ORF NY16810

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160036.1
Annotathon code: ORF_NY16810
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : annomg
Annotated on : 2008-03-19 18:52:37
  • MACHI Marc
  • ZWOJSCZYKI Gael

Synopsis

Genomic Sequence

>AACY01160036.1 ORF_NY16810 genomic DNA
CTGGATTTCTAGAAGAAATTGCATCAGAAACGGTAAACTTCTCAAATAACTTTGACGGTTCACAAAAAGAACCAGATGTTCTTCCAGCTCAACTTCCGTT
TTTATTTTTGAACGGATCATCAGGAATTGCCGTTGGAATGGCAACTAATATCCCCCCTCACAACCTTGGAGAAATAGTAGATGCTTTAATTGCTTTAGTA
GAAAATAAAGATATAAATAATAAAAAACTCTCTAAAATAATTAAAGGACCTGATTTCCCTACTGGAGGAGAATTAATTAATAATCAAGCAATAGAGGAAC
TTTACGAAACTGGAAAAGGATCAGTAATAATAAGAGGGGTAATAAATAAAGAAGAAATAAATTTAGGCAAAGGTAAACACAAAAGAAATGCATTAATCAT
TACGGAACTTCCTTATCAAATTAGTAAAGCAGGTTGGATTGAAAAACTAGCTGAACTTGTTAATTCAAACAAAATCAATGGTATCGCTGATATTCGGGAT
GAAAGCGATAGAGATGGCATGAGAATTGTAATAGAGTTAAAAAAAGATTCTAATACTGAACTTGTAATTTCCAATTTATATAAAAAAACAACTCTCCAAA
CCAACTTTGGTGCAATATTTTTAACTTTAGTACAAGGGAAACCTGTTCAACTAAACTTAAAGCAATATCTTAACTATTTTCTTGAATTCCGAGAAGAAAC
TATTAGAAAAAGAACTGGTTATTTTCTAAAAAATACACTTGAAAAACTAGAAATATTAGAAGGTTTGTCTAAAGCAACAAAAGACATAAAAAGAATTATT
GAGATTATTGAAGAATCAGAAAATTCTGGAGAAGCAAAATCAAAACTAATTGA

Translation

[3 - 848/853]   direct strand
>ORF_NY16810 Translation [3-848   direct strand]
GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEEL
YETGKGSVIIRGVINKEEINLGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKKDSNTELVISNLYKKTTLQT
NFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYFLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

Voici l'arbre avec la méthode de NJ

           +-------------eubactérie 3   (Geobacillus kaustophilus HTA426)   
        +-22  
        !  +----------eubactérie 1      (Carboxydothermus hydrogenoformans Z-2901)   
     +-23  
     !  !  +-------------eubactérie 2   (Caldicellulosiruptor saccharolyticus DSM 8903)   
     !  +-18  
     !     +-------------gramplus1      (Symbiobacterium thermophilum IAM 14863) 
     !  
     !               +---GSbactérie 1   (Chlorobium tepidum TLS)  
     !  +-----------10  
  +-24  !            +---GSbactérie 2   (Chlorobium phaeobacteroides DSM 266)  
  !  !  !  
  !  !  !             +--------betaprotéobactérie 1    (Ralstonia metallidurans CH34)  
  !  !  !        +---11  
  !  !  !     +-16    +--------betaprotéobactérie 2    (Dechloromonas aromatica RCB) 
  !  !  !     !  !  
  !  !  !     !  +--------------gamaprotéobactérie     (Alcanivorax borkumensis SK2) 
  !  +-25  +-20  
  !     !  !  !               +--alphaprotéobactérie 4   (Rhodopseudomonas palustris CGA009)    
  !     !  !  !      +--------9 
  !     !  !  !      !        +---alphaprotéobactérie 3  (Rhodopseudomonas palustris BisA53)    
  !     !  !  +-----14  
  !     !  !         !  +--------------alphaprotéobactérie 2  (Caulobacter crescentus CB15)    
  !     !  !         +-13  
  !     !  !            +-------------alphaprotéobactérie 1   (Roseobacter denitrificans OCh 114)    
  !     !  !  
  !     +-21                    +GNSbactérie 1  (Dehalococcoides sp. CBDB1)  
  !        !  +-----------------7 
  !        !  !                 +GNSbactérie 2  (Dehalococcoides ethenogenes 195)  
  !        !  !  
  !        !  !                          +ORF   
  !        !  !                 +--------4 
  !        !  !                 !        !      +--------cyanobactérie 2         (Prochlorococcus marinus subsp. pastoris str. CCMP1986 )    
  !        !  !                 !        +------1         
  !        !  !                 !               +--------cyanobactérie 1         (Prochlorococcus marinus str. MIT 9312)    
  !        +-19       +---------8 
  !           !       !         !         +-----------cyanobactérie 5            (Prochlorococcus marinus subsp. marinus str. CCMP1375)    
  !           !       !         !     +---5 
  !           !       !         !     !   +------------cyanobactérie 3           (Prochlorococcus marinus str. NATL2A)    
  !           !       !         +-----6 
  !           !   +--12               !       +-------cyanobactérie 7            (Synechococcus sp. CC9902)    
  !           !   !   !               !     +-2 
  !           !   !   !               +-----3 +------cyanobactérie 6             (Synechococcus sp. WH 7805)    
  !           !   !   !                     ! 
  !           +--15   !                     +--------cyanobactérie 4             (Prochlorococcus marinus str. MIT 9313)    
  !               !   !  
  !               !   +------------------------------cryptomonads     (Guillardia theta)      
  !               !  
  !               +-----------------------eudicots   
  !  
 17-------------euryarchaeote 1    (Methanosarcina mazei Go1)  
  !  
  +--------------euryarchaeote 2   (Methanosaeta thermophila PT)  



La représentation de l'arbre par parcimonie n'a pu être mise en évidence ici car   il y a eu des problemes dans le copier coller ... (arbre trop grand). Néanmoins, les résultats sont très semblables entre les deux méthodes.

Annotator commentaries

Pour commencer, on pourra dire que le poids moléculaire de la protéine que nous avons calculé n'est pas à prendre en considération car celui ci sera erroné étant donné que nous n'avons ni la méthionine ni le codon stop.

L'analyse des domaines protéiques laisse supposer que la protéine que nous étudions est une Topoisomérase de type IIA. Les ADN topoisomérases sont des enzymes qui contrôlent la structure topologique de l’ADN en générant des coupures transitoires dans l’ADN et en catalysant le passage des segments d’ADN à travers ces coupures avant de les refermer. Elles permettent notamment d'ajouter ou d'enlever des supertours dans les molécules d'ADN. Elles jouent un rôle essentiel lors de nombreuses étapes de la vie cellulaire (réplication, transcription, séparation des chromosomes, etc.). Ici nous avons peut être un type II, et le type II est spécialisé dans les cassures doubles brins.

Le blast a été fait contre la banque NR. En effet, les résultats avec la banque swissprot étaient bons mais ceux avec NR étaient meilleurs(NR SCORE MAX>400 VS SWISSPROT~200) Au vu des résultats des deux analyses phylogénétique (NJ et Parcimonie), nous pouvons dire que notre ORF se trouve très proche des séquences codées par des cyanobactéries (surtout des prochlococcus marinus)

Prochlorococcus est un genre de cyanobactérie marine photosynthétique. Sa taille est d'environ 0,6 μm et appartient au bactérioplancton. Elle a été découverte en Mer des Sargasses en 1986 par S.W. Chisholm et R.J. Olson. Entre 40°N et 40°S, on la trouve sur l'ensemble de la zone euphotique des océans (zone exposée à une lumière suffisante pour que la photosynthèse se produise pouvant aller jusqu'à 200 m dans les milieux les plus oligotrophes) à des densités de l'ordre de 100 000 cellules par millilitre. Elle disparaît aux latitudes plus élevées, sans doute à cause de conditions de température trop basse. Ces caractéristiques en font sans doute l'organisme le plus abondant sur Terre.


Le groupe d'étude sont les cyanobactéries et le groupe extérieur est composé d'euryarchaeotes , d'eudicots et de cryptomonads . Nous nous apercevons que quelques soit l'organisme qui permet de raciner l'arbre il y a toujours un des organismes du groupe extérieur qui dans l'arbre se trouve à l'intérieur du groupe d’étude. On peut en déduire qu'il s'agirait d'un transfert de gène entre des groupes de bactéries différentes. Il s'agirait dans ce cas de Xénologues .

Après avoir vérifié sur le site de swissprot , on peut en effet proposer un symbole gène qui est " gyrA " .


Multiple Alignement

Format CLUSTALw :

                     10        20        30        40        50        60
                      |         |         |         |         |         |
eubact1      ------------------------------------------------------------
eubact3      ------------------------------------------------------------
gramplus1    ------------------------------------------------------------
eubact2      ------------------------------------------------------------
eury1x23     ------------------------------------------------------------
eury2x24     ------------------------------------------------------------
gs1xxx19     ------------------------------------------------------------
gs2xxx20     ------------------------------------------------------------
beta1x16     ------------------------------------------------------------
beta2x17     ------------------------------------------------------------
gama1x18     ------------------------------------------------------------
alpha3       ------------------------------------------------------------
alpha4       ------------------------------------------------------------
alpha2       ------------------------------------------------------------
alpha1       ------------------------------------------------------------
gns1xx21     ------------------------------------------------------------
gns2xx22     ------------------------------------------------------------
eudi1x25     MKLHTLNPQTPLTQSKPMAFSTGITPSRFSGLRKTSSELRFLSSVTPPPRKQLRPVSARR
ORFxxx0      ------------------------------------------------------------
cyano1       ------------------------------------------------------------
cyano2       ------------------------------------------------------------
cyano3       ------------------------------------------------------------
cyano5       ------------------------------------------------------------
cyano6       ------------------------------------------------------------
cyano7       ------------------------------------------------------------
cyano4       ------------------------------------------------------------
crypto       -------------------------MIRVQSILFNCILKKGFIFNLGENKNFVDKFNRNV
                                                                         
Prim.cons.   MKLHTLNPQTPLTQSKPMAFSTGIT22R22222222222222222222222222222222

                     70        80        90       100       110       120
                      |         |         |         |         |         |
eubact1      -----------------------MFSIGKVLPVKLEEEMKSSYLDYAMSVIVGRALPDVR
eubact3      ---------------------MAEHEQPRIREVNISQEMRSSFLDYAMSVIVSRALPDVR
gramplus1    ---------------------MAGDFAQRILTKEIKHEMETSYLTYSMSVIVGRALPDVR
eubact2      ----------------------MEEFDFRIIPVEIQEEMKRSYIDYAMSVIVSRALPDVR
eury1x23     ------------MDTGPEEPEDEEPVRAGVTPILIDDEMKRSYINYAMSVIVGRALPDAR
eury2x24     ---------------------------MAEIDVDVTEEMKSSYIDYAMSVIVGRALPDVR
gs1xxx19     ------------------------MQREKILPISIEEEMRDSYLDYSMSVIVSRALPDVR
gs2xxx20     ------------------------MQRERILPISIEEEMRDSYLDYSMSVIVSRALPDVR
beta1x16     ----------------------MDQFAKETLPVSLEEEMRRSYLDYAMSVIVGRALPDVR
beta2x17     ----------------------MDQFAKETLPISLEDEMRRSYLDYAMSVIVGRALPDAR
gama1x18     ----------------------MTDLAREVTPVNIEDELKQSYLDYAMSVIVGRALPDVR
alpha3       ----------MPLSDTDDRKPGEPPAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDAR
alpha4       --------------------------------------MKRSYLDYAMSVIVARALPDAR
alpha2       ------------MSDDHNTIPADGSR-GDIAPINIEDELRRSYLDYAMSVIVSRALPDAR
alpha1       --------------MRPERPVYDGPS------VSIEQEMRTSYLDYAMSVIVSRAIPDLR
gns1xx21     ------------------------MVTGNTRPINIEDEMKGSYLDYAMSVIVSRALPDVR
gns2xx22     ------------------------MVTGNTRPINIEEEMKGSYLDYAMSVIVSRALPDVR
eudi1x25     KEEEVGDEGNGSVILRDRGENEDRNGGERVVLTELHKEATEAYMSYAMSVLLGRALPDVR
ORFxxx0      ------------------------------------------------------------
cyano1       ------------------------MDKKKFTSISLQEEMQRSYLEYAMSVIVGRALPDAR
cyano2       ------------------------MTKEKFTSISLQEEMQRSYLEYAMSVIIGRALPDAR
cyano3       ------------------------MAKERLKPISLHQEMQRSYLEYAMSVIVGRALPDAR
cyano5       ------------------------MAKERFQPISLHQEMQRSYLEYAMSVIVGRALPDAR
cyano6       ------------------------MAEERVQPIALHQEMQRSYLEYAMSVIVGRALPDVR
cyano7       --------------------------------------MQRSYLEYAMSVIVGRALPDAR
cyano4       ------------------------MAEERLQPIALHQEMQRSYLEYAMSVIVGRALPDAR
crypto       KFSKFLIFSSYSSENNGSIKVKYTNDKTRIINTELQNEMAKSYMEYALSVIYGRALPDIR
                                                                         
