C...   132    1e-29   UniGene infoGene info

Alignments

>gi|78778389|ref|YP_396501.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9312]
 gi|78711888|gb|ABB49065.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9312]
Length=486

 Score =  370 bits (950),  Expect = 2e-101, Method: Composition-based stats.
 Identities = 186/200 (93%), Positives = 191/200 (95%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVYKARLKMGDYLSETIKE I +GDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY
Sbjct  273  SVYKARLKMGDYLSETIKESINTGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  332

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQQKRKKSVRQKLNAMS EFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK
Sbjct  333  VGRTFIMPGQQKRKKSVRQKLNAMSTEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  392

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V FTSAAPPVRFPHVYGINMPNR ELIAHDRTISEIA++LEIDNLVYQSVENLRKSIIS+
Sbjct  393  VFFTSAAPPVRFPHVYGINMPNRCELIAHDRTISEIANQLEIDNLVYQSVENLRKSIISE  452

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S +E LEMSCFTG YVTG V
Sbjct  453  SPIEDLEMSCFTGIYVTGKV  472


>gi|33860564|ref|NP_892125.1|  amidophosphoribosyltransferase [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gi|33633506|emb|CAE18463.1|  Glutamine amidotransferase class-II:Phosphoribosyl transferase 
[Prochlorococcus marinus subsp. pastoris str. CCMP1986]
Length=486

 Score =  362 bits (930),  Expect = 4e-99, Method: Composition-based stats.
 Identities = 178/200 (89%), Positives = 191/200 (95%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARLKMGDYL+ETIK+ I  GDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY
Sbjct  273  SVYQARLKMGDYLAETIKQSIQCGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  332

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPG QKRK+SVRQKLNAMS EFKNKNVLIVDDSIVRGTTSK+IVQMAKDAGANK
Sbjct  333  VGRTFIMPGHQKRKQSVRQKLNAMSTEFKNKNVLIVDDSIVRGTTSKQIVQMAKDAGANK  392

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V FTSAAPPVR+PHVYGINMPNRDELIAHDR+I EIA+KLEID+LVYQSVENLRKSII+D
Sbjct  393  VFFTSAAPPVRYPHVYGINMPNRDELIAHDRSIIEIAEKLEIDHLVYQSVENLRKSIIND  452

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S ++ LEMSCFTG+YVTGTV
Sbjct  453  SPIQELEMSCFTGSYVTGTV  472


>gi|84518952|ref|ZP_01006301.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9211]
 gi|84513701|gb|EAQ10039.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9211]
Length=485

 Score =  323 bits (827),  Expect = 4e-87, Method: Composition-based stats.
 Identities = 154/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARL+MGD L+ TIK+ + SGD+DVVMPIPDSSRP+AMQVARQLG+EYREGFFKNRY
Sbjct  272  SVYEARLRMGDRLANTIKKTLNSGDIDVVMPIPDSSRPSAMQVARQLGVEYREGFFKNRY  331

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSVRQKLNAMS EFK KN+LIVDDSIVRGTTS+EIVQMA+ AGANK
Sbjct  332  VGRTFIMPGQSQRKKSVRQKLNAMSTEFKGKNILIVDDSIVRGTTSREIVQMARLAGANK  391

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V+FTSAAPP+RFPHVYGINMP++DELIA+DR+I EI + L +D LVYQ V +L+ +I+ D
Sbjct  392  VTFTSAAPPIRFPHVYGINMPSKDELIAYDRSILEIQNILLVDQLVYQEVGDLKTAILDD  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S +E L+MSCFTG YVTGTV
Sbjct  452  SKIEDLDMSCFTGHYVTGTV  471


>gi|33239456|ref|NP_874398.1|  amidophosphoribosyltransferase [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gi|33236981|gb|AAP99050.1|  Glutamine phosphoribosylpyrophosphate amidotransferase [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
Length=485

 Score =  315 bits (807),  Expect = 7e-85, Method: Composition-based stats.
 Identities = 151/200 (75%), Positives = 180/200 (90%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARL+MGDYL++TI+E ITSG++DVVMPIPDSSRP+AMQVARQLG+EYREGFFKNRY
Sbjct  272  SVYEARLRMGDYLAKTIQEQITSGEIDVVMPIPDSSRPSAMQVARQLGLEYREGFFKNRY  331

