ORF OH16480

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160023.1
Annotathon code: ORF_OH16480
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : eliotte
Annotated on : 2008-03-19 18:52:37
  • CHABERT marion
  • GIRAUD helene

Synopsis

Genomic Sequence

>AACY01160023.1 ORF_OH16480 genomic DNA
TGGCTCTGGCTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCTCTGCCTCTCCCTGGCTCTCTTGGGCCCTTCCGGCTCTCTCTGG
CTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGGGGGTTTTCGGGCTCTTGCGGGC
TCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTGGCTCTCTGTGGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCTCTT
TGGCTCCCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTCTCTGGGTTTCTCTGGCTCTCGCTGGTTCCCTCCGGCTCTCTC
TGGGTCTCTCTGGCGCTCTCTGGTCCTCTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTCCCTGGCTTTCTCTGGCTCTCTC
TGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTGTTTGGCTCTCTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCTCTT
TTGTTGTCTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCGTGGCTGCATCTCTTTGTGTGACGCAGTCGAGAAGCTTAGCCG
GGATTTCGCCCACAGGTAAACCTGAGGACACATATGGCGCACGGCGAAGCCCGGCCATTGCCAGTGCACATGGAATCTTGTCCACCAAATAAGCGTGTGG
ATGACTTACCTTATTCGTGAGAGGATA

Translation

[70 - 825/827]   indirect strand


Phylogeny


Annotator commentaries

Après recherche des ORF dans la séquence d'ADN en sens direct et indirect nous avons trouvé deux ORF dans le sens indirect. Nous avons gardé le premier qui était le plus grand (755nucléotides) ce qui correspond après traduction à 252 acides aminés.

La recherche de domaines protéiques par prosite ne donne que des résultats faux positifs (site de myristylation...). En revanche aucun résultat n'apparait dans interpro. Malgré ce manque de résultats significatifs, nous avons réalisé deux blastp avec swissprot et nr. (voir annotathon)

Les résultats avec swissprot montrent que la meilleure e-value est de 5e-05 et celle avec nr est de 7e-09. Nous avons conservé les résultats de nr.

En regardant les premiers alignements 2 à 2, nous nous sommes apperçues que les séquences homologues étaient composées majoritairement d'éléments répétés: E et P. Nous sommes donc remontées à la séquence nucléique et avons constaté qu'elle n'était composée que d'éléments répétés.

Nous ne pouvons pas aller plus loin dans l'annotathon et nous concluons donc que cette séquence est non-codante.

(nous avons tenu compte de votre remarque à propos du blastx mais nous n'avons pas réussi à le faire)