Prim.cons.   K2222222223SMSDR2ER22MM2MAKERILPISIEEEMKRSYLDYAMSVIVGRALPDVR

                    130       140       150       160       170       180
                      |         |         |         |         |         |
eubact1      DGLKPVHRRILYAMHILGMTPDKPHRKSAHIVGEVLGKFHPHGDVAVYDAMVRMAQDFST
eubact3      DGLKPVHRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNY
gramplus1    DGLKPVQRRILYAMYESGNTADKPFRKSAKTVGDVLSKYHPHGDAAVYDTMVRMAQDFVL
eubact2      DGLKPVHRRILYAMNEIGLTPDKPYRKSATVVGHVLAKYHPHGDAAVYESLVRMAQDFSM
eury1x23     DGLKPVHRRILFSMNESGITHDKPYKKSARIVGDVLGKYHPHGDSAVYDTIVRMVQDFSL
eury2x24     DGLKPVHRRILYAMYEQGVTFDQPYKKSARIVGDVMGKYHPHGDVAIYDTMVRMAQDFSM
gs1xxx19     DGLKPVHRRVLYGMHELGLQAGKPYKKSARVVGEVLGKYHPHGDSAVYDSLVRMVQDFSL
gs2xxx20     DGLKPVHRRVLYGMHELGLQAGKPHKKSARIVGEVLGKFHPHGDTAVYDSLVRLVQDFSM
beta1x16     DGLKPVHRRVLFAMHELNNDWNRPYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQNFSL
beta2x17     DGLKPVHRRVLFAMHELNNDWNKAYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSL
gama1x18     DGLKPVHRRVLFAMHELNNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSL
alpha3       DGLKPVHRRILFGMYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDAMVRMAQDFSM
alpha4       DGLKPVHRRILYGMYENGFEWNKQYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSM
alpha2       DGLKPVHRRVLFSMHEQGQTPERPYVKSARVVGDVMGKYHPHGDASIYFTLVRMTQSFSM
alpha1       DGLKPVHRRILFAMHETGNTHDKPYRKSARPVGDVMGQYHPHGDSAIYDALVRMAQDFSM
gns1xx21     DGLKPVQRRILYAMNDLGMKHNTPYKKSARIVGEVLGKYHPHGDSSVYDAMVRMAQPFSY
gns2xx22     DGLKPVQRRILYAMNDLGMKHNTPYKKSARIVGEVLGKYHPHGDSSVYDAMVRMAQPFSY
eudi1x25     DGLKPVHRRILYAMHELGLSSKKPYKKCARVVGEVLGKFHPHGDTAVYDSLVRMAQDFSL
ORFxxx0      ------------------------------------------------------------
cyano1       DGLKPVQRRILFAMYELGLTPDKPFRKCARVVGDVLGKYHPHGDQAVYDALVRLVQNFST
cyano2       DGLKPVQRRILFAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYEALVRLVQDFST
cyano3       DGLKPVQRRILFAMHELGLTPERPYRKCARVVGDVLGKYHPHGDQAVYDALVRQVQVFNS
cyano5       DGLKPVQRRILYAMHELGLTPERPFRKCARVVGDVLGKYHPHGDQAVYDALVRLVQSFSS
cyano6       DGLKPVQRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFSS
cyano7       DGLKPVQRRILYAMQELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFAS
cyano4       DGLKPVQRRILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQNFSS
crypto       DGLKPVHRRILFAMYELNLVPEAPYRKCARVVGEVLGKYHPHGDTAVYDSLVRMSQEFSM
                                                                         
Prim.cons.   DGLKPVHRRILYAMHELGLTPDKPYRKSARVVGDVLGKYHPHGDQAVYDALVRMAQDFSM

                    190       200       210       220       230       240
                      |         |         |         |         |         |
eubact1      RYPLIDGHGNFGSVDGDSAAAMRYTEARMAKITV-EMLRDIDKETVDFMPNYDNSTKEPV
eubact3      RYMLVDGHGNFGSIDGDAAAAMRYTEARMSKIAM-ELLRDINKDTIDYQDNYDGSEKEPV
gramplus1    RYPLVEGQGNFGSIDGDPPAAMRYTEARLSRLAH-EMLADIEKNTVDFEDNYDNSEKEPT
eubact2      RHPLVDGHGNFGSVDGDPPAAMRYTEARMSKIAI-EMLRDIEKETVDFMPNFDESAKEPK
eury1x23     RYPLIDGQGNFGSIDGDSAAAMRYTEVRMDRIAE-EMLVDIEKETVPFIPNYDGSLKEPE
eury2x24     RYTLIDGQGNFGSVDGDPPAAMRYTEVRLSKIAG-EMLADIEKDTVDFVPNYDGSLKEPT
gs1xxx19     RYPLIDGQGNFGSVDGDSPAAMRYTEVRMKAIAG-EMLKDLDKETVDFSLNFDDSLEEPT
gs2xxx20     RYPLIDGQGNFGSIDGDSPAAMRYTEVRMKAIAG-EMLKDLDKETVDFSLNFDDSLEEPT
beta1x16     RYMLVDGQGNFGSVDGDNAAAMRYTEIRLSKIAH-EMLQDIDKETVDFEPNYDGSEKEPG
beta2x17     RYMLVDGQGNFGSVDGDSAAAMRYTEVRMAKIGH-QMLEDLDKETVDFGPNYDGSENEPL
gama1x18     RYMLVDGQGNFGSIDGDSAAAMRYTEVRMAKIAH-ELLADLDKETVDFVDNYDGTERIPD
alpha3       RVPLIDGQGNFGSVDGDAPAAMRYTESRLTKIAQ-LLLDDLDKDTVDYQDNYDGSFREPR
alpha4       RVPLIDGQGNFGSVDGDMPAAMRYTESRLTKIAQ-TLLDDIDKDTVDFQPNYDNSEREPQ
alpha2       GLVLIDGQGNFGSVDGDMPAAMRYTECRMAPPAM-ALLADLDKDTVDFADNYDGKEQEPT
alpha1       SLPLLDGQGNFGSMDGDNPAAMRYTEVRMDKPAA-YLLADIDKDTVDFQDNYDGKQKEPT
gns1xx21     RYPLVDGQGNFGSVDNDPAAAMRYTEARLAQIAE-HLLADIDKNTVDFMPNFDSSLEEPT
gns2xx22     RYPLVDGQGNFGSVDNDPPAAMRYTEARLAQIAE-QLLTDIDKNTVDFMPNFDASLEEPT
eudi1x25     RSPLIRGHGNFGSIDADPPAAMRYTECRLEALTESMLLADLEQNTVDFVPNFDNSQKEPS
ORFxxx0      -----------------------------------GFLEEIASETVNFSNNFDGSQKEPD
cyano1       KYPTLDGHGNFGSVDNDPPAAMRYTETRLAPISHKGFLEEIDSETVNFSNNFDGSQKEPD
cyano2       KYPTLDGHGNFGSVDNDPPAAMRYTETRLAPIAHECFLQEIGSETVSYSNNFDGSQQEPD
cyano3       RYPILDGHGNFGSIDDDPPAAMRYTETRLAPISNDAILSEIDQETVDFSPNFDGSQQEPD
cyano5       RYPVLDGHGNFGSIDDDPPAAMRYTETRLAPIANQALLNEIDDKTVDFSQNFDGSQQEPD
cyano6       RHPLLDGHGNFGSVDDDPPAAMRYTETRLAPIAHEGLLDEIGNDTVDFANNFDGSQQEPT
cyano7       RHPLLDGHGNFGSVDDDPPAAMRYTETRLAPIAHQALLEEIGDDTVDFASNFDGSQQEPT
cyano4       RFPVLDGHGNFGSVDDDPPAAMRYTETRLASIAHMALLDEIGEETVDFTANFDGSQQEPS
crypto       RKVLILGHGNFGSIDHDPPAAMRYTECKLSNLSVDTLLKELDFKTVEYVYNFDGSSIEPS
                                                 :* ::  .*: :  *:* .   * 
Prim.cons.   RYPLIDGQGNFGSVDGDPPAAMRYTE2RLAKIAH3ELLADIDKETVDFSPNFDGSQKEPT

                    250       260       270       280       290       300
                      |         |         |         |         |         |
eubact1      VLPSRIPNLLVNGSSGIAVGMATNIPPHNLREVIDGVVKMIDDPEVEIGELMKIIKGPDF
eubact3      VLPSRFPNLLVNGSSGIAVGMATNIPPHQLGEVIDALLALSQNPEMTVADLMEYIPGPDF
gramplus1    VLPSRFPNLLVNGSTGIAVGMATNIPPHNLGEVIDGIIRLIDQPDISIEELNRIIKGPDF
eubact2      VLPSRFPNLLVNGSQGIAVGMATNIPPHNLAEVIDAIVYLLDNENAGLDDIMKIIKGPDF
eury1x23     VLPARLPNLLINGSTGIAVGMATNMPPHNISEVIDGILMLIENPETQISELMTVIKGPDF
eury2x24     VLPSRLPNLLVNGSTGIAVGMATNIPPHNLREVVYALIHLIENPDASVTDLMNFIRGPDF
gs1xxx19     VLPAAIPNLLVNGASGIAVGMATNIPPHNMREVVSGLIALIENPEIEIGDLMKHVTAPDF
gs2xxx20     VLPSAIPNLLVNGSSGIAVGMATNIPPQNLREVVDGIIALIENPDIEIADLMKHVIAPDF
beta1x16     ILPARIPNLLINGSSGIAVGMATNIPPHNLNEVVDACLHLLRNPDATVDELIELVPAPDF
beta2x17     VMPARIPNLLINGSSGIAVGMATNIPPHNLNEVIAGCLALLENPALSIEDLIAYIPAPDF
gama1x18     VMPTRVPNLLVNGSSGIAVGMATNIPPHNLGEVVDGCLALIDDDSLTPDDLMEYIKGPDF
alpha3       VLPAKFPNLLVNGAGGIAVGMATNIPPHNLGEVIDACVALIEDPALSIDDLSKIIPGPDF
alpha4       VLPAKFPNLLVNGAGGIAVGMATNIPPHNLGEVIDACIALIDDPALSIDDLNKIVPGPDF
alpha2       VLPSRIPNLLVNGAGGIAVGMATNIPPHNLGEVIDACLLLIDQPDVTTDQLLDLVPGPDF
alpha1       VLPARFPNMLVNGAGGIAVGMATNIPPHNLGEVIDATLALIEEPDLTSEQLIDYVPGPDF
gns1xx21     VLPARIPNLLMNGSSGIAVGMATNIPPHNLAELCQAICYLIDNPDCGVDELMQFVSGPDF
gns2xx22     VLPARIPNLLMNGSSGIAVGMATNIPPHNLAELCQAICYLIDNPDCGVDDLMQFVSGPDF
eudi1x25     LLPARVPNLLLNGASGIAVGMATNIPPHNLGELVDALSALIHNPEATLQELLEYMPGPDF
ORFxxx0      VLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDALIALVENKDINNKKLSKIIKGPDF
cyano1       VLPAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVDGLIALINNKEVSNKKLSNIIKGPDF
cyano2       ILPAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVDGLIALINDKEISDLRLSKIILGPDF
cyano3       VLPAQLPFLILNGSTGIAVGMATSIPPHNLNEVVEALIAIIKKPSLNEEKLLEIIPGPDF
cyano5       VLPAQLPFLVLNGCSGIAVGMATNIPPHNINEIINGLIALIKKPELSEDKLIEIIPGPDF
cyano6       VLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALVREPDLSNDKLLKLIPGPDF
cyano7       VLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALIRQPGLSDERLLELIPGPDF
cyano4       VLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALIRKPDLSDDKLLGLIPGPDF
crypto       IMPSVIPSILLNGSSGIAVGMATSIPPHNLGEIVRSCLALIDNYNITNQELIKYLPCPDF
             ::*: .* :.:**. ********.:**::: *:  .   :  .       :   :  ***
Prim.cons.   VLPARLPNLLVNGSSGIAVGMATNIPPHNLGEVVD2LIALIDNPDLSIDDLMKIIPGPDF