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSVRQKLNAMS+EFK KNVL+VDDSIVRGTTS+EIVQMAK AGANK
Sbjct  332  VGRTFIMPGQAQRKKSVRQKLNAMSSEFKGKNVLLVDDSIVRGTTSREIVQMAKLAGANK  391

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V+FTSAAPP+RFPHVYGINMP++ ELIAHD++I +I + L  D LVYQ + +L +SI+  
Sbjct  392  VTFTSAAPPIRFPHVYGINMPSKMELIAHDKSIDQIQETLLADGLVYQKISDLEQSILKG  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S V++L++SCF G YVTG V
Sbjct  452  SQVKNLDLSCFNGEYVTGKV  471


>gi|33862277|ref|NP_893837.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
MIT 9313]
 gi|33640390|emb|CAE20179.1|  Glutamine amidotransferase class-II:Phosphoribosyl transferase 
[Prochlorococcus marinus str. MIT 9313]
Length=485

 Score =  315 bits (806),  Expect = 1e-84, Method: Composition-based stats.
 Identities = 154/200 (77%), Positives = 175/200 (87%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARL+MGD L+ETI++   SGD+DVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY
Sbjct  272  SVYEARLRMGDRLAETIEKYTPSGDIDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  331

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSVRQKLNAM  EFK KNVLIVDDSIVRGTTSKEIVQMA+ AGANK
Sbjct  332  VGRTFIMPGQAQRKKSVRQKLNAMGTEFKGKNVLIVDDSIVRGTTSKEIVQMARVAGANK  391

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V+FTSAAPPVR+ HVYGINMPNR ELIA++RTI EI+ +L  D++VYQ V +L  +I+  
Sbjct  392  VTFTSAAPPVRYSHVYGINMPNRHELIAYNRTIPEISSELSTDHMVYQEVADLEAAIVEG  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S V  LE+SCFTG Y+TGTV
Sbjct  452  SGVSELELSCFTGEYITGTV  471


>gi|72383168|ref|YP_292523.1|  amidophosphoribosyltransferase [Prochlorococcus marinus str. 
NATL2A]
 gi|72003018|gb|AAZ58820.1|  amidophosphoribosyl transferase [Prochlorococcus marinus str. 
NATL2A]
Length=485

 Score =  310 bits (795),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 147/200 (73%), Positives = 180/200 (90%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY++RL+MGD L+ETIK+ I+ GD+DVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY
Sbjct  272  SVYESRLRMGDLLAETIKKQISLGDIDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  331

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ  RK+SVRQKLNAMS EFKNKNVLIVDDS+VRGTTS++IVQMA+ AGANK
Sbjct  332  VGRTFIMPGQSLRKRSVRQKLNAMSTEFKNKNVLIVDDSVVRGTTSQQIVQMARSAGANK  391

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V+FTSAAPP+R+PHVYGINMP+R+ELIA++R I++I + L ID ++YQ V +L ++I  +
Sbjct  392  VTFTSAAPPIRYPHVYGINMPSRNELIAYNRDINQIENNLFIDKMIYQEVNDLTQAITQN  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S ++ L++SCFTG Y+TGTV
Sbjct  452  SKIKELDLSCFTGKYITGTV  471


>gi|88854870|ref|ZP_01129536.1|  amidophosphoribosyltransferase [marine actinobacterium PHSC20C1]
 gi|88816031|gb|EAR25887.1|  amidophosphoribosyltransferase [marine actinobacterium PHSC20C1]
Length=485

 Score =  304 bits (779),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 144/200 (72%), Positives = 174/200 (87%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARL++G+ L++TI +    GD+DVVMPIPDSSRPAAMQVA++LG+EYREGF+KNRY
Sbjct  272  SVYEARLRLGNKLADTIAKFTPMGDIDVVMPIPDSSRPAAMQVAQKLGVEYREGFYKNRY  331

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSV+QKLNAMS+EFK KN+LIVDDSIVRGTTSKEIVQMA++AGANK
Sbjct  332  VGRTFIMPGQAERKKSVKQKLNAMSSEFKGKNILIVDDSIVRGTTSKEIVQMAREAGANK  391

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V+FTSAAPPVRFPHVYGINMP R ELI H R I EIA +L  D L+YQ VE+++ +I++ 
Sbjct  392  VTFTSAAPPVRFPHVYGINMPTRAELIGHGRKIPEIAIELGADALIYQEVEDMQAAIVAG  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            S V  LEMSCFTG Y++G +
Sbjct  452  SNVTSLEMSCFTGDYISGNI  471