Multiple Alignement


BLAST

blastp ORF vs swissprot

gi|76363500|sp|Q9L7Q2|ZMPB_STRPN  Zinc metalloprotease zmpB precu  47.4    5e-05
gi|82583720|sp|O01761|UNC89_CAEEL  Muscle M-line assembly prot...  46.2    1e-04  Gene info
gi|5921693|sp|Q05152|CAC1B_RABIT  Voltage-dependent N-type cal...  45.4    2e-04
gi|6685537|sp|Q14152|IF3A_HUMAN  Eukaryotic translation initia...  45.1    2e-04  Gene info
gi|62512118|sp|Q8DQN5|ZMPB_STRR6  Zinc metalloprotease zmpB precu  43.1    0.001  Gene info
gi|50400866|sp|Q6KCD5|NPBL_MOUSE  Nipped-B-like protein (Delangin  42.0    0.002  Gene info
gi|6686292|sp|P23116|IF3A_MOUSE  Eukaryotic translation initia...  41.6    0.003  Gene info
gi|1705706|sp|P54282|CAC1A_RAT  Voltage-dependent P/Q-type cal...  40.8    0.005  Gene info
gi|20137608|sp|Q9Z330|DNMT1_RAT  DNA (cytosine-5)-methyltransf...  40.0    0.007  Gene info
gi|1170517|sp|P45386|IGA4_HAEIN  Immunoglobulin A1 protease precu  37.7    0.040
gi|81311015|sp|Q5E7L5|IF2_VIBF1  Translation initiation factor IF  37.4    0.043  Gene info
gi|5921454|sp|P97445|CAC1A_MOUSE  Voltage-dependent P/Q-type c...  37.4    0.047  Gene info
gi|112670|sp|P15711|104K_THEPA  104 kDa microneme-rhoptry antigen  37.0    0.067
gi|1705854|sp|Q00975|CAC1B_HUMAN  Voltage-dependent N-type cal...  36.6    0.075  Gene info
gi|50400865|sp|Q6KC79|NIPBL_HUMAN  Nipped-B-like protein (Delangi  36.2    0.10   Gene info
gi|5921456|sp|P56698|CAC1B_DISOM  Probable voltage-dependent N...  35.8    0.13 
gi|61217641|sp|Q9BYE2|TMPSD_HUMAN  Transmembrane protease, ser...  35.4    0.17   Gene info
gi|23822071|sp|Q28298|RRBP1_CANFA  Ribosome-binding protein 1 (18  35.0    0.23   Gene info
gi|74950752|sp|Q4U9M9|104K_THEAN  104 kDa microneme-rhoptry antig  34.7    0.27 
gi|81917793|sp|Q9R0G8|NRK_MOUSE  Nik-related protein kinase (N...  34.7    0.32   Gene info
gi|76363581|sp|Q5UPJ3|YL116_MIMIV  Uncharacterized protein L116    34.7    0.32   Gene info
gi|62511164|sp|Q863A2|TBX2_CANFA  T-box transcription factor TBX2  34.7    0.32   Gene info
gi|124244|sp|P09790|IGA_NEIGO  IgA-specific serine endopeptidase   34.3    0.41 
gi|81311452|sp|Q5FJN6|IF2_LACAC  Translation initiation factor IF  33.5    0.62 
gi|108935977|sp|Q24K09|DNMT1_BOVIN  DNA (cytosine-5)-methyltransf  33.5    0.63   Gene info
gi|90101372|sp|Q3IJ53|IF2_PSEHT  Translation initiation factor IF  33.1    0.81   Gene info
gi|37999954|sp|Q8TDI7|TMC2_HUMAN  Transmembrane channel-like p...  33.1    0.98   Gene info
gi|48428490|sp|Q9GLW0|PRGR_CANFA  Progesterone receptor (PR)       33.1    1.0    Gene info
gi|2498904|sp|Q14242|SELPL_HUMAN  P-selectin glycoprotein liga...  32.7    1.3    Gene info
gi|116242677|sp|P12036|NFH_HUMAN  Neurofilament triplet H prot...  32.7    1.3  
gi|13431559|sp|P57873|IF2_PASMU  Translation initiation factor IF  32.3    1.4  
gi|90101378|sp|Q32BG5|IF2_SHIDS  Translation initiation factor IF  32.3    1.6    Gene info
gi|81830507|sp|Q72ER1|IF2_DESVH  Translation initiation factor IF  32.3    1.7    Gene info
gi|20141336|sp|P13864|DNMT1_MOUSE  DNA (cytosine-5)-methyltran...  32.0    1.9    Gene info
gi|85540609|sp|Q86TD4|SRCA_HUMAN  Sarcalumenin precursor           32.0    2.0    Gene info
gi|267150|sp|Q01320|TOP2A_MOUSE  DNA topoisomerase 2-alpha (DNA t  32.0    2.0    Gene info
gi|94730407|sp|Q9QYX7|PCLO_MOUSE  Protein piccolo (Aczonin) (M...  32.0    2.1  
gi|2498738|sp|P75211|P200_MYCPN  Protein P200                      31.6    2.3  
gi|6165988|sp|Q15878|CAC1E_HUMAN  Voltage-dependent R-type cal...  31.6    2.5    Gene info
gi|33518630|sp|Q14690|RRP5_HUMAN  RRP5 protein homolog (Programme  31.6    2.7    Gene info
gi|12644429|sp|Q28343|PGCA_CANFA  Aggrecan core protein precur...  31.2    3.5  
gi|21542298|sp|Q9PU53|TERF2_CHICK  Telomeric repeat-binding fa...  31.2    3.6    Gene info
gi|34098662|sp|Q92576|PHF3_HUMAN  PHD finger protein 3             31.2    3.7    Gene info
gi|90110783|sp|Q8NEE8|TTC16_HUMAN  Tetratricopeptide repeat prote  30.8    4.2  
gi|20532391|sp|Q9Y6K1|DNM3A_HUMAN  DNA (cytosine-5)-methyltran...  30.8    5.0    Gene info
gi|68565218|sp|Q8N884|CF150_HUMAN  Protein C6orf150                30.4    5.7    Gene info
gi|24212076|sp|Q9JKS6|PCLO_RAT  Protein piccolo (Aczonin) (Mul...  30.4    5.7    Gene info
gi|81914087|sp|Q8C761|WDR60_MOUSE  WD repeat protein 60            30.4    6.2    Gene info
gi|115502506|sp|Q7Z2Y5|NRK_HUMAN  Nik-related protein kinase       30.4    6.5    Gene info
gi|6166049|sp|O55017|CAC1B_MOUSE  Voltage-dependent N-type cal...  30.4    6.6    Gene info
gi|97537162|sp|Q15772|SPEG_HUMAN  Striated muscle preferential...  30.0    7.4  
gi|23396613|sp|Q8ZBC2|IF2_YERPE  Translation initiation factor...  30.0    7.4  
gi|90110075|sp|Q9H2D6|TARA_HUMAN  TRIO and F-actin-binding pro...  30.0    8.1  
gi|52782720|sp|Q6RHR9|MAGI1_MOUSE  Membrane-associated guanyla...  30.0    8.2    Gene info
gi|12231019|sp|P26358|DNMT1_HUMAN  DNA (cytosine-5)-methyltran...  29.6    9.2    Gene info
gi|19862882|sp|Q09779|YATE_SCHPO  Hypothetical protein C1D4.14 in  29.6    9.8  