                    310       320       330       340       350       360
                      |         |         |         |         |         |
eubact1      PTGGKIMGRQGIRQAYTTGRGTIKVRAVTTFEKLSGGK-----TAIIVTELPYQVNKAKL
eubact3      PTAGQIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGK-----ETIIVTELPYQVNKAKL
gramplus1    PTGALILGHEGIRRAYQTGKGSITLRARTQIETLQNGR-----NRIVVTELPYGVNKAKL
eubact2      PTGGYIIGKKGIRDAYATGKGKIIVRAKATIEQTSKGR-----QRIVVTELPYMVNKARL
eury1x23     PTGAHILGTAGIRSAYMTGRGPIRMRAVAEIQELKKDR-----QQIIVTELPYQVNKAKL
eury2x24     PTGGYIVGRSGIESAYSTGRGTITIRARSEIEEGRRG------SRIIFTELPYQVNKAKV
gs1xxx19     PTGGIIYGYEGVRQAYLTGRGKVVIRARAVVEVTQKNG----RESIIVTELPYQVNKVRL
gs2xxx20     PTAGIIYGYEGVKQAYLTGRGKVVIRARALVEVTQKNG----RESIIVTELPYQVNKVRL
beta1x16     PTAGIIYGIQGVREGYRTGRGRVVMRARTHFEDIDRGQ----RQAIIVDELPYQVNKRTL
beta2x17     PTAGLIYGMTGVREGYQTGRGRVIMRARTHFEDMEKSN---GRQALIVDEIPYQVNKKSL
gama1x18     PTAGIINGRAGIVQAYRTGRGRVYMRARAEIEATDKSG----KEAIIVTEIPYQVNKARL
alpha3       PTGGIILGRAGIRLAYHTGRGSIVMRGKVSIEPARKDR-----EAIIISEIPYQVNKATM
alpha4       PTGGIILGRAGIRAAYQTGRGSIVMRGKVEIETVRKDR-----EAIIVSEIPYQVNKATM
alpha2       PTGGEIIGRAGPRQALLTGRGSVIMRGVASVEELRAGR-----EAIIVTEIPYQVNKANL
alpha1       PTGGIMLGRGGARKAYLEGRGSVIIRAKTRVEEIRKDR-----WAIIVDEIPYQVNKATM
gns1xx21     PTGGTILGTDGIKSAYATGKGKIVIQAKAHIGEVETRK------AIFVTEIPYQVNKAEL
gns2xx22     PTGGTILGTDGIKSAYATGKGKIVIQAKAHIGEVDNRK------AIFVTEIPYQVNKAEL
eudi1x25     PTGGIIMGNIGILEAFRTGRGRVVIRGKTDIELLDSKT---KRAAIIIQEIPYQTNKASL
ORFxxx0      PTGGELINNQAIEELYETGKGSVIIRGVINKEEINLGKGKHKRNALIITELPYQISKAGW
cyano1       PTGGELIYSRAIEELYATGKGSITIRGVINSEAINLGKGKHKRNALIITELPFQISKAGW
cyano2       PTGGELICNSAMNEVYLQGRGSVTVRGVIKNEEINLGKGRHKKNALIISELPYQISKAGW
cyano3       PTGGEILVSNGIKETYTKGRGSITMRGIARIEEINPGKGKHKRSGIIISELPYQLNKASW
cyano5       PTGGEILLSNGIKETYLKGKGSIPMRGITHIEEINPGKGKHRKKGIVITELPYQVNKAAW
cyano6       PTGGEVLLGSGVRDTYLRGRGSIPMRGVAHVEEVQLGKGRHKRNAVIVTELPYQLSKAGW
cyano7       PTGGEVLLSSGLQDTYLQGRGSIPMRGVAHTEEVQLGKGRHKRNAVVVTELPYQLSKAGW
cyano4       PTGGEILLGTGIHETYLKGRGSIPMRGVAHVEEIQPGKGRHRRSAVVVTELPYQLSKAGW
crypto       PTGGLIIGNNSCKDLYEKGISSIILRGKINVEFSKSVKKVSKYN-LIITEIPFQINKSML
             **.. :    .       * . : ::.                  :.. *:*:  .*   
Prim.cons.   PTGGEILGR2GIREAYLTGRGSIVMRA2AHIEEIQKGKG2HKR2AIIVTELPYQVNKAGL

                    370       380       390       400       410       420
                      |         |         |         |         |         |
eubact1      IEKIAELVRDKKIDGIADLRDESDRKGMRIVIELKRDANPQVVLNQLFKHTQLQDTFGII
eubact3      IERIAELVRDKKIDGITDLRDESDRSGMRIVIEVRRDANAKVVLNNLYKHTALQTSFGIN
gramplus1    IERIAELHRDRKIDGITDLRDESDRSGLRIAIELRRDANPHVILNQLFKYTALQQNFGII
eubact2      IEKIAELVHEKRIDGISDIRDESDKEGLRIVIEIKKDADANVVLKQLYKNTQLQDSFGII
eury1x23     IENIAQLVREKVINGISDLRDESDREGIRVVVELSRGVNPNVVLNQLYKHTQMATTFGVI
eury2x24     VEDIAELVKAGRVDGISEIRDESDREGIRLVVELKQGVNPQVVLNQLHKHTQLETTYGII
gs1xxx19     IEKIVELVHDKKVEGIADIRDESDREGMRLVIELKRDAVAKVVLNNLYKHTPMQDTFGVI
gs2xxx20     IEKIVELVHDKKLEGIADIRDESDRDGMRLVIELKRDAVAKVVLNNLYKHTPMQDTFGVI
beta1x16     LERIAELVTEKKVEGISDIRDESDKSGMRVVIELKRNEVPEVVLNNLYKNTQLQDTFGMN
beta2x17     IEKIAELVNEKKIEGISDIRDESDKSGMRIVIELKRGEVGEVILNNLYKQTQLQDTFGMN
gama1x18     IEKIAELVKDKKIEGITELRDESDKEGMRIVIELRRGENAEVVLNNLYQQTQMESVFGIN
alpha3       VERIAELVREKKIEGISDLRDESDRDGFRVVIELRRDAVADVVLNQLYRFTPLQTNFGAN
alpha4       VERIAELVREKKIEGIGDLRDESDRDGFRVVIELRRDAVPEVVLNQLYKFTPLQTNFGAN
alpha2       VEHIAELVRDKKIEGVADIRDESNRDGMRIVVELKRDASGEVILNQLYRFTALQSSFGVN
alpha1       IEKIAEQVREKKIDGIAHVQDESDRNGVRVVIELKRDATAEVVMNQLYRFTPLQTYFGCN
gns1xx21     VAKIAELVKERKVTGISDLRDESDRQGMRVVIELKRDAEPQQVLNSLYKHTNMRTSFFVN
gns2xx22     VVKIAELVKDRKIVGISDLRDESDRQGMRVVIELKRDAEPQQVLNSLYKHTNMRTSFFVN
eudi1x25     VEKIADLVENKILEGVSDIRDESDRSGMRIVIELKRGSDPAIVLNNLYRLTALQSSFSCN
ORFxxx0      IEKLAELVNSNKINGIADIRDESDRDGMRIVIELKKDSNTELVISNLYKKTTLQTNFGAI
cyano1       IEKLAELVNSSKINGISDIRDESDRDGMRIVIELKKDSNAELVISNLYKKTTLQTNFGAI
cyano2       IEKLAELVNLGKIDGISDIRDESDRDGMRVVIELKKDSNSEIVVSNLFKKTALQSNFGAI
cyano3       IEKLADLVNNGKISGIADIRDESDRDGMRILVEVKRDSDPKKILDFLYQKTSLQSNFGAI
cyano5       IEKLADLVNNSKIDGIADIRDESDRDGMRIVIELRRDIDHEIVKDTLYQKTNLQNNFSAT
cyano6       IEKLAEQVNDGKIGGIADIRDESDREGMRVVVELRRDADPDAVLKDLQRRTSLQSNFGAI
cyano7       IEKLAESVNDGKIGGIADIRDESDRDGMRVVVELRRDAEPEKVLKDLQRRTALQSNFGAI
cyano4       IEKLADLVNNGKIGGIADIRDESDREGMRIVVELRRDANPENVLGDLHRRTSLQSNFGAI
crypto       IAKLADLVNSKIIQGISDIRDESDRKGIRIVIEIKRDYDPIKIVKIILKKSSLQITFSSY
             :  :.:      : *: .::***::.*.*: :*: :.     :   : : : :   :   
Prim.cons.   IEKIAELVNDKKIEGISDIRDESDRDGMRIVIELKRDANPEVVLNNLYKHTQLQTNFGAI

                    430       440       450       460       470       480
                      |         |         |         |         |         |
eubact1      MLALVDNQPRILNLKEILFYYLEHQKDVVTRRTRYDLNKAEERAHILEGLKIALANLDEV
eubact3      MLALVNGEPKVLNLKECLEHYLNHQKTVIRRRTAFELKKAEARAHILEGLRIALDHLDEV
gramplus1    MLALVENRPRLLNLKQMLHYYLQHQLEVIVRRTQFDLQKALDRAHILEGLLKALDIIDEV
eubact2      MLALVDNQPKVLTLLDMLNYYIEHQKDVIVRRTKYDLKKAEERAHILEGLKKALDHIDEI
eury1x23     NLALVDGKPKELNLKQLLEIYLEYRMEIIQKRTLYDLRKSEERAHILEGLRIALDNIDAV
eury2x24     NLVLVDGQPRTLTLKETLEQYINYRAEVIERRTRFELEQAEKRAHILAGILIALRDIDEV
gs1xxx19     MLALVDGVPRVLNLKEMMQYYIRHRNEIVLRRTQYDLNAAEKRAHILEGLKICLDNLDEV
gs2xxx20     MLALVDGMPRVLNLKQMMEYYIRHRNEIVLRRTQYDLTAAEKRAHILEGLKICLDNLDEV
beta1x16     MVALVDGQPRLLNLRQMLDAFLSHRREVVTRRTVFELRKARERGHVLEGLAVALANIDEF
beta2x17     MVALVDGQPRLLNLKQMLECFLSHRREVITRRTVYELRKARERGHILEGLAVALSNVDEI
gama1x18     TVALVDGQPKILNLRELLDAFIRHRREVVTRRTVYELRKAREKAHLLEGLAVALSNIDPV
alpha3       MVALDAGRPLLMNLKDLLTLFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEI
alpha4       MVALEGGRPQLMNLKDLLTVFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEI
alpha2       MLALNRGRPEQMGLHQLIQLFVDFREEVVVRRTKFELGKARDRGHVLVGLTIAVANIDEF
alpha1       MLALNGGRPEQLTLRKFLTYFIDFREDVVARRTAYLLRKARERSHVLCGLAVAVTNIDEV
gns1xx21     MLALVDGQPQVLSLKEVLKNFIDFRHLIITRRSQFELKAAKDRAHILEGLKKALDFIDRI
gns2xx22     MLALVDGQPQVLSLKEVLKNFIDFRHLIITRRSQFELKAAKDRAHILEGLKKALDFIDRI
eudi1x25     MVGILNGQPKLMGLKELLQAFLDFRCSVVERRARFKLSQAQERNHIVEGIIVGLDNLDEV
ORFxxx0      FLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYFLKNTLEKLEILEGLSKATKDIKRI
cyano1       FLALIKGKPVQLNLKQYLNYFLEFREETIRKRTNYFLKNTLEKLEILEGLSKATKNIKKI
cyano2       FLALVDGKPIQLTLRKYLNYFLEFREETIRKRTKYFLRIASEKFEILEGFSIATKNIKDI
cyano3       LLALVNGQPVQLTLKKLLNNFLEFRENTILLRSNYLLKNIKNREEIVDALIQATNNVKKV
cyano5       LLALVNGQPKQLSLKRLLIIFLEYRELTIRKRTKNKLKQTLARLEILEGLIKALKNLKKV
cyano6       MLALVDGQPQQLSLRQLLQTFLDYRELTLIRRTTHALRKAEDRLEVVEGLITALQSLQRV
cyano7       LLALVNGQPQQLSLRQLLQTFLDYRELTLIRRTSHALRKTEDRLEVVEGLITALNNLQAV
cyano4       LLALVNGQPQQLSLRKLLQTFLEYRELTVIRRTNHALEKTKARLEVVEGLITALNALQAV
crypto       MLCIVDKQPILVNLKEILSLFLHFRRKIIRKNIKFELKNILKKKNILKGISISLEKIDLT
              : :    *  : *   :  :: .:   :  .    *     : .:: .:      :.  
Prim.cons.   MLALVDGQPRQLNLKQLLQYFLEFREEVITRRTKYELKKAEERAHILEGL3IALDNIDEV