>gi|78211562|ref|YP_380341.1|  amidophosphoribosyltransferase [Synechococcus sp. CC9605]
 gi|78196021|gb|ABB33786.1|  amidophosphoribosyltransferase [Synechococcus sp. CC9605]
Length=485

 Score =  301 bits (770),  Expect = 1e-80, Method: Composition-based stats.
 Identities = 141/200 (70%), Positives = 175/200 (87%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY++RL+MGD L++TI E + +GD+DVVMPIPDS+RP+AMQVA++LG++YREGF+KNRY
Sbjct  272  SVYESRLRMGDRLAQTIAETLPAGDIDVVMPIPDSARPSAMQVAKRLGLDYREGFYKNRY  331

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSVRQKLNA+  EF  KNVLIVDDSIVRGTTS+EIVQMA+ AGANK
Sbjct  332  VGRTFIMPGQAERKKSVRQKLNALGTEFAGKNVLIVDDSIVRGTTSREIVQMARSAGANK  391

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V+FTSAAPPVR+P+VYGINMP R EL+AH RT  EI+D L  D++VYQ+VENL +SI+ +
Sbjct  392  VTFTSAAPPVRYPNVYGINMPTRAELLAHGRTSDEISDVLGADHVVYQTVENLLESIVEN  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
            + ++ LEMSCF G YVTG +
Sbjct  452  TEIKDLEMSCFDGHYVTGGI  471


>gi|28572878|ref|NP_789658.1|  amidophosphoribosyltransferase [Tropheryma whipplei TW08/27]
 gi|28411011|emb|CAD67396.1|  amidophosphoribosyltransferase [Tropheryma whipplei TW08/27]
Length=486

 Score =  283 bits (725),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 135/200 (67%), Positives = 166/200 (83%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARL++GD LS TIK+ +  G++DVVMPIPDSSRPAA+QV+R LGIEYREGF KNRY
Sbjct  273  SVYEARLRLGDTLSTTIKQQMPCGNIDVVMPIPDSSRPAALQVSRNLGIEYREGFLKNRY  332

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSVRQKLNAM  EF+ KNVLIVDDSIVRGTTSKEI+ MA+ AGAN+
Sbjct  333  VGRTFIMPGQLQRKKSVRQKLNAMGLEFRGKNVLIVDDSIVRGTTSKEIIHMARSAGANQ  392

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V FTSAAPPVR+ +V+GINMP   EL+AH+R + EI   ++ D L+YQS+E++R++I+  
Sbjct  393  VFFTSAAPPVRYQNVFGINMPTSSELVAHNRQLQEIRQYIDADRLIYQSIEDMRRAIMHG  452

Query  181  SLVEHLEMSCFTGTYVTGTV  200
               + LE SCF+G YVTG V
Sbjct  453  GEFKRLEDSCFSGEYVTGRV  472


>gi|28493690|ref|NP_787851.1|  amidophosphoribosyltransferase [Tropheryma whipplei str. Twist]
 gi|28476732|gb|AAO44820.1|  amidophosphoribosyltransferase [Tropheryma whipplei str. Twist]
Length=504

 Score =  283 bits (725),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 135/200 (67%), Positives = 166/200 (83%), Gaps = 0/200 (0%)

Query  1    SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY  60
            SVY+ARL++GD LS TIK+ +  G++DVVMPIPDSSRPAA+QV+R LGIEYREGF KNRY
Sbjct  291  SVYEARLRLGDTLSTTIKQQMPCGNIDVVMPIPDSSRPAALQVSRNLGIEYREGFLKNRY  350

Query  61   VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK  120
            VGRTFIMPGQ +RKKSVRQKLNAM  EF+ KNVLIVDDSIVRGTTSKEI+ MA+ AGAN+
Sbjct  351  VGRTFIMPGQLQRKKSVRQKLNAMGLEFRGKNVLIVDDSIVRGTTSKEIIHMARSAGANQ  410

Query  121  VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD  180
            V FTSAAPPVR+ +V+GINMP   EL+AH+R + EI   ++ D L+YQS+E++R++I+  
Sbjct  411  VFFTSAAPPVRYQNVFGINMPTSSELVAHNRQLQEIRQYIDADRLIYQSIEDMRRAIMHG  470