>gi|82583720|sp|O01761|UNC89_CAEEL Gene info Muscle M-line assembly protein unc-89 (Uncoordinated protein 
89)
Length=8081

 Score = 41.6 bits (96),  Expect = 0.003, Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 83/221 (37%), Gaps = 12/221 (5%)

Query  41    ESQREPERPGDNKRGPEGTRESQREPGR-ARESQTEPEATSKSWREPERAR-ESQGEPER  98
             + ++ PE+  +    P    +S  +P    ++S+ E ++ +K  + PE++  E    P+ 
Sbjct  1562  KKEKSPEKVEEKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKE  1621

Query  99    AKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPER  158
                 + + K     ++     + +  +     + ++ P++  E    P +   S   P +
Sbjct  1622  KSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESS---PTK  1678

Query  159   ARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARE------  212
               +++    ++  + P+        P    KSP+     E     ++ PE+A E      
Sbjct  1679  KTDDEVKSPTKKEKSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPT  1738

Query  213   -SQREPERAresrkgprepgrgresqrARESPGEPQRTSQS  252
               ++ PE++                + A E P  P +   S
Sbjct  1739  KKEKSPEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESS  1779


 Score = 32.7 bits (73),  Expect = 1.2, Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 63/162 (38%), Gaps = 2/162 (1%)

Query  43    QREPERPGDNKRGPEGTR-ESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKA  101
             + +P  P   ++ PE +  E  + P      + E +  S + +E    + +  E +    
Sbjct  1698  EEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEEVKSPTK  1757

Query  102   SQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPERARE  161
              +  P+ + E++      +ES        E  + P +  +S  + E    S    E+  E
Sbjct  1758  KEKSPEKSAEEKPKSPTKKESSPVKMADDEV-KSPTKKEKSPEKVEEKPASPTKKEKTPE  1816

Query  162   NQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARES  203
                A E +S  + E    S  K  G     K+P++PE   +S
Sbjct  1817  KSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKS  1858


 Score = 32.3 bits (72),  Expect = 1.6, Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 83/225 (36%), Gaps = 10/225 (4%)

Query  32    AATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARE  91
             AA E +   + ++ P  P   ++ P    +   +  + +     P    KS  +PE  + 
Sbjct  1423  AAEEVKSPTKKEKSPSSPTKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSPEKPEDVKS  1482

Query  92    SQGEPERAKASQ-----GEPKGAREDQraperpresrreparareTQRGPKRARESQREP  146
                + +   A+       E    + +            E   + + ++ P++  E  + P
Sbjct  1483  PVKKEKSPDATNIVEVSSETTIEKTETTMTTEMTHESEESRTSVKKEKTPEKVDEKPKSP  1542

Query  147   ERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQRE  206
              +     + PE++   +     +  + PE        P    KSP+ P  P   ++S+ E
Sbjct  1543  TK---KDKSPEKSITEEIKSPVKKEKSPEKVEEKPASPTKKEKSPEKPASP--TKKSENE  1597

Query  207   PERARESQREPERAresrkgprepgrgresqrARESPGEPQRTSQ  251
              +   + ++ PE++        +     ++    +SP + +++ +
Sbjct  1598  VKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKEKSPE  1642


>gi|1705706|sp|P54282|CAC1A_RAT Gene info Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Voltage-gated 
calcium channel subunit alpha Cav2.1) (Calcium 
channel, L type, alpha-1 polypeptide, isoform 4) (Brain calcium 
channel I) (BI) (RAT brain class A) (RBA-I)
Length=2212

 Score = 37.7 bits (86),  Expect = 0.037, Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 76/183 (41%), Gaps = 21/183 (11%)

Query  23    LLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTR----ESQREPGRARESQTEPEA  78
             ++D    R+  T   RA E+ R+  RP ++ R P+  R      +R PGR      E E 
Sbjct  825   VVDPQENRNNNTNKSRAPEALRQTARPRESARDPDARRAWPSSPERAPGREGPYGRESEP  884

Query  79    TSKSWREPERARESQGEPERAKA------------SQGEPKGAREDQraperpresrrep  126
               +    P        +PERAKA            ++GEP+  R  +R  + P +     
Sbjct  885   QQREHAPPREHVPWDADPERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERR  944

Query  127   arareTQRGPKRARESQREPERARGSQRGP----ERARENQGARESQSHREP-EGPRGSQ  181
              R R+  R  + A     + ER R  + GP    +R R ++  +ESQ    P  GP  S 
Sbjct  945   PRPRDATRPARAADGEGDDGERKRRHRHGPPAHDDRERRHRRRKESQGSGVPMSGPNLST  1004