                    490       500       510       520       530       540
                      |         |         |         |         |         |
eubact1      IKIIRGSKDVDTAREGLMSR----------------------------------------
eubact3      IDLIRRSQTTEAAREGLMAR----------------------------------------
gramplus1    INTIRSSPTTDEARSRLMSN----------------------------------------
eubact2      ISIIRSSRTVNEAKERLIKR----------------------------------------
eury1x23     VALIKGSANADQAKQGLIDN----------------------------------------
eury2x24     IALIRGSPSPSDARNLLMNR----------------------------------------
gs1xxx19     ISTIRQSPDTPAAQSRLMDR----------------------------------------
gs2xxx20     ITTIRQSPDAPTAQSSLMEK----------------------------------------
beta1x16     IAIIKAAPTPPIAKQELMSKPWDSGLVREMLARAESDTAGGRASYRPDGLPAVFGMQPDG
beta2x17     ITLIKAAPTPADAKRGLMERTWRSAVVEEMLVRAASDAS------RPEGLAPEFGLSAQG
gama1x18     IELIKASPSGAEAKAKLLDKGWKPGDVLQMLERAGGENAA-----RPDGLDEQYGLVDGL
alpha3       IRVIRASPDPATARDTLMSRDWPAQDVAAMITLID---------------DPRHRLNEDG
alpha4       IRVIRNSPDPNTARETLMSRDWPAADVAAMITLID---------------DPRHKLNPDG
alpha2       IHIIRSSKDPTEARERLVAKSWPAGDMLPLVELIA---------------DPRTVQEDGG
alpha1       VATIRASADAAEAREKLMTRRWPAQDILPYIALID---------------DPTHTANDDG
gns1xx21     IAIIRGSENGDAARKNLIAE----------------------------------------
gns2xx22     IAIIRNSENGDTARKNLVAE----------------------------------------
eudi1x25     INTIRKASSNALAAASLRKE----------------------------------------
ORFxxx0      IEIIEESENSGEAKSKL-------------------------------------------
cyano1       IEIIEDSENSAEAKSKLIDI----------------------------------------
cyano2       IEVIQNSENATEAKSILIVK----------------------------------------
cyano3       IDLIEKSKDTPEAKSNLIIS----------------------------------------
cyano5       INLIENAKDSIDAKIKIMSE----------------------------------------
cyano6       IAMIQEAQDAAAARASLMVH----------------------------------------
cyano7       IAMIQEAKDAASARASLMVR----------------------------------------
cyano4       IAMIQEAADAAAARARLMVQ----------------------------------------
crypto       IEKIKKSINNLEAKCILM-E----------------------------------------
             :  *. :     *   :                                           
Prim.cons.   IAIIRASPDAAEARS2LMSRDWPAGDVL3M23LIDSD3A2GRASYRPDGLDPRHGLNDDG

                    550       560       570       580       590       600
                      |         |         |         |         |         |
eubact1      -FGLTEKQAQAILDMRLQRLTALEREKIDEEYRELIKKIEYFNSILADERVLLGVIRQEL
eubact3      -FSLSERQAQAILDMRLQRLTGLEREKIEQEYQDLVRLIAELRGVLADEEKVLQIIRDEL
gramplus1    -FGFTEVQAQHILDMQLRRLTALEREKLQEEYDELQDRIAYYRAVLASEKMQYDIIKQEL
eubact2      -FGFTEVQAQAILDMRLQRLTGLERQKIEEELAELLKMIEYYKNVLANEAMVKEIIKKEI
eury1x23     -FALDEVQAKAILEMRLQRLTGLETRKILDELEALVKQIEELRKILASDELKYEIIRTEL
eury2x24     -FGLSEEQARAILDMRLQRLTGLEQEKVASEARELESTIARLKGILASRTEVLDIIKNEL
gs1xxx19     -FGLTEAQSKAILEMRLQRLTGMERQKIDDEYRETLALIEELKSILESPAKQMEIIKAEL
gs2xxx20     -FGLTEIQSKAILEMRLQRLTGMERKKIDMEYQETLLLIDELRSILANPQKQMQIIREEL
beta1x16     LYRLSDGQAQEILQMRLQRLTGLEQDKIVQEYREVMGLIADLLDILARPERITTIITEEL
beta2x17     -YRLSDAQAQAILELRLQRLTGLEQDKIVGEYKDVMAKILDLLDILAKPERITEIIVTEL
gama1x18     -YHLSPEQAQAILDLRLQKLTGLEREKLINDYQELLEQIAELLKILGNPERLMEVIREEL
alpha3       TARLSFEQAKAILDLRLQRLTALGREEISEELDKLAVEIADYLEILRSRARVQTIIKDEL
alpha4       TARLSFEQAKAILDLRLQRLTALGREEISEELDKLAVEIADYLEILRSRARVQAIVKTEL
alpha2       LIRLTDEQARAILALTLSRLTGLGRDEIGNEAAALADAIRGYLELLSDRANIMAVVREEL
alpha1       TYNLSETQARAILDLRLQRLTQIGVKEVTDELEELAGKIKEYLEILGSRDRIMGIIADEL
gns1xx21     -FDFSVVQAQAILDLQLRRLANLERQKILDEYAELMKRIGYLEDLLSHPEKIYALVKEDA
gns2xx22     -FDFSVIQAQAILDLQLRRLANLERQKILDEYAELMKRIGYLEDLLSHPEKIYALVKEDA
eudi1x25     -FELSEKQAEAILDISLRRLTALERNKFVEEGKSLRTQISKLEELLSSKKQILQLIEEEA
ORFxxx0      ------------------------------------------------------------
cyano1       -FYLSAKQANSVLDMPLKKLTNLEKNQIDEDIRKLQEKKDYFQNLLNERKLLLELLVDEL
cyano2       -LSLSEKQADAVLSMPLKKLTTLERKQIEIDMKELLEKKKYLNNLLNNRRLLLDTLIEEL
cyano3       -LKINERQADGILGMPLKKITGLEKDSLKNELKDLKTKRAELELIINDKENLMKVMVKEL
cyano5       -LKLNEKQSEGILSMPLRKLTNLETQGLYNEANDLKILEKNLREILENRSQLLSEMVNEL
cyano6       -LDLSERQADAVLAMPLRRLTGLERESLRQEAEELRAQRQRLKLLLDNRDQLLDALTKEL
cyano7       -LDLNERQADAVLAMPLRRLTGLEQESLRQEVDNLRNEKERLKLLLENRDQLLDAMVAEL
cyano4       -LDLNEKQADAVLAMPLRRLTSLEQSSLRQEAKELQEKQEQLQFLLENRESMLEVLIQEL
crypto       -FGLSQEQSEAILNLQLRRLTKLESKKIDNDFEITKSSLNELKCILSSNILIDGIIKNQI
                                                                         
Prim.cons.   TFGLSE2QAQAILDMRLQRLTGLEREKIDEEY2ELLKKIAELLEILASRER2LEIIKEEL

                    610       620       630       640       650       660
                      |         |         |         |         |         |
eubact1      LEIKEKYGDARRTQITN-----------------EESIFDEEDLIAEEDMVITITHQGYI
eubact3      SEIKERFNDERRTEIVSG----------------AVEQFDDEDLIPQEHVVITLTHKGYI
gramplus1    GEIKKKYGDPRRTRITPD----------------DG-DIDIEDLIADEDVVVTISHSGYI
eubact2      LEIKEKYKDERRTKIIQD----------------EQEDFEEEELIQEQDTVITLTHFGYI
eury1x23     SELKDKYGDIRRTRIVH-----------------NTENVTDEDLIPEEDVVVTITNSGYI
eury2x24     RELDEIYGDDRRTEILE-----------------SVESVRPEDLIQDEEVAVIITNNGYI
gs1xxx19     LKVSDVYGDERRTELRP-----------------QEGDFSIEDMIAQEDVVITITHEGFI
gs2xxx20     LKVKDVYGDARRTEIVP-----------------QEGDFSIEDMIAQEDVVITITHDGFI
beta1x16     GAIRAEFGDERRSQIEL-----------------NATELDTEDLITPQDMVVTLSHSGYM
beta2x17     VAIREQFGDERRSEIIL-----------------QTHELSLEDLITPQDMVVTLSHGGYI
gama1x18     QAVREEYADERRSEIVA-----------------SRQDFSMEDLIAEETVVVTLSNGGYA
alpha3       AAVKAEFATPRRTEIIE-----------------QEGEVEDEDLIQREDMVVTVSHAGYV
alpha4       GEVKAEFATPRRTVIAE-----------------QEGEVEDEDLIQREDMVVTVSHAGYV
alpha2       VEVREKFAIPRRCQIVD-----------------GDADMEDEDLIVREDMVITVTMGGYV
alpha1       REVRELFAVPRRTEIVD-----------------WSGDMEDEDLIAREDMVVTVTQGGYI
gns1xx21     KDLKSSYGQPRATEISNQ----------------GVIEFRVEDLVPHMDVIVTLSERGFI
gns2xx22     KDLKGSYGQPRATEISSQ----------------GVIEFRVEDLVPHMDVIVTLSERGFI
eudi1x25     IEIKNKFFNPRRSMLEDT----------------DSGDLEDIDVIPNEEMLLAISEKGYV
ORFxxx0      ------------------------------------------------------------
cyano1       LILKKKYNVKRKTKLLK--N--IDQNEE-----LETINNQILEDFINKKTKLFIDNRLYL
cyano2       KSLKKKFNVKRKTKILK--D--INQEKE-----IDTINNQILEDLINKETKISVDNRFYF
cyano3       KDLKKRFGSKRRTKLIEGGDALIAEKMANQRPNKELQRINALKELS-KDSEIIIQSNNEI
cyano5       KLLKKKFGSQRKTKLVEGGDELVAERNANLRPNAELQRKKAFESLP-KDGYLLIQDDDQV
cyano6       RQLKKRFATPRRTRLVEGGDHLLAERAANQRPNAELQRRQALDALP-PDSRILIQDDGQV
cyano7       KTLKKRFSTPRRTRLVEGGDALIAERAASQRPNTELLRQQALAALP-GDGRLLIQADGQV
cyano4       RQLKKRFNNPRRTRLVEGGDDLVAERAANQRPNAEVQRQQALSALP-SDGRILIQQDSQV
crypto       KNISEIYGFPRKTLLIN----------S-----INENIIEELETIENYESVIMITQYYIK
                                                                         