Query  181  SLVEHLEMSCFTGTYVTGTV  200
               + LE SCF+G YVTG V
Sbjct  471  GEFKRLEDSCFSGEYVTGRV  490


>gi|113868568|ref|YP_727057.1|  glutamine phosphoribosylpyrophosphate amidotransferase [Ralstonia 
eutropha H16]
 gi|113527344|emb|CAJ93689.1|  glutamine phosphoribosylpyrophosphate amidotransferase [Ralstonia 
eutropha H16]
Length=509

 Score =  283 bits (724),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 137/200 (68%), Positives = 165/200 (82%), Gaps = 1/200 (0%)

Query  2    VYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYV  61
            VY ARL+MGDYL+E I++ +++GDVDVVMPIPDSSRPAAMQVA +LG+ YREGFFKNRYV
Sbjct  272  VYDARLRMGDYLAEKIRQEVSAGDVDVVMPIPDSSRPAAMQVANRLGVNYREGFFKNRYV  331

Query  62   GRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANKV  121
            GRTFIMPGQ  RKKSVRQKLNAM  EFK KNVLIVDDSIVRGTTS EIVQMA+DAGANKV
Sbjct  332  GRTFIMPGQAVRKKSVRQKLNAMGVEFKGKNVLIVDDSIVRGTTSFEIVQMARDAGANKV  391

Query  122  SFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIIS-D  180
             F SAAPPV++P+VYGI+MP R EL+AH+RT  EIA  +  D LVYQ VE +++++   +
Sbjct  392  IFASAAPPVKYPNVYGIDMPTRSELVAHNRTHEEIAKIIGADKLVYQDVEAMKQAVRDIN  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
              ++  + SCF G Y+TG +
Sbjct  452  PALKDFDASCFDGRYITGDI  471


>gi|84354023|ref|ZP_00978939.1|  COG0034: Glutamine phosphoribosylpyrophosphate amidotransferase 
[Burkholderia cenocepacia PC184]
 gi|107026746|ref|YP_624257.1|  amidophosphoribosyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116692062|ref|YP_837595.1|  amidophosphoribosyltransferase [Burkholderia cenocepacia HI2424]
 gi|105896120|gb|ABF79284.1|  amidophosphoribosyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116650062|gb|ABK10702.1|  amidophosphoribosyltransferase [Burkholderia cenocepacia HI2424]
Length=510

 Score =  281 bits (720),  Expect = 8e-75, Method: Composition-based stats.
 Identities = 137/200 (68%), Positives = 163/200 (81%), Gaps = 1/200 (0%)

Query  2    VYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYV  61
            VY  RL+MGDYL+E IK  + +  +DVVMPIPDSSRPAAMQVA +LG+EYREGFFKNRYV
Sbjct  272  VYNVRLRMGDYLAEKIKRELPNVPIDVVMPIPDSSRPAAMQVAAKLGVEYREGFFKNRYV  331

Query  62   GRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANKV  121
            GRTFIMPGQ  RKKSVRQKLNAMS EFK+K+VLIVDDSIVRGTTS EIVQMA+DAGA  V
Sbjct  332  GRTFIMPGQAVRKKSVRQKLNAMSIEFKDKHVLIVDDSIVRGTTSHEIVQMARDAGAKSV  391

Query  122  SFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIIS-D  180
             F SAAPPV+FP+VYGI+MP R EL+AH RT  E+A  +  D+L+YQ V++LR+++   +
Sbjct  392  IFASAAPPVKFPNVYGIDMPTRGELVAHGRTDEEVAKIIGADHLIYQDVDDLRRAVRDIN  451

Query  181  SLVEHLEMSCFTGTYVTGTV  200
              +EH E SCF G Y+TG V
Sbjct  452  PKLEHFEASCFDGNYITGAV  471

ORF finding

sms/ any codon/ phase 1,2 et 3/direct/60/standard

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 8 to base 223.
AATGAAAGAACGCAAATTAAGAATGATTATTTCCTCAAAATTTTACCAAGTAATTATTAT
CTTGACATTGAAACTAATAAAAATAAATCTGCTAGATTAGACTTTGATAAATTAATTTTT
AAATCTAATAAAACGAATTTTTTAATTGACTTTTTAAAATTAGATAAAGATGAATATCTT
GAAAATTGTTTTCGACTAGAAAACTTGCTCGCCTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
NERTQIKNDYFLKILPSNYYLDIETNKNKSARLDFDKLIFKSNKTNFLIDFLKLDKDEYL
ENCFRLENLLA*