Query  182   RKP  184
              +P
Sbjct  1005  TRP  1007






blastp ORF vs nr
gi|118419244|gb|ABK87663.1|  conserved hypothetical protein [B...  63.9    7e-09
gi|71666455|ref|XP_820186.1|  trans-sialidase [Trypanosoma cru...  53.1    1e-05  Gene info
gi|66359950|ref|XP_627153.1|  sushi-domain containing secreted...  52.8    1e-05  Gene info
gi|22209012|gb|AAC98688.2|  surface antigen PHGST#5 [Trypanosoma   52.0    3e-05
gi|83317505|ref|XP_731189.1|  hypothetical protein PY03200 [Pl...  50.4    7e-05  Gene info
gi|758803|gb|AAB70878.1|  peritrophin-95 precursor [Lucilia cupri  48.5    2e-04
gi|984808|gb|AAA92532.1|  peritrophin-95 precursor                 48.1    4e-04
gi|49478820|ref|YP_038951.1|  conserved hypothetical protein, ...  47.0    8e-04  Gene info
gi|52140598|ref|YP_086232.1|  cell surface protein [Bacillus c...  46.2    0.002  Gene info
gi|71413651|ref|XP_808957.1|  trans-sialidase [Trypanosoma cru...  45.4    0.003  Gene info
gi|26342987|dbj|BAC35150.1|  unnamed protein product [Mus musculu  43.9    0.006  UniGene infoGene info
gi|28481366|ref|XP_139295.2|  PREDICTED: similar to caspase re...  43.9    0.006  UniGene infoGene info
gi|27807135|ref|NP_777057.1|  calcium channel, voltage-depende...  43.5    0.009  UniGene infoGene info
gi|118093208|ref|XP_421831.2|  PREDICTED: similar to Inpp5a prote  43.1    0.011  Gene info
gi|115762736|ref|XP_785240.2|  PREDICTED: similar to WD repeat...  42.7    0.017  Gene info
gi|115964466|ref|XP_001191416.1|  PREDICTED: similar to WD rep...  42.7    0.017  Gene info
gi|47125144|gb|AAH70605.1|  LOC431817 protein [Xenopus laevis]     42.4    0.018  UniGene infoGene info
gi|30022968|ref|NP_834599.1|  Cell surface protein [Bacillus c...  42.4    0.020  Gene info
gi|47206643|emb|CAF91366.1|  unnamed protein product [Tetraodon n  41.6    0.031
gi|83616161|gb|ABC25605.1|  anonymous antigen-2 [Babesia bovis]    41.6    0.036
gi|71980588|ref|NP_001020985.1|  UNCoordinated family member (...  41.6    0.039  UniGene infoGene info
gi|71980604|ref|NP_001020990.1|  UNCoordinated family member (...  41.2    0.042  UniGene infoGene info
gi|1160355|gb|AAB00542.1|  UNC-89                                  41.2    0.046
gi|7511618|pir||T29757  protein UNC-89 - Caenorhabditis elegans    41.2    0.046
gi|71980586|ref|NP_001020984.1|  UNCoordinated family member (...  41.2    0.047  UniGene infoGene info
gi|45935149|gb|AAS79607.1|  hypothetical protein [Ipomoea trifida  40.8    0.053
gi|52144762|ref|YP_082066.1|  possible internalin protein [Bac...  40.8    0.058  Gene info
gi|71666350|ref|XP_820135.1|  trans-sialidase [Trypanosoma cru...  40.4    0.071  Gene info
gi|71406403|ref|XP_805742.1|  hypothetical protein [Trypanosom...  40.4    0.071  Gene info
gi|111307761|gb|AAI21193.1|  Unknown (protein for IMAGE:4960177)   40.4    0.072
gi|16769850|gb|AAL29144.1|  SD04745p [Drosophila melanogaster]     38.5    0.26   UniGene info
gi|161956|gb|AAB97873.1|  surface antigen [Trypanosoma cruzi]      37.7    0.50 
gi|6978579|ref|NP_037050.1|  calcium channel, voltage-dependen...  37.7    0.50   UniGene infoGene info
gi|71408769|ref|XP_806768.1|  kinetoplast DNA-associated prote...  37.7    0.52   Gene info
gi|118093099|ref|XP_421787.2|  PREDICTED: similar to p167 [Gallus  37.4    0.65   Gene info
gi|118415465|gb|ABK83884.1|  internalin protein [Bacillus thuring  37.4    0.69 
gi|83750916|ref|ZP_00947331.1|  hypothetical protein BbacK_010...  37.0    0.76 
gi|67623325|ref|XP_667945.1|  Sushi domain [Cryptosporidium ho...  37.0    0.90   Gene info
gi|71649745|ref|XP_813586.1|  trans-sialidase [Trypanosoma cru...  36.6    1.1    Gene info
gi|71657429|ref|XP_817230.1|  hypothetical protein [Trypanosom...  36.6    1.1    Gene info
gi|24584968|ref|NP_609877.2|  nucampholin CG12750-PA [Drosophi...  36.6    1.2    UniGene infoGene info
gi|71021185|ref|XP_760823.1|  hypothetical protein UM04676.1 [...  35.8    1.7    Gene info
gi|71648919|ref|XP_813237.1|  trans-sialidase [Trypanosoma cru...  35.8    2.1    Gene info
gi|89365957|gb|AAI14430.1|  Eukaryotic translation initiation ...  35.4    2.2    UniGene infoGene info
gi|114633007|ref|XP_001153575.1|  PREDICTED: eukaryotic transl...  35.4    2.3    Gene info
gi|4503509|ref|NP_003741.1|  eukaryotic translation initiation...  35.4    2.3    UniGene infoGene info
gi|40788877|dbj|BAA09488.2|  KIAA0139 [Homo sapiens]               35.4    2.3    UniGene infoGene info
gi|118124449|ref|XP_001235161.1|  PREDICTED: similar to trans-...  35.4    2.4    Gene info
gi|161958|gb|AAB97874.1|  surface antigen [Trypanosoma cruzi]      35.4    2.6  
gi|5921693|sp|Q05152|CAC1B_RABIT  Voltage-dependent N-type cal...  35.0    2.8  
gi|109094975|ref|XP_001117433.1|  PREDICTED: hypothetical protein  34.3    5.7    Gene info
gi|115462723|ref|NP_001054961.1|  Os05g0225800 [Oryza sativa (...  34.3    6.2    Gene info
gi|115462725|ref|NP_001054962.1|  Os05g0226000 [Oryza sativa (...  33.9    6.8    Gene info
gi|73999959|ref|XP_861013.1|  PREDICTED: hypothetical protein XP_  33.5    8.2    Gene info
gi|76625356|ref|XP_601217.2|  PREDICTED: similar to PHD finger pr  33.5    9.0    Gene info