Prim.cons.   KELKEKFGDPRRTEIVEGGDALIAERAANQRPNAEEGDFEDEDLIP3EDVV2TITHDGYI

                    670       680       690       700       710       720
                      |         |         |         |         |         |
eubact1      KRLPVDTYKNQRRGGRGVTAMATKEEDFVRHLFVTSTHNYLLFFTNKGKVYRLKVHEIPE
eubact3      KRLPLSTYRSQKRGGRGVQGMHTAEDDFVEHLLITSTHDTVLFFTNKGKVYQAKGYEIPE
gramplus1    KRVPLSTYRQQRRGGRGVQGAGTKEEDFIEHIFTTTTHHDMMFFTDQGRVYRIRCHEIPE
eubact2      KRLPLDTYKSQKRGGKGITGISTREEDFVEEVFVTTTHHYILFFTDKGKAYRLRAYEVPE
eury1x23     KRIPLDTYTMQRRGGRGIIGMEMKEEDFVENLFISSTHNYILFFTNRGRLYWQKVYEIPE
eury2x24     KRQPLSVYRMQRRGGKGSIGAETKSEDFVTDIFTASTLDYLMIFTDRGKAHWLRVYEIPM
gs1xxx19     KRFPVSGYRRQHRGGRGVAGAQAKNEDFIEHMFIASTHNYILFFTTAGRCYWLKVYEIPE
gs2xxx20     KRFPVSGYRRQARGGKGVAGAQAKHDDFVEHMFIASTHNYILFFTTRGRCYWLKVYEIPE
beta1x16     KSQPISEYRAQKRGGRGKLATATKEDDWIDTLFVANTHDYILCFSNRGRLYWLKVYEVPQ
beta2x17     KAQPLADYRAQRRGGRGKQAAAIKDEDFVDHLFMANTHDFILCFSNRGRCYWLKVYEAPQ
gama1x18     KMQPIDTYRAQKRGGRGKSAGQLKDQDYVEHLLVAGTHDTLLLFTNAGKVFWLRTFELPQ
alpha3       KRVPLSTYRAQRRGGKGRAGMATREEDFVSRLFVASTHTPVLFFSSRGQVYKEKVWRLPL
alpha4       KRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVASTHTPVLFFSSRGQVYKEKVWRLPL
alpha2       KRTPLANYRTQHRGGKGKSGMATKNEDAVTRVFSASTHAPLLFFTSGGKVYKMKVWRLPL
alpha1       KRTPLADFRSQRRGGKGLSGGSLKEDDVVTTLFVANTHTQLLFFTTDGMAYKLKTWRLPQ
gns1xx21     KRVPANVFRLQHRGGTGIMGMPTREADAVRFLSVSDTHDTLLFFTNRGKVFSLRCFDIPD
gns2xx22     KRVPANVFRLQHRGGTGIMGMPTREADAVRFLSVSDTHDTLLFFTNRGKVFSLRCFDIPD
eudi1x25     KRMKPDTFNLQNRGTIGKSVGKLRVNDAMSDFLVCRAHDKVLYFSDKGTVYSSPAYKIPE
ORFxxx0      ------------------------------------------------------------
cyano1       RKMILNNYKKS----FEDVNKIIDNKNIQKFICNIDKNVKIIGITYTGKVFHINWE----
cyano2       KKIIYNNYKKI----LDHENKFIDNKNVQKFICRIDKSLKIIGITSSGKIIQIDWK----
cyano3       KIIPSLTIKKLK---LKEINQERKDILPAKLIWPIKNEPKILAVSQEGKIGLLKWE----
cyano5       KILRPQILTKLN---LTESCLLGEGPVPTRLLWPIAKQPKILAITNHGKIALLKWE----
cyano6       KVISPQLMGRLH---LNEPTALGDEPSPARVILPIKPVAKLLAVTASGRVALIRWE----
cyano7       KIVTPQVLGRLH---FGDPCPVSDAPSPARVILPIEPPPRLLAISANGRVALVRWE----
cyano4       KVMSPQILGRLH---LNEACKLSDGPSPARLILPIEPAPRLLAVTNNGRVALVRWE----
crypto       KMFLESFESQTRG-TKGKRGLIISDGDEISHFFSCNNRDDLIAISSGGIAYKIKVSRIPI
                                                                         
Prim.cons.   KRVPLSTYR2QRRGG2GKSGMATKEEDFV2HLFVASTHDYLLFFTNRGKVYWLKVYEIPE

                    730       740       750       760       770       780
                      |         |         |         |         |         |
eubact1      -AGRQAKGTPIVNLLY-VDQDERITAIIPVK-----------------------------
eubact3      -FGRTAKGLPIINLLE-LDKDEWINAMIPIES----------------------------
gramplus1    -ASRQARGTAIVNLIP-LLPGEKVNTVIPVKE----------------------------
eubact2      -ASRQAKGTAIVNLIQ-IGKDEKITACMTVK-----------------------------
eury1x23     -GSRQSRGKAIVNLLE-LQEGEMVNAMISVEE----------------------------
eury2x24     -VSKVARGRPIASLLQ-LEENERITEAIPVES----------------------------
gs1xxx19     -AGRAARGRSLANIME-LPPGEKIRTYINVRN----------------------------
gs2xxx20     -AGRTARGRSLANIME-LQPAEKIRAYINIRN----------------------------
beta1x16     -GSRNSRGRPIVNMFP-LADGEKINVIL--------------------------------
beta2x17     -GSRVSRGKPIVNLFP-LEEGERINAVL--------------------------------
gama1x18     -GGRASRGKPIVNLLPALGADERITAILRLDADMVRQQKAGGEEDIVDVDDAADVIEDET
alpha3       -APPNGRGKALINILP-LEQGERINTIMPLPE----------------------------
alpha4       -APPNGRGKALINILP-LEQGERITTIMPLPE----------------------------
alpha2       -GVANSRGKAFVNLLP-IEPGETITSILALPE----------------------------
alpha1       -GARTSKGKAIVNILP-IPQGVSIAAILPIDR----------------------------
gns1xx21     DSSRIAKGTAIVNLIP-VTQDERITAILDLKS----------------------------
gns2xx22     DASRIAKGTAIVNLIP-VTQDERITAILDLKS----------------------------
eudi1x25     -CSRTAAGTPLVQILS-LSDGERITSIIPVS-----------------------------
ORFxxx0      ------------------------------------------------------------
cyano1       -SNINNDYKLDKKIIG-NIDQNKIINFHSIKKGIKNY-----------------------
cyano2       -SNITSEFKMDKKVLG-NIDPKEIINFHYLDSKLKNY-----------------------
cyano3       -FAGQKPGPLKQFLPA-GLENDKIINLIPLTEIRDIS-----------------------
cyano5       -FAGSQPGQLNRFLPS-GLEGEKITNLLPLLNTENLS-----------------------
cyano6       -FAGQQPGSLERFLPT-ALQGDPVVSVLQLPDADADSN----------------------
cyano7       -FAGQQPGALERFLPS-GLEGEPIVAIAPLPMQESSD-----------------------
cyano4       -FAGQQPGSLERFLPG-GLEKETLINIFPLPVDQNLS-----------------------
crypto       -SKRNSKGTPILSILK-GLENNQISSIIATSNCETEK-----------------------
                                                                         
Prim.cons.   DASRQARGKAIVNLLPALLEGERITAIIPL2EDE22S2KAGGEEDIVDVDDAADVIEDET

                    790       800       810       820       830       840
                      |         |         |         |         |         |
eubact1      --------E------FTDDHYLFMVTKNGIVKKTVLSEYDSSRRDGIIALSLEEGDK---
eubact3      --------E------FSDERYLVFATKQGIAKRSPLSAFAHIRNNGLIAIHLREGDE---
gramplus1    --------G------DQEEGYIFFATRSGWVKKTAVTEFQNVRSTGIIAIKLEEGDT---
eubact2      ---------------DFKEGFLMMCTKNGTIKKVLLSEFENTTKAGKKAITLAEDDC---
eury1x23     ---------------FAEDKYLFMATRAGTVKKTPLSEFRNPRRAGIIAVSLDEGDE---
eury2x24     ---------------FGTDEYIVLATRNGSIVKTPLRAFSNPRRGGIKAVNLR-GDS---
gs1xxx19     ---------------FDDPHFIIMATAKGIVKKTSLEEYSHPRRTGINAITIDEGDE---
gs2xxx20     ---------------FDEPGFIVMATGNGTVKKTGLDEFSRPRRNGIAAITIEENDE---
beta1x16     -----------PVRQFDAEHFIFMATARGTVKKTVLTDFSNPRKAGIIAVDLDEGDF---
beta2x17     -----------PVKEFADDKFIFMATRAGTVKKTPLSDFSNPRKAGIIAVDLLDDDY---
gama1x18     DSDVEVEGEVEAVTDTVPGPFIFMATSSGIVKRTALANFARPRSSGLIAVKLQEGEH---
alpha3       -------DE-----SSWAEFDVMFATTRGTVRRNKLSDFVDVRRSGIIAMKLDDGEA---
alpha4       -------DE-----ASWSELDVMFATTGGNVRRNKLSDFVDVRRSGIIAMKLDEGEA---
alpha2       -------DE-----ATWGGLDVMFATRSGSVRRNKLSDFVDVRRNGKIAMKLDEGDG---
alpha1       -------DE-----KDWSQLQIVFATSAGTVRRNALSDFTNVKSNGKIAMKFEDEHAETT
gns1xx21     ---------------FPADHFLLMATNKGEIKKTSLQEFTAVRSSGLIAMDLTASDE---
gns2xx22     ---------------FPADHFLLMATNKGEIKKTSLQEFTAVRSSGLIAMDLATSDE---
eudi1x25     --------------EFAADQYLVMLTVNGYIKKVSLNYFASIRCTGIIAIQLVPDDE---
ORFxxx0      ------------------------------------------------------------
cyano1       ---------------------LCILNSDGRFKKVLFDEDMIKSNRCFSITKLKNNIK---
cyano2       ---------------------LCILSSDGRFKKVLFDEDMIKSNRIFSITKLKNSTS---
cyano3       ---------------------IGLISTDGKFKRISINEISDISNRSTTILKLKDSVK---
cyano5       ---------------------LGLLSTDGRFKRTNLNEIIDISGRATTILKLKDGVF---
cyano6       ---------------KAAVSSLGLLSSDGRFKRLPMQELLDLSGRAASVVKLKEGVE---
cyano7       -------------------LSLGLLSSDGRFKRLPLAEVLELSGRATSVVKLKDGVQ---
cyano4       ---------------------LGLLSSDGRFKRLPIEEVMELSGRAATIVKLKDGVI---
crypto       --------------------FLVLLTQKGLIKRTSISNFNNISSRGLIILTLDENDS---
                                                                         
Prim.cons.   DSDVEVEDEVEPV32F2ADHFL2MATSDGTVKKTPLSEFSN2RRRGIIAVKL2EGDEETT

                    850       860       870       880       890       900
                      |         |         |         |         |         |
eubact1      LIDVKLSTGQEEVIIGTKKGMAIRFSETDVRPM--GRTARGVKGITLS-PGDEVIGLEVV
eubact3      LISVRLTDGKKHLIIGTKNGMLIRFPETDVRAM--GRSATGVKAITLD-DGDEVVGMEIL
gramplus1    LVGARLTRGNDEIILVSSAGYALRFHEDDVRPM--GRDTRGVKGITLG-PDEYVVGMDGV
eubact2      LIDVKLTSGNDEMVLVSSGGYCVVFNENDVRVM--GRSAQGVKGMTLE-DGDFVVGMEKA
eury1x23     LVKVLLTDGKQEIMMVSKKGKAIRFSEEDVRPM--GRTARGVRGMTLEGPDDEVVSLDLV
eury2x24     LVAARLTDGSRELIVATKKGKAIRFHESDVRSS--GRGSMGVKAINLS-EGDELISMDVV
gs1xxx19     LIEARLTDGDHQIILAKSSGYAVRFPESEVRSM--GRTAMGVKGITLD-EDERCISMVTT
gs2xxx20     LIDARLTDGDHQIILAKSSGYVVRFPESEIRSM--GRTAMGVRGITLD-ADEKCISMVTT
beta1x16     LIGAAVTDGQHDVMLFSDAGKAVRFDENDVRPM--GRQARGVRGMNLD-EGQAVIAMLVA
beta2x17     LIGVELTTGQSDIVLVSNAGKAVWFDEEDVRPM--GRGARGVRGMKLQ-AGQAVISLLVA
gama1x18     LVNVAITQGHEDIMLVARNGKAVRFHQSKVRVM--SRLARGVRGIKLA-EGVDVISLIVP
alpha3       IVDVQICTDRDDVLLTAAEGQCIRFAVTDVRVFQ-SRASMGVRGMALA-NGDQVISLTIL
alpha4       IVDVQICTERDDVLLTAAGGQCIRFPVPDVRVFS-GRTSMGVRGIALS-SGDTVISLSIL
alpha2       IVGVAVCNADQDVLLTTAAGRCIRFSVDEVRVFA-SRDSTGVRGVKLL-DGDQVISMAVL
alpha1       LINARIASPDDDVMLVTASGRAIRFPSEDVRVFN-SRSSVGVRGVKLS-GHDKVVSMSVI
gns1xx21     LVAAVETIEEKDILLATRLGQSIRFPVSELRTS--LRASGGVKAIVLS-MEDEVVSMDVA
gns2xx22     LVAAVETTEEKDILLATRMGQSIRFPVSELRTS--LRASGGVKAIVLS-KGDEVVSMDVA
eudi1x25     LKWVKCCSNNDFVAMASQNGMVILTPCANIRAL--GRNTRGSVAMRLK-EGDKVASMDII
ORFxxx0      ------------------------------------------------------------
cyano1       TIDSFIFSEEKNLIILTSIGRMFKFNLSNKFLTPTTKQSQGLMLTKLL-PTEKIVSCCSY
cyano2       IIDSFILNKQQQLVILTSIGRLFKFDLSDKNLNPSTKQSLGLLLVNLL-PTEQIVSCCKS
cyano3       LKSCILCKENSYLYIVSDIGRIIKIKITENDFPFMGKLAQGTNIIKLF-PNENIVEALSF
cyano5       LKSALLCPLNGHLLVVTNIGRIIKLKINEESIPLMGKLAQGSVMIKLF-PGENIIGALTT
cyano6       LKTAVICREGGTLSLISDLGRVLPLPVTEDNLPLMGKLAQGPVTMRLL-PGETLIAAVAT
cyano7       LKAAVICHEHHDLILVSDIGRMLRLPINEDVLPRMGRLAQGPMTMRLL-PGEHLIGALCP
cyano4       LKSAFICKANDDVILASNIGRVIRINVNNDSMPLMGKLAQGPMTMRLL-PEEMVVGAVSC
crypto       LKWVRKCYNDDSVIISTKKGKLLRFNASQKELKSTGRTSKGIKSIDLD-SNDIISDFDII
                                                                         