>ORF number 2 in reading frame 2 on the direct strand extends from base 467 to base 658.
GGAAAACGAACTGGAGGAGCAGCTGATGTGAAAGAAACTTTATTTGCTCCTGCATCTTTA
GCCATCTGTACAATTTCTTTTGAAGTAGTACCTCTTACTATCGAATCATCAACTATTAAT
ACATTTTTATTTTTAAATTCTGCACTCATAGCATTTAACTTTTGTCTTACGGATTTCTTA
CGTTTCTGTTGA

>Translation of ORF number 2 in reading frame 2 on the direct strand.
GKRTGGAADVKETLFAPASLAICTISFEVVPLTIESSTINTFLFLNSALIAFNFCLTDFL
RFC*


sms/ atg, gtg, ctg et ttg/ phase 1,2 et 3/direct/60/standard

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.



sms/ any codon/ phase 1,2 et 3/indirect/60/standard

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 647.
TCAGTGTATAAAGCTCGTTTGAAAATGGGAGATTATTTATCTGAAACAATAAAGGAAATA
ATTACTTCTGGAGATGTTGATGTTGTAATGCCTATTCCTGATTCTTCACGACCTGCTGCT
ATGCAAGTTGCAAGACAGCTAGGTATTGAGTATAGAGAGGGCTTTTTTAAAAATAGATAT
GTTGGTAGAACATTTATTATGCCTGGTCAACAGAAACGTAAGAAATCCGTAAGACAAAAG
TTAAATGCTATGAGTGCAGAATTTAAAAATAAAAATGTATTAATAGTTGATGATTCGATA
GTAAGAGGTACTACTTCAAAAGAAATTGTACAGATGGCTAAAGATGCAGGAGCAAATAAA
GTTTCTTTCACATCAGCTGCTCCTCCAGTTCGTTTTCCTCATGTTTATGGAATTAATATG
CCTAATAGAGATGAATTAATAGCTCATGATAGAACAATAAGTGAAATTGCTGATAAACTT
GAAATTGATAATCTCGTTTATCAAAGTGTTGAAAATTTACGTAAATCTATAATAAGTGAT
TCTCTTGTTGAACATTTGGAGATGAGTTGTTTTACTGGTACTTATGTAACAGGAACAGTA
AATCAAGAGTATTTAAATTGGGTCGAAAATGAATATACTTCTTAG

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
SVYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRY
VGRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANK
VSFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISD
SLVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS*


sms/ atg, ttg, ctg et gtg/ phase 3/indirect/60/standard

>ORF number 1 in reading frame 3 on the reverse strand extends from base 6 to base 647.
GTGTATAAAGCTCGTTTGAAAATGGGAGATTATTTATCTGAAACAATAAAGGAAATAATT
ACTTCTGGAGATGTTGATGTTGTAATGCCTATTCCTGATTCTTCACGACCTGCTGCTATG
CAAGTTGCAAGACAGCTAGGTATTGAGTATAGAGAGGGCTTTTTTAAAAATAGATATGTT
GGTAGAACATTTATTATGCCTGGTCAACAGAAACGTAAGAAATCCGTAAGACAAAAGTTA
AATGCTATGAGTGCAGAATTTAAAAATAAAAATGTATTAATAGTTGATGATTCGATAGTA
AGAGGTACTACTTCAAAAGAAATTGTACAGATGGCTAAAGATGCAGGAGCAAATAAAGTT
TCTTTCACATCAGCTGCTCCTCCAGTTCGTTTTCCTCATGTTTATGGAATTAATATGCCT
AATAGAGATGAATTAATAGCTCATGATAGAACAATAAGTGAAATTGCTGATAAACTTGAA
ATTGATAATCTCGTTTATCAAAGTGTTGAAAATTTACGTAAATCTATAATAAGTGATTCT
CTTGTTGAACATTTGGAGATGAGTTGTTTTACTGGTACTTATGTAACAGGAACAGTAAAT
CAAGAGTATTTAAATTGGGTCGAAAATGAATATACTTCTTAG

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
VYKARLKMGDYLSETIKEIITSGDVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYV
GRTFIMPGQQKRKKSVRQKLNAMSAEFKNKNVLIVDDSIVRGTTSKEIVQMAKDAGANKV
SFTSAAPPVRFPHVYGINMPNRDELIAHDRTISEIADKLEIDNLVYQSVENLRKSIISDS
LVEHLEMSCFTGTYVTGTVNQEYLNWVENEYTS*