>gi|118419244|gb|ABK87663.1|  conserved hypothetical protein [Bacillus thuringiensis str. Al 
Hakam]
Length=3588

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 62/227 (27%), Positives = 108/227 (47%), Gaps = 6/227 (2%)

Query  27    VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  86
             +  ++   +PE   E + +PE P + +  PE  +E + +P   +E + +PE   +   +P
Sbjct  3273  IKPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP  3332

Query  87    ERARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREP  146
             E  +E + +PE  K  + +P+  +E +  PE P+E   +P   +E +  P+  +E + +P
Sbjct  3333  EDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP  3392

Query  147   ERARGSQRGPERARENQGARESQSHRE--PEGPRGSQRKPAGARK---SPKTPKEPERAR  201
             E  +  +  PE  +E +   E     E  PE P+  + KP   ++    P+ PKEPE   
Sbjct  3393  EDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP  3452

Query  202   ESQREPERARESQREPERAresrkgprepgrgresqrAR-ESPGEPQ  247
             E  +EPE   E  +EPE   E  K P       +    + E P EP+
Sbjct  3453  EDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPE  3499


 Score = 45.1 bits (105),  Expect = 0.003, Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 67/184 (36%), Gaps = 41/184 (22%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EPE   E  +EPE   ++ + PE   E  +EP    E   EPE   +  +EPE   E   
Sbjct  3387  EPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPK  3446

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EPE       EP+   ED                           +E + +PE  +  + 
Sbjct  3447  EPEVKPEDPKEPEVKPED--------------------------PKEPEVKPEDPKEPEV  3480

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              PE               +P+ P      P      P+ PKEPE   E  +EPE   E  
Sbjct  3481  KPE---------------DPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3525

Query  215   REPE  218
             +EPE
Sbjct  3526  KEPE  3529


 Score = 43.1 bits (100),  Expect = 0.010, Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 0/132 (0%)

Query  30    RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  89
             ++   +PE   E + +PE P + +  PE  +E + +P   +E + +PE   +   +PE  
Sbjct  3396  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3455

Query  90    RESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERA  149
             +E + +PE  K  + +P+  +E +  PE P+E   +P   +E +  P+  +E + +PE  
Sbjct  3456  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3515

Query  150   RGSQRGPERARE  161
             +  +  PE  +E
Sbjct  3516  KEPEVKPEDPKE  3527


>gi|71666455|ref|XP_820186.1| Gene info trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70885521|gb|EAN98335.1| Gene info trans-sialidase, putative [Trypanosoma cruzi]
Length=1133

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 80/214 (37%), Gaps = 2/214 (0%)

Query  35   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
            EP+ AG    EP+  G     P+       EP  A     EP++      EP+ A     
Sbjct  756  EPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA  815

Query  95   EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
            E + A+    EPK A       +       EP  A      PK A     EP+ A     
Sbjct  816  ESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA  875

Query  155  GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
             P+ A E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+ A    
Sbjct  876  EPKSA-EPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKP  934