Prim.cons.   LIDARLTDGNDDVILVTSIGRAIRFPESDVRVMLMGR2A2GV2GI2L2GPGDEVISMDVA

                    910       920       930       940       950       960
                      |         |         |         |         |         |
eubact1      DE----------------------------------------------------------
eubact3      ED----------------------------------------------------------
gramplus1    VP----------------------------------------------------------
eubact2      SD----------------------------------------------------------
eury1x23     DE----------------------------------------------------------
eury2x24     KE----------------------------------------------------------
gs1xxx19     KRN---------------------------------------------------------
gs2xxx20     KRF---------------------------------------------------------
beta1x16     PAESAETESSVAEGDV-------------------------S------------------
beta2x17     -------ESD--Q-----------------------------------------------
gama1x18     -------EEN--------------------------------------------------
alpha3       RHFDATPAERTTYLKQSGAIRRAATGEEVEPSEVVEAAVEPEEETDGLAALSPERYAEMS
alpha4       RHFEATPAERSTYLKQSGAIRRAATGEENEPVETPEAEAE---EGDTSAALSQERYAEMS
alpha2       RSVDATPAERAAYLKHQRAMLRAADGEEGEDTATAADDGD---EEVGEASLTPERIAELG
alpha1       RHFDATADERAAYLKMRRAMVGLTDDSE-------TSDED---ETSANATISPDRYAEMS
gns1xx21     QEG---------------------------------------------------------
gns2xx22     QEG---------------------------------------------------------
eudi1x25     PDALQKELDKTLEVQQR------------------------------------Q---YRS
ORFxxx0      ------------------------------------------------------------
cyano1       ----------Q-------------------------------------------------
cyano2       ----------K-------------------------------------------------
cyano3       Q--------EK-------------------------------------------------
cyano5       K--------EK-------------------------------------------------
cyano6       D--------PE-------------------------------------------------
cyano7       ------------------------------------------------------------
cyano4       P--------PN-------------------------------------------------
crypto       PS-------QA-------------------------------------------------
                                                                         
Prim.cons.   3EFDATP2ER2AYLKQ22A2RRAA2GEE3EP3ET3EAD42P2EETDG4AALSPERYAEMS

                    970       980       990      1000      1010      1020
                      |         |         |         |         |         |
eubact1      --QAELLTVTSKGFGKKTPFSEYRVQGRGGKGIINMKVT-Q--KNGEVVGIVAVRPE---
eubact3      --HHDVLVVTKKGFGKRTPASEYRVQSRGGKGLKTCNVT-D--KNGPVVAVTTVVGN---
gramplus1    --GADLLVVSETGVGKRTPLTEYPTYKRGARGVITIQLLPE--RHGRLVGVKAVTEG---
eubact2      --GKYLLCVTENGFGKRSDIEEYRKTKRGAKGVLTYKVT-E--KTGRIVDIKMVNDE---
eury1x23     --TTTLLTVTDNGFGKRTEYSQYPVHRRGGKGVITIVTN-L--RNGFVSNVKSVAED---
eury2x24     --GETLFTITTQGYGKRTELSEYPLQRRGGKGVKNIDT-----RRGDVVAAITVSDD---
gs1xxx19     --DTSLLAVTDNGYGKRSKVEDYRMTKRGARGVITIKAH-E--KIGNLVGLLDVNDE---
gs2xxx20     --DTTLLAVTDNGFGKRSRVEDYRLTKRGARGVITLKAH-E--KTGAMVGLLDVNDE---
beta1x16     -PVGSVLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS-E--RNGRVVAAALVSPE---
beta2x17     ---QTVLVATENGFGKRTVLADFRHSGRGTQGVKAIADS-E--RNGVVIGAKLVDDN---
gama1x18     ---GQILTASEHGYGKRTPLTDYPTKGRGGQGVIAMVIN-E--RNGELVGATQVFGE---
alpha3       ANEQFVLTISENGFGKRTSSFEYRTTGRGGKGIVAMSVN-A--RNGKLVASFPVEEE---
alpha4       ASEQFVLTISENGYGKRTSSFEYRTTGRGGKGIVAMSVN-S--RNGKLVASFPVEDS---
alpha2       AAEEILLTVSSEGFGKRTSAYDFRRTGRGGQGLAAQDLS-K--RGGRLVGSFPIDES---
alpha1       AAENLILTLTAGGAGKLSSSHDYPVRGRGGMGVTAWDKR-M--QTGQIVASFPVEMD---
gns1xx21     ---TMVITVTENGAGKLTAIEEYPQQHRAGSGVINFKVV-D--KTGEVVASKVVSVT---
gns2xx22     ---TLVITVTENGAGKLTAIEEYPQQHRAGSGVINFKVV-D--KTGEVVASKVVSET---
eudi1x25     MKGPWLLFVSESGYGKRVPVSRFRTSPLNRVGLFGYKFSSEDCLAAVFVVGFSLGEDGES
ORFxxx0      ------------------------------------------------------------
cyano1       -NGENIYLVSRKGKIFCINSNEIYYANEYSLGYLNEITQLK----NDYFLKILP--SN--
cyano2       -DKEILYLVSKKGKFFKLKIDDIYNSYNSKLGYVNEKMQLK----DDHFITVLS--SN--
cyano3       -KNKDLILITNKGFFVKHSTKEITISKKGALGTMGIHFKDNKTI-KERVIDCFI--NN--
cyano5       -ENCNIILISEKGTVIKHSLKSIKESSKGDLGEIGISFKDKNNQ-KDRLIQTYN--AK--
cyano6       -QQDPLLLFSRHGRIKPLSLDTVRLCQRGNLGVIGWQPEQDGNEGEDRLCAACV--GS--
cyano7       -TKPTALLVSEQGRLARIDLTSIRSSQRGDLGSMAIQLVGD----TDRITGLTE--AS--
cyano4       -CESTVLLATRLGKFAKILVSSIRICQRGDLGEIGLTIKDSSRD-QDRVVDICN--GN--
crypto       -ITNFIILLTEMGYGKRIKVTELKIQKRGKKGIKVISLREN---VNDYLISSRFCIEN--
                                                                         
Prim.cons.   A32TTLLTVTENGFGKRTSLSEYRT3GRGGKGVIAIKV2DE5NRNGDVVASK2VS2ENES

                   1030      1040      1050      1060      1070      1080
                      |         |         |         |         |         |
eubact1      -DEVMAISGEGIMIRVKAAE------ISTQGRATQG-VTLMKLNKDDQLTAVAKIAAQED
eubact3      -EDVMVITTGGVLIRIAVSD------ISRTGRIAQG-VKLIRLSGEDGHECVATVAKVPE
gramplus1    -NDLMLVSEQGVLIRIPVEE------VRRSGRNTQG-VQLMNLDAN---DRVSAVAQVVT
eubact2      -DEIMLCSTEGIFIRLEMSQ------VPVQGRNTQG-VKLMRIDSDS--IKVSSIARIKA
eury1x23     -DELMFTSAEGIIIRIPAKD------ISIQGRNTQG-VRVMNIKSG---DKVGGMARIKN
eury2x24     -DGLLITTKEGVMIRIAASD------VRVQGRATQG-VKIMDVKPG---DEISDVARVD-
gs1xxx19     -DDLIIITTNGIVIRQHVSD------IRVLGRNTSG-VRLIRLDAG---DRISATARVPK
gs2xxx20     -DDLIIITNNGIVNRQHVSD------IRLTGRNTSG-VRLIRLMAG---DIISALARVPK
beta1x16     -DEIMLITTGGVLIRTRVAE------IREMGRATQG-VTLINVDEG---TKLSGLQRIVE
beta2x17     -DEVMLITTGGVLIRTRVSE------IRGMGRATQG-VTLISLDDG---EKLAGLEKVAE
gama1x18     -EDIMLISNQGTLVRTGVNQ------VSTSGRNTQG-VRLIRLADG---EALCGLATIPE
alpha3       -DQIMLVTDKGQLIRCPVGG------IRIVGRSTQG-VTVFNTAED---EHVVSVEHIGE
alpha4       -DQIMLVTDNGQLIRCPVEG------IRVAGRSTQG-VIVFNTADD---EKVVSVERIPE
alpha2       -DQILLVTDQGQLIRVPVSQ------IRVAARNTQG-VTIFRTAQD---EHVVSVERLAD
alpha1       -DQIMLATSKGQSIRVPVEG------ISFRSRSAGG-VKVFNTGKG---EEVVSVAWIAD
gns1xx21     -DQMMLISADGMVTRTQVKEEDPSHGIPIMGRATQG-VRVMRLEEG---DRVVAVATF--
gns2xx22     -DQMMLISADGMVTRTQVKEEDPSHGIPIMGRATQG-VRVMRLEEG---DRVVAVATF--
eudi1x25     DEQVVLVSQSGTVNRIKVRD------ISIQSRYARG-VILMRLEHAG---KIQSASLISA
ORFxxx0      ------------------------------------------------------------
cyano1       -HYLDIETNKNKSARLNFDK------LNFKSKKTNFLIDFLKLDDE---EYIENCFQLEN
cyano2       -QYIDIETNKNKSARLNLNK------LDNNSGKNMLKIDFLNLEKD---EYLDNCYRLEK
cyano3       -KHVYVKTDKDRYQRLKTDQ------IDNSSYRKEN-KLNIDLKND---EFLKSTFSMKV
cyano5       -QLVGIKTNQGKHGRVSSNQ------IEKLKFNEEQ-KKAFNLEKN---ELLEKIIPLIE
cyano6       -GLVGIVTSSGRHG-----R------LLTREP------NDLTLKSG---ETLERIVPLLN
cyano7       -GLIGMVSTEQRHGRIDPTT------LEITNPGEEF-SNQIELHQG---ETITDLIPQIS
cyano4       -RLVGLVSSQGRHGRIEAGK------LELTIPIKPS-LNIVELKDN---EEIQKLVPLIT
crypto       -EEILISTSYGNVVKQKISD------IAVQKKNSKG-IIIQRLTEG---DKVSKISIINS
                                                                         
Prim.cons.   DDQIMLITT3G2LIRIPVSDEDPSHGIR2QGRNTQG2VRL2RLD2GD22EKVSSVARIPE

                   1090      1100      1110      1120      1130      1140
                      |         |         |         |         |         |
eubact1      EEND--------------------------------------------------------
eubact3      EERDEE------------------------------------------------------
gramplus1    RDEE--------------------------------------------------------
eubact2      EQ----------------------------------------------------------
eury1x23     GKEDEKLKLTALAKKAAKEKVPGSESEEDESEDLDEFEGSDEFGEEPEKEEFEDSESEDS
eury2x24     ------------------------------------------------------------
gs1xxx19     SDDDSATEPLGD--EGQIDLEF--------------------------------------
gs2xxx20     SDEEIDPDSLPENPDGQIDLF---------------------------------------
beta1x16     SDADNGS-GAEEGEAADDAAGATDAG--ATDAGANS------------------------
beta2x17     SVAEAEVEGESEVVAPETGDAAPSEGDVASNEGGEV------------------------
gama1x18     LEGVEEEDGEADEVLDGEATPEAPKSD-ASDDAEE-------------------------
alpha3       EA--ENGNGDGG------------------------------------------------
alpha4       TD--DGENGNGG------------------------------------------------
alpha2       SGGDDNQGEDSGADETP-------------------------------------------
alpha1       QGEDDTDGEDAQNA----------------------------------------------
gns1xx21     ------------------------------------------------------------
gns2xx22     ------------------------------------------------------------
eudi1x25     ADADPEDEDATAVAA---------------------------------------------
ORFxxx0      ------------------------------------------------------------
cyano1       FLD---------------------------------------------------------
cyano2       YIN---------------------------------------------------------
cyano3       PDKN--------------------------------------------------------
cyano5       ENSYN-------------------------------------------------------
cyano6       ------------------------------------------------------------
cyano7       G-----------------------------------------------------------
cyano4       TNNTLD------------------------------------------------------
crypto       VIN---------------------------------------------------------
                                                                         
Prim.cons.   2D2DEE2EGD2232A2QI2L6A4SE2D2ASDEG4E3FEGSDEFGEEPEKEEFEDSESEDS

                   1150      1160
                      |         |
eubact1      -----------------------
eubact3      -----------------------
gramplus1    -----------------------
eubact2      -----------------------
eury1x23     ESEDSEEEEEEEEEEEEEKEEEY
eury2x24     -----------------------
gs1xxx19     -----------------------
gs2xxx20     -----------------------
beta1x16     -----------------------
beta2x17     -----------------------
gama1x18     -----------------------
alpha3       -----------------------
alpha4       -----------------------
alpha2       -----------------------
alpha1       -----------------------
gns1xx21     -----------------------
gns2xx22     -----------------------
eudi1x25     -----------------------
ORFxxx0      -----------------------
cyano1       -----------------------
cyano2       -----------------------
cyano3       -----------------------
cyano5       -----------------------
cyano6       -----------------------
cyano7       -----------------------
cyano4       -----------------------
crypto       -----------------------
                                                                         
Prim.cons.   ESEDSEEEEEEEEEEEEEKEEEY                                     


BLAST

BLASTp : ORF contre la banque de donnée "nr" .