Query  215  REPERAresrkgprepgrgresqrARE-SPGEPQ  247
             EP  A      P+         ++ E  P EP+
Sbjct  935  AEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  968


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 96/247 (38%), Gaps = 10/247 (4%)

Query  11   SSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPE----RPGDNKRG-PEGTRESQRE  65
            +S +P G  P+   +  +      EP+ AG    EP+    +P + K   P+       E
Sbjct  742  TSSVPSGGAPSTPAEPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE  801

Query  66   PGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrre  125
            P  A     EP+       EP+ A     EP+ A++   EPK A      P+       E
Sbjct  802  PKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAE  861

Query  126  parareTQRGPKRARESQREPERARGSQRGPE----RARENQGARESQSHREPEGPRGSQ  181
            P  A      PK A     EP+ A     GP+    ++ E + A    +  +P  P+ ++
Sbjct  862  PKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE  921

Query  182  RKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrARE  241
             KPA  + +   P EP  A     EP+ A     EP+ A      P+         ++ E
Sbjct  922  PKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE  981

Query  242  -SPGEPQ  247
              P EP+
Sbjct  982  PKPAEPK  988


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 82/220 (37%), Gaps = 5/220 (2%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EP+ A     EP+        P+       EP  A     EP+       EP+ A   
Sbjct  799   SAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPK  858

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EP+ A+    EPK A      P+        P  A      PK A     EP+ A   
Sbjct  859   SAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPK  918

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
                P+    ++ E + A  + +  +P  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  919   SAEPKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  978

Query  209   RARESQREPERAresrkgprepgrgresqrARE-SPGEPQ  247
              A     EP+ A      P+         ++ E  P EP+
Sbjct  979   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  1018


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 79/223 (35%), Gaps = 4/223 (1%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EP+ A     EP+        P+       EP  A     EP+       EP+ A   
Sbjct  819   SAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  878

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EP+ A++    PK A      P+       EP  A      PK A     EP+ A  +
Sbjct  879   SAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPN  938

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
                P+    ++ E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  939   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  998

Query  209   RARESQREPERAresrkgprepgrgresqrARESPGEPQRTSQ  251
              A     EP+ A      P+          A  S        Q
Sbjct  999   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPNAATSSAREGTADQ  1041


>gi|66359950|ref|XP_627153.1| Gene info sushi-domain containing secreted protein [Cryptosporidium parvum 
Iowa II]
 gi|46228572|gb|EAK89442.1| Gene info sushi-domain containing secreted protein; with a signal peptide, 
low complexity region followed by a sushi domain [Cryptosporidium 
parvum]
Length=1006

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 89/189 (47%), Gaps = 2/189 (1%)

Query  28   TQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPE  87
            + +   ++PE +   + +P+ P  +++ PE ++  + +PG ++  +T+P  +     +P 
Sbjct  73   SSKSGESKPEESNLDKTKPKEPSPDEKKPEESKSDEAKPGESKSDETKPGESKSDETKPG  132

Query  88   RARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPE  147
             ++  + +P  +K+ + +P  ++ D+  P   +    +P   +  +  P+ A+  + +PE
Sbjct  133  ESKSDEAKPGESKSDETKPGESKSDETKPGESKSDESKPEETKPDETKPEEAKSEEAKPE  192

Query  148  RARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREP  207
              +  ++ PE ++  +   E   H E    +G+  +P        +  + +  +E + E 
Sbjct  193  ETKPDEKNPEESKPEETKPEEAKHDEENSGKGNSTEPKSLESIENS--KDDLKKEDKSED  250

Query  208  ERARESQRE  216
              A+ES  E
Sbjct  251  SSAKESTEE  259


 Score = 37.4 bits (85),  Expect = 0.73, Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 81/192 (42%), Gaps = 1/192 (0%)

Query  61   ESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpr  120
            E  +E   ++  +++PE ++    +P+     + +PE +K+ + +P  ++ D+  P   +
Sbjct  66   EQAKEQSSSKSGESKPEESNLDKTKPKEPSPDEKKPEESKSDEAKPGESKSDETKPGESK  125

Query  121  esrreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGS  180
                +P  ++  +  P  ++  + +P  ++  +  P  ++ ++   E     E + P  +
Sbjct  126  SDETKPGESKSDEAKPGESKSDETKPGESKSDETKPGESKSDESKPEETKPDETK-PEEA  184

Query  181  QRKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrAR  240
            + + A   ++    K PE ++  + +PE A+  +    +   +     E     +    +
Sbjct  185  KSEEAKPEETKPDEKNPEESKPEETKPEEAKHDEENSGKGNSTEPKSLESIENSKDDLKK  244

Query  241  ESPGEPQRTSQS  252
            E   E     +S
Sbjct  245  EDKSEDSSAKES  256


>gi|22209012|gb|AAC98688.2|  surface antigen PHGST#5 [Trypanosoma cruzi]
Length=796

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 60/238 (25%), Positives = 90/238 (37%), Gaps = 2/238 (0%)

Query  11   SSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRAR  70
            +S +P G  P+K  +  +      EP+ AG    EP+        P+       EP  A 
Sbjct  462  ASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAG  521

Query  71   ESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrreparar  130
                EP++      EP+ A     EP+ A+    EPK A      P+       EP  A 
Sbjct  522  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAE  581

Query  131  eTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKS  190
                 PK A     EP+ A      P+ A E + A    +  +P  P+ ++ +P   + +
Sbjct  582  PKPTEPKSAEPKPAEPKSAEPEPAEPKSA-EPEPAEPKSAEPKPAEPKSAEPEPTEPKSA  640

Query  191  PKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrARE-SPGEPQ  247
               P EP  A     EP+ A     EP+ A      P+  G       + E  P EP+
Sbjct  641  GPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPK  698


 Score = 45.1 bits (105),  Expect = 0.003, Method: Composition-based stats.
 Identities = 55/213 (25%), Positives = 79/213 (37%), Gaps = 2/213 (0%)

Query  36   PERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGE  95
            P  AG  Q +      +     G      EP  A     EP++      EP+ A     E
Sbjct  447  PATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAE  506

Query  96   PERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRG  155
            P+ A+    EPK A      P+       EP  A      PK A     EP+ A      
Sbjct  507  PKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAE  566

Query  156  PERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQR  215
            P+ A E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+ A     
Sbjct  567  PKSA-EPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPA  625

Query  216  EPERAresrkgprepgrgresqrARE-SPGEPQ  247
            EP+ A      P+  G       + E  P EP+
Sbjct  626  EPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPK  658


 Score = 43.1 bits (100),  Expect = 0.012, Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 69/183 (37%), Gaps = 1/183 (0%)

Query  35   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
            EP+ A     EP+        P+       EP  A     EP++      EP+ A     
Sbjct  526  EPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPT  585

Query  95   EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
            EP+ A+    EPK A  +   P+       EP  A      PK A     EP+ A G + 
Sbjct  586  EPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSA-GPKP  644

Query  155  GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
                + E + A    +  EP  P+ ++ +P   + +   P EP  A     EP+ A  + 
Sbjct  645  AEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAELNA  704

Query  215  REP  217
              P
Sbjct  705  TTP  707


 Score = 40.8 bits (94),  Expect = 0.065, Method: Composition-based stats.
 Identities = 51/197 (25%), Positives = 75/197 (38%), Gaps = 2/197 (1%)

Query  52   NKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGARE  111
            N+R    T+ +   P  A   QT+    + S      A     EP+ A+    EPK A  
Sbjct  433  NERVTTNTQPTVPSPATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGP  492

Query  112  DQraperpresrreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSH  171
                P+       EP  A      PK A     EP+ A      P+ A E + A    + 
Sbjct  493  KPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSA-EPKPAEPKSAE  551

Query  172  REPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepg  231
             EP  P+ ++ KPA  + +   P EP+ A     EP+ A     EP+ A      P+   
Sbjct  552  PEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAE  611

Query  232  rgresqrARE-SPGEPQ  247
                  ++ E  P EP+
Sbjct  612  PEPAEPKSAEPKPAEPK  628


 Score = 39.3 bits (90),  Expect = 0.18, Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 65/183 (35%), Gaps = 4/183 (2%)

Query  42   SQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKA  101
            +  +P  P     GP+ T ++              +       EPE A      P+ A+ 
Sbjct  438  TNTQPTVPSPATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEP  497

Query  102  SQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPE----  157
               EPK A      P+        P  A      PK A     EP+ A      PE    
Sbjct  498  KSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEP  557

Query  158  RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREP  217
            ++ E + A    +  +P  P+ ++ KP   + +   P EP+ A     EP+ A     EP
Sbjct  558  KSAEPKPAEPKSAEPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEP  617

Query  218  ERA  220
            + A
Sbjct  618  KSA  620


>gi|83317505|ref|XP_731189.1| Gene info hypothetical protein PY03200 [Plasmodium yoelii yoelii str. 17XNL]
 gi|23491150|gb|EAA22754.1| Gene info hypothetical protein [Plasmodium yoelii yoelii]
Length=542

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 69/124 (55%), Gaps = 0/124 (0%)

Query  31   DAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERAR  90
            DA  +P  A +++R+P    D KR P  + +++REP  A + + +P +++ + R+     
Sbjct  43   DAKRKPVLATDAKRKPVLATDAKREPASSTDAKREPASATDVKRKPASSTDAKRKSASTT  102

Query  91   ESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERAR  150
            +++ EP  A  ++ +P  A + +R      +++R+ A A + +R P  A +++REP  + 
Sbjct  103  DAKREPASATVAKRKPASATDAKRKSASATDAKRKSASAIDAKREPVLATDAKREPASST  162

Query  151  GSQR  154
             ++R
Sbjct  163  DAKR  166


 Score = 43.1 bits (100),  Expect = 0.011, Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 79/157 (50%), Gaps = 8/157 (5%)