                                                                  Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|78778390|ref|YP_396502.1|  DNA gyrase/topoisomerase IV, sub...   456    4e-127  
gi|33860565|ref|NP_892126.1|  DNA gyrase/topoisomerase IV, sub...   417    3e-115  
gi|56752405|ref|YP_173106.1|  DNA gyrase A subunit [Synechococ...   355    1e-96   
gi|81300503|ref|YP_400711.1|  DNA gyrase/topoisomerase IV, sub...   355    1e-96   
gi|113953878|ref|YP_729244.1|  DNA gyrase subunit A [Synechoco...   346    9e-94   
gi|87301556|ref|ZP_01084396.1|  DNA gyrase/topoisomerase IV, s...   345    2e-93 
gi|72383169|ref|YP_292524.1|  DNA gyrase/topoisomerase IV, sub...   340    3e-92   
gi|33864544|ref|NP_896103.1|  putative DNA topoisomerase chain...   338    2e-91   
gi|33862278|ref|NP_893838.1|  DNA gyrase/topoisomerase IV, sub...   337    4e-91   
gi|88809359|ref|ZP_01124867.1|  DNA gyrase/topoisomerase IV, s...   336    6e-91 
gi|87123344|ref|ZP_01079195.1|  putative DNA topoisomerase cha...   336    8e-91 
gi|78183589|ref|YP_376023.1|  DNA gyrase/topoisomerase IV, sub...   334    3e-90   
gi|33239457|ref|NP_874399.1|  Type IIA topoisomerase, A subuni...   333    4e-90   
gi|116071803|ref|ZP_01469071.1|  DNA gyrase/topoisomerase IV, ...   333    5e-90 
gi|84518951|ref|ZP_01006300.1|  Type IIA topoisomerase, A subu...   332    1e-89 
gi|75909066|ref|YP_323362.1|  DNA gyrase, subunit A [Anabaena ...   332    2e-89   
gi|116074280|ref|ZP_01471542.1|  putative DNA topoisomerase ch...   331    2e-89 
gi|17227937|ref|NP_484485.1|  DNA topoisomerase chain A [Nosto...   328    2e-88   
gi|78211563|ref|YP_380342.1|  DNA gyrase/topoisomerase IV, sub...   327    3e-88   
gi|23128095|ref|ZP_00109951.1|  COG0188: Type IIA topoisomeras...   327    5e-88 
gi|86607511|ref|YP_476273.1|  type II DNA topoisomerase, A sub...   323    7e-87   
gi|86604741|ref|YP_473504.1|  type II DNA topoisomerase, A sub...   322    1e-86   
gi|17228355|ref|NP_484903.1|  DNA gyrase subunit A [Nostoc sp....   313    8e-84   
gi|75910661|ref|YP_324957.1|  DNA gyrase subunit A [Anabaena v...   311    2e-83   
gi|67921390|ref|ZP_00514908.1|  DNA topoisomerase (ATP-hydroly...   309    1e-82 
gi|23125167|ref|ZP_00107113.1|  COG0188: Type IIA topoisomeras...   308    2e-82 
gi|56751268|ref|YP_171969.1|  DNA gyrase subunit A [Synechococ...   308    2e-82   
gi|113475568|ref|YP_721629.1|  DNA gyrase, A subunit [Trichode...   306    6e-82   
gi|78779457|ref|YP_397569.1|  DNA gyrase, A subunit [Prochloro...   306    9e-82   
gi|16331582|ref|NP_442310.1|  DNA gyrase subunit A [Synechocys...   304    3e-81   
gi|67923218|ref|ZP_00516705.1|  DNA gyrase, subunit A [Crocosp...   304    3e-81 
gi|22298912|ref|NP_682159.1|  DNA gyrase subunit A [Thermosyne...   303    5e-81   
gi|113477602|ref|YP_723663.1|  DNA gyrase, A subunit [Trichode...   302    1e-80   
gi|33861619|ref|NP_893180.1|  DNA gyrase subunit A [Prochloroc...   301    2e-80   
gi|84517805|ref|ZP_01005154.1|  DNA gyrase subunit A [Prochlor...   301    2e-80 
gi|37522651|ref|NP_926028.1|  DNA gyrase subunit A [Gloeobacte...   301    2e-80   
gi|87124805|ref|ZP_01080653.1|  DNA gyrase A subunit [Synechoc...   301    3e-80 
gi|33865261|ref|NP_896820.1|  DNA gyrase subunit A [Synechococ...   300    5e-80   
gi|78213459|ref|YP_382238.1|  DNA gyrase subunit A [Synechococ...   298    2e-79   
gi|33863395|ref|NP_894955.1|  DNA gyrase subunit A [Prochloroc...   298    3e-79   
gi|33240587|ref|NP_875529.1|  DNA gyrase subunit A [Prochloroc...   295    1e-78   
gi|86606084|ref|YP_474847.1|  DNA gyrase, A subunit [Synechoco...   295    2e-78   
gi|87302143|ref|ZP_01084968.1|  DNA gyrase subunit A [Synechoc...   295    2e-78 
gi|72382528|ref|YP_291883.1|  DNA gyrase subunit A [Prochloroc...   294    3e-78   
gi|113952792|ref|YP_730186.1|  DNA gyrase, A subunit [Synechoc...   294    3e-78   
gi|37521619|ref|NP_924996.1|  DNA gyrase subunit A [Gloeobacte...   293    7e-78   
gi|116071053|ref|ZP_01468322.1|  DNA gyrase subunit A [Synecho...   293    7e-78 
gi|116073097|ref|ZP_01470359.1|  DNA gyrase subunit A [Synecho...   293    8e-78 
gi|78184300|ref|YP_376735.1|  DNA gyrase subunit A [Synechococ...   292    1e-77   
gi|88808973|ref|ZP_01124482.1|  DNA gyrase subunit A [Synechoc...   291    2e-77 
gi|7404425|sp|P73077|PARC_SYNY3  DNA topoisomerase 4 subunit A (T   291    2e-77 
gi|16329694|ref|NP_440422.1|  DNA gyrase A subunit [Synechocys...   291    2e-77   
gi|86609072|ref|YP_477834.1|  DNA gyrase, A subunit [Synechoco...   287    3e-76   
gi|22299160|ref|NP_682407.1|  DNA gyrase A subunit [Thermosyne...   286    6e-76   
gi|16125827|ref|NP_420391.1|  DNA gyrase subunit A [Caulobacte...   281    3e-74   
gi|110679940|ref|YP_682947.1|  DNA gyrase, A subunit [Roseobac...   281    3e-74   
gi|49474366|ref|YP_032408.1|  DNA gyrase subunit A [Bartonella...   280    6e-74   
gi|49475756|ref|YP_033797.1|  DNA gyrase subunit A [Bartonella...   279    9e-74   
gi|75675993|ref|YP_318414.1|  DNA gyrase subunit A [Nitrobacte...   279    1e-73   
gi|51891145|ref|YP_073836.1|  DNA gyrase A subunit [Symbiobact...   278    2e-73   
gi|3128378|gb|AAC16230.1|  DNA gyrase subunit a [Rhodobacter caps   278    3e-73 
gi|83371238|ref|ZP_00916056.1|  DNA gyrase, subunit A [Rhodoba...   277    4e-73 
gi|85716508|ref|ZP_01047479.1|  DNA gyrase subunit A [Nitrobac...   276    6e-73 
gi|84686892|ref|ZP_01014776.1|  DNA gyrase subunit A [Rhodobac...   276    7e-73 
gi|77463183|ref|YP_352687.1|  DNA gyrase subunit A [Rhodobacte...   275    1e-72   
gi|83373949|ref|ZP_00918725.1|  DNA gyrase, subunit A [Rhodoba...   275    1e-72 
gi|39935665|ref|NP_947941.1|  DNA gyrase subunit A [Rhodopseud...   275    2e-72   
gi|92117309|ref|YP_577038.1|  DNA gyrase, A subunit [Nitrobact...   275    2e-72   
gi|115524770|ref|YP_781681.1|  DNA gyrase, A subunit [Rhodopse...   275    2e-72   
gi|83751354|ref|ZP_00947767.1|  COG0188: Type IIA topoisomeras...   274    3e-72 
gi|114707076|ref|ZP_01439975.1|  DNA gyrase subunit A [Fulvima...   273    5e-72 
gi|113934445|ref|ZP_01420345.1|  DNA gyrase, A subunit [Caulob...   273    7e-72 
gi|110633753|ref|YP_673961.1|  DNA gyrase, A subunit [Mesorhiz...   273    7e-72   
gi|99081173|ref|YP_613327.1|  DNA gyrase, A subunit [Silicibac...   273    8e-72   
gi|69933261|ref|ZP_00628463.1|  DNA gyrase, subunit A [Paracoc...   273    1e-71 
gi|82499796|ref|ZP_00885233.1|  DNA gyrase, subunit A [Caldice...   272    1e-71 
gi|113879320|ref|ZP_01417363.1|  probable DNA gyrase subunit A...   271    2e-71 
gi|1835202|emb|CAA70294.1|  DNA gyrase subunit A; DNA topoisom...   271    2e-71 
gi|78045002|ref|YP_361486.1|  DNA gyrase, A subunit [Carboxydo...   271    2e-71   
gi|90419651|ref|ZP_01227561.1|  DNA gyrase/topo II, topoisomer...   271    2e-71 
gi|56418541|ref|YP_145859.1|  DNA gyrase subunit A [Geobacillu...   271    3e-71   
gi|86138320|ref|ZP_01056894.1|  DNA gyrase subunit A [Roseobac...   270    4e-71 
gi|85705334|ref|ZP_01036433.1|  DNA gyrase, subunit A [Roseova...   270    5e-71 
gi|17987167|ref|NP_539801.1|  DNA gyrase subunit A [Brucella m...   270    6e-71   
gi|86357729|ref|YP_469621.1|  DNA gyrase subunit A protein [Rh...   269    9e-71   
gi|62290012|ref|YP_221805.1|  DNA gyrase subunit A [Brucella a...   269    9e-71   
gi|23501975|ref|NP_698102.1|  DNA gyrase subunit A [Brucella s...   269    9e-71   
gi|17935406|ref|NP_532196.1|  DNA gyrase subunit A [Agrobacter...   269    1e-70   
gi|15888832|ref|NP_354513.1|  DNA gyrase subunit A [Agrobacter...   268    2e-70   
gi|117924379|ref|YP_864996.1|  DNA gyrase, A subunit [Magnetoc...   268    2e-70   
gi|116252153|ref|YP_767991.1|  putative DNA gyrase subunit A [...   268    2e-70   
gi|75761792|ref|ZP_00741727.1|  DNA gyrase subunit A [Bacillus...   268    2e-70 
gi|78695073|ref|ZP_00859585.1|  DNA gyrase, subunit A [Bradyrh...   268    2e-70 
gi|83952094|ref|ZP_00960826.1|  DNA gyrase subunit A [Roseovar...   268    3e-70 
gi|90424083|ref|YP_532453.1|  DNA gyrase, A subunit [Rhodopseu...   268    3e-70   
gi|56696919|ref|YP_167281.1|  DNA gyrase subunit A [Silicibact...   268    3e-70   
gi|89358086|ref|ZP_01195908.1|  DNA gyrase, subunit A [Xanthob...   267    5e-70 
gi|52145203|ref|YP_081625.1|  DNA gyrase subunit A [Bacillus c...   267    5e-70   
gi|83588882|ref|YP_428891.1|  DNA gyrase, A subunit [Moorella ...   267    5e-70   
gi|91977067|ref|YP_569726.1|  DNA gyrase, A subunit [Rhodopseu...   266    6e-70   
gi|83942520|ref|ZP_00954981.1|  DNA gyrase subunit A [Sulfitob...   266    6e-70 
gi|15965313|ref|NP_385666.1|  DNA gyrase subunit A [Sinorhizob...   266    9e-70   
gi|34497753|ref|NP_901968.1|  DNA gyrase subunit A [Chromobact...   266    1e-69   