Query  27   VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  86
            V+ +  A+E   A + +R+P    D KR P    +++R+P  A +++ EP +++ + REP
Sbjct  19   VSNKSFASELASATDVKRKPASATDAKRKPVLATDAKRKPVLATDAKREPASSTDAKREP  78

Query  87   ERARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREP  146
              A + + +P  +  ++ +     + +R P     ++R+PA A + +R    A +++R+ 
Sbjct  79   ASATDVKRKPASSTDAKRKSASTTDAKREPASATVAKRKPASATDAKRKSASATDAKRKS  138

Query  147  ERARGSQRGPERARENQGARESQSHREPEGPRGSQRK  183
              A  ++R P  A        + + REP     ++RK
Sbjct  139  ASAIDAKREPVLA--------TDAKREPASSTDAKRK  167


>gi|758803|gb|AAB70878.1|  peritrophin-95 precursor [Lucilia cuprina]
Length=480

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 0/76 (0%)

Query  32   AATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARE  91
            A T+PE +  +  EPE+       PE +  +  EP   + ++TEPE T+ +  EPE  + 
Sbjct  367  AKTDPEESTPATTEPEKSTPATTDPEKSTLATTEPEETKPTETEPEKTTPATTEPEETKP  426

Query  92   SQGEPERAKASQGEPK  107
            ++ EPE+   +  EP+
Sbjct  427  TETEPEKTTPATTEPE  442


 Score = 37.7 bits (86),  Expect = 0.44, Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 59/134 (44%), Gaps = 10/134 (7%)

Query  29   QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  88
            + + A   E A  ++   +     K  PE +  ++ +P  +  + TEPE ++ +  +PE+
Sbjct  334  KNNGACYLETATTTEEPSKESTPAKTDPEESTPAKTDPEESTPATTEPEKSTPATTDPEK  393

Query  89   ARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPER  148
            +  +  EPE  K ++ EP+          +   +  EP   + T+  P++   +  EPE 
Sbjct  394  STLATTEPEETKPTETEPE----------KTTPATTEPEETKPTETEPEKTTPATTEPEP  443

Query  149  ARGSQRGPERAREN  162
               +  G   A +N
Sbjct  444  VETTLDGKNPALDN  457

ORF finding

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

>ORF number 1 in reading frame 1 on the reverse strand extends from base 70 to base 825.
ATGGCCGGGCTTCGCCGTGCGCCATATGTGTCCTCAGGTTTACCTGTGGGCGAAATCCCG
GCTAAGCTTCTCGACTGCGTCACACAAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGA
GAGAGCCAGAGAGAGCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGA
GAGAGCCAGAGAGAGCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGC
AAGAGCTGGCGAGAGCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAA
GCAAGCCAGGGAGAACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGA
GAGAGCCGGAGGGAACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGA
GAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGA
GAGAACCAGGGAGCCAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGC
CAGAGAAAGCCAGCCGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCC
AGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCC
AGAGAGAGCCGGAAGGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGG
GAGAGCCCGGGAGAGCCGCAGAGAACCAGCCAGAGC

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MAGLRRAPYVSSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTR
ESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQRAPERPR
ESRREPARARETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGS
QRKPAGARKSPKTPKEPERARESQREPERARESQREPERARESRKGPREPGRGRESQRAR
ESPGEPQRTSQS

>ORF number 1 in reading frame 2 on the reverse strand extends from base 95 to base 826.
ATGTGTCCTCAGGTTTACCTGTGGGCGAAATCCCGGCTAAGCTTCTCGACTGCGTCACAC
AAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGAGAGAGCCAGAGAGAGCCAGAGAGAC
CCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGAGAGAGCCAGAGAGAGCCAGGGAGAG
CCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGCAAGAGCTGGCGAGAGCCAGAGAGAG
CCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAAGCAAGCCAGGGAGAACCAAAGGGAG
CCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGAGAGAGCCGGAGGGAACCAGCGAGAG
CCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAG
CCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGAGAGAACCAGGGAGCCAGAGAGAGCC
AGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGCCAGAGAAAGCCAGCCGGAGCCCGCA
AGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGA
GAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCGGAAGGGCCCAAGAG
AGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGGGAGAGCCCGGGAGAGCCGCAGAGAA
CCAGCCAGAGCC

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MCPQVYLWAKSRLSFSTASHKEMQPRSQKEPERARESQRDPETTKEGPKEPERARESQGE
PERAKQNQRPPARAGESQREPEKARENQRGPKQARENQREPERTRERQRDPERAGGNQRE
PEKPREGQREPERARESQREPEGAKEDQREPERTREPERARATESQRDPEGARESQPEPA
RARKPPKSQREPERARESQREPERARESQREPERAGRAQESQGEAERAKEPGRARESRRE
PARA

No ORFs were found in reading frame 3.