gi|86749993|ref|YP_486489.1|  DNA gyrase, A subunit [Rhodopseu...   266    1e-69   
gi|31323275|gb|AAP43927.1|  DNA gyrase subunit A [Bacillus ant...   266    1e-69 
gi|94309658|ref|YP_582868.1|  DNA gyrase, A subunit [Ralstonia...   265    1e-69   
gi|89208021|ref|ZP_01186546.1|  DNA gyrase, subunit A [Bacillu...   265    1e-69 
gi|21228522|ref|NP_634444.1|  DNA gyrase, subunit A [Methanosa...   265    2e-69   
gi|46202307|ref|ZP_00208476.1|  COG0188: Type IIA topoisomeras...   265    2e-69 
gi|23097462|ref|NP_690928.1|  DNA gyrase subunit A [Oceanobaci...   265    2e-69   
gi|30260201|ref|NP_842578.1|  DNA gyrase subunit A [Bacillus a...   265    2e-69   
gi|30018284|ref|NP_829915.1|  DNA gyrase subunit A [Bacillus c...   265    2e-69   
gi|83311480|ref|YP_421744.1|  Type IIA topoisomerase , A subun...   265    2e-69   
gi|71906869|ref|YP_284456.1|  DNA gyrase subunit A [Dechloromo...   264    3e-69   
gi|16077075|ref|NP_387888.1|  DNA gyrase subunit A [Bacillus s...   264    4e-69   
gi|114798624|ref|YP_761439.1|  DNA gyrase, A subunit [Hyphomon...   263    5e-69   
gi|114767275|ref|ZP_01446115.1|  DNA gyrase subunit A [Roseova...   263    6e-69 
gi|73542263|ref|YP_296783.1|  DNA gyrase subunit A [Ralstonia ...   263    6e-69   
gi|32129333|gb|AAP73860.1|  putative DNA gyrase subunit [Oryza...   263    6e-69   
gi|110808537|sp|Q7XZF7|GYRA_ORYSA  Probable DNA gyrase subunit...   263    7e-69 
gi|28209862|ref|NP_780806.1|  DNA gyrase subunit A [Clostridiu...   263    9e-69   
gi|52078498|ref|YP_077289.1|  DNA gyrase subunit A [Bacillus l...   263    1e-68   
gi|89210820|ref|ZP_01189204.1|  DNA gyrase, subunit A [Halothe...   263    1e-68 
gi|27379807|ref|NP_771336.1|  DNA gyrase subunit A [Bradyrhizo...   262    1e-68   
gi|18308989|ref|NP_560923.1|  DNA gyrase subunit A [Clostridiu...   262    1e-68   
gi|56475927|ref|YP_157516.1|  DNA gyrase subunit A [Azoarcus s...   262    1e-68   
gi|91776041|ref|YP_545797.1|  DNA gyrase, A subunit [Methyloba...   262    1e-68   
gi|113866815|ref|YP_725304.1|  DNA gyrase subunit A [Ralstonia...   262    2e-68   
gi|68056189|ref|ZP_00540320.1|  DNA gyrase, subunit A [Exiguob...   262    2e-68 
gi|73670269|ref|YP_306284.1|  DNA topoisomerase (ATP-hydrolyzi...   261    2e-68   
gi|15612570|ref|NP_240873.1|  DNA gyrase subunit A [Bacillus h...   261    2e-68   
gi|13470909|ref|NP_102478.1|  DNA gyrase subunit A [Mesorhizob...   261    2e-68   
gi|83858658|ref|ZP_00952180.1|  DNA gyrase subunit A [Oceanica...   261    2e-68 
gi|110801534|ref|YP_697358.1|  DNA gyrase, A subunit [Clostrid...   261    2e-68   
gi|110834612|ref|YP_693471.1|  DNA gyrase, subunit A [Alcanivo...   261    2e-68   
gi|84501054|ref|ZP_00999289.1|  DNA gyrase subunit A [Oceanico...   261    2e-68 
gi|89202821|ref|ZP_01181529.1|  DNA gyrase, subunit A [Bacillu...   261    2e-68 
gi|114768820|ref|ZP_01446446.1|  DNA gyrase subunit A [alpha p...   261    2e-68 
gi|3550423|gb|AAC34892.1|  DNA gyrase A subunit [Methylovorus sp.   261    2e-68 
gi|83593079|ref|YP_426831.1|  DNA gyrase, subunit A [Rhodospir...   260    4e-68   
gi|116268965|ref|ZP_01493210.1|  DNA gyrase, A subunit [Polynu...   260    5e-68 
gi|67934854|ref|ZP_00527879.1|  DNA gyrase, subunit A [Chlorob...   260    5e-68 
gi|21672982|ref|NP_661047.1|  DNA gyrase subunit A [Chlorobium...   260    5e-68   
gi|84704077|ref|ZP_01017905.1|  DNA gyrase subunit A [Parvular...   259    7e-68 
gi|110800886|ref|YP_694482.1|  DNA gyrase, A subunit [Clostrid...   259    7e-68   
gi|118029222|ref|ZP_01500683.1|  DNA gyrase, A subunit [Burkho...   259    8e-68 
gi|108802862|ref|YP_642799.1|  DNA gyrase, A subunit [Rubrobac...   259    8e-68   
gi|107102698|ref|ZP_01366616.1|  hypothetical protein PaerPA_0...   259    8e-68 
gi|106893722|ref|ZP_01360846.1|  DNA gyrase, subunit A [Clostr...   259    9e-68 
gi|56961789|ref|YP_173511.1|  DNA gyrase subunit A [Bacillus c...   259    9e-68   
gi|92088880|ref|ZP_01273836.1|  DNA gyrase, subunit A [Lactoba...   259    1e-67 
gi|89054985|ref|YP_510436.1|  DNA gyrase, A subunit [Jannaschi...   259    1e-67   
gi|89101112|ref|ZP_01173948.1|  DNA gyrase subunit A [Bacillus...   259    1e-67 
gi|73749403|ref|YP_308642.1|  DNA gyrase, A subunit [Dehalococ...   259    1e-67   
gi|20090441|ref|NP_616516.1|  DNA topoisomerase (ATP-hydrolyzi...   259    1e-67   
gi|84516181|ref|ZP_01003541.1|  DNA gyrase subunit A [Loktanel...   259    1e-67 
gi|94413560|ref|ZP_01293440.1|  hypothetical protein PaerP_010...   258    2e-67 
gi|83749097|ref|ZP_00946102.1|  DNA gyrase subunit A [Ralstoni...   258    2e-67 
gi|15598364|ref|NP_251858.1|  DNA gyrase subunit A [Pseudomona...   258    2e-67   
gi|78485535|ref|YP_391460.1|  DNA gyrase, A subunit [Thiomicro...   258    2e-67   
gi|116332687|ref|YP_794214.1|  DNA gyrase, A subunit [Lactobac...   258    2e-67   
gi|89091457|ref|ZP_01164460.1|  DNA gyrase, subunit A [Lactoba...   258    2e-67 
gi|118043688|ref|ZP_01512416.1|  DNA gyrase/topoisomerase IV, ...   258    2e-67 
gi|71481925|ref|ZP_00661627.1|  DNA gyrase, subunit A [Prosthe...   258    2e-67 
gi|57233707|ref|YP_182324.1|  DNA gyrase, A subunit [Dehalococ...   258    2e-67   
gi|71838658|ref|ZP_00678416.1|  DNA gyrase, subunit A [Pelobac...   258    2e-67 
gi|58039351|ref|YP_191315.1|  DNA gyrase subunit A [Gluconobac...   258    3e-67   
gi|91784819|ref|YP_560025.1|  DNA gyrase, subunit A [Burkholde...   258    3e-67   
gi|115422431|emb|CAJ48956.1|  DNA gyrase subunit A [Bordetella av   258    3e-67 
gi|77362544|emb|CAJ33722.1|  DNA gyrase subunit A [Bacillus gibso   258    3e-67 
gi|37514957|dbj|BAC98435.1|  GyrA protein [Burkholderia glumae]     257    3e-67 
gi|30248349|ref|NP_840419.1|  DNA gyrase subunit A [Nitrosomon...   257    4e-67   
gi|67918760|ref|ZP_00512354.1|  DNA gyrase, subunit A [Chlorob...   257    4e-67 
gi|37514961|dbj|BAC98437.1|  GyrA protein [Burkholderia glumae]     257    4e-67 
gi|37514955|dbj|BAC98434.1|  GyrA protein [Burkholderia glumae]     257    4e-67 
gi|77952720|ref|ZP_00817133.1|  DNA gyrase, subunit A [Marinob...   257    4e-67 
gi|37514963|dbj|BAC98438.1|  GyrA protein [Burkholderia glumae]     257    4e-67 
gi|37514959|dbj|BAC98436.1|  GyrA protein [Burkholderia glumae]     257    4e-67 
gi|87119282|ref|ZP_01075180.1|  DNA gyrase subunit A [Marinomo...   257    4e-67 
gi|118135630|gb|ABK62674.1|  DNA gyrase, A subunit [Clostridium n   257    4e-67 
gi|77917623|ref|YP_355438.1|  DNA gyrase, A subunit [Pelobacte...   256    6e-67   
gi|5817862|gb|AAD52968.1|AF167102_2  DNA gyrase alpha subunit [Ac   256    6e-67 
gi|52698587|ref|ZP_00339995.1|  COG0188: Type IIA topoisomeras...   256    9e-67 
gi|15892196|ref|NP_359910.1|  DNA gyrase subunit A [Rickettsia...   256    9e-67   
gi|84361156|ref|ZP_00985836.1|  COG0188: Type IIA topoisomeras...   256    9e-67 
gi|33592101|ref|NP_879745.1|  DNA gyrase subunit A [Bordetella...   256    1e-66   
gi|33597666|ref|NP_885309.1|  DNA gyrase subunit A [Bordetella...   256    1e-66   
gi|67459447|ref|YP_247071.1|  DNA gyrase subunit A [Rickettsia...   256    1e-66   
gi|17545620|ref|NP_519022.1|  DNA gyrase subunit A [Ralstonia ...   255    1e-66   
gi|88950359|ref|ZP_01152965.1|  DNA gyrase, subunit A [Halorho...   255    1e-66 
gi|77169328|gb|ABA63601.1|  gyrase subunit A [Clostridium perfrin   255    1e-66 
gi|20806553|ref|NP_621724.1|  DNA gyrase (topoisomerase II) A ...   255    2e-66   
gi|77168988|gb|ABA63431.1|  gyrase subunit A [Clostridium perf...   255    2e-66 
gi|109728787|ref|ZP_01380198.1|  hypothetical protein RbelO_01...   255    2e-66 
gi|91205609|ref|YP_537964.1|  DNA gyrase subunit A [Rickettsia...   255    2e-66   
gi|114331560|ref|YP_747782.1|  DNA gyrase, A subunit [Nitrosom...   255    2e-66   
gi|89094106|ref|ZP_01167049.1|  DNA gyrase subunit A [Oceanosp...   255    2e-66 
gi|102191518|ref|ZP_01347330.1|  hypothetical protein RcanM_01...   255    2e-66 
gi|88946519|ref|ZP_01149595.1|  DNA gyrase, subunit A [Desulfo...   255    2e-66 
gi|115371945|ref|ZP_01459257.1|  DNA gyrase/topoisomerase IV, ...   254    2e-66 
gi|34580784|ref|ZP_00142264.1|  DNA gyrase subunit A [Ricketts...   254    3e-66 
gi|78185988|ref|YP_374031.1|  DNA gyrase, subunit A [Pelodicty...   254    3e-66   
gi|94493526|ref|ZP_01300729.1|  hypothetical protein Rgryl_010000   254    3e-66 
gi|77169132|gb|ABA63503.1|  gyrase subunit A [Clostridium perf...   254    3e-66 
gi|82703307|ref|YP_412873.1|  DNA gyrase, A subunit [Nitrososp...   254    3e-66   
gi|110592961|ref|ZP_01381316.1|  DNA gyrase, A subunit [Acidov...   254    3e-66 
gi|116493580|ref|YP_805314.1|  DNA gyrase, A subunit [Lactobac...   254    3e-66   
gi|74316966|ref|YP_314706.1|  DNA gyrase subunit A [Thiobacill...   254    3e-66   
gi|104780668|ref|YP_607166.1|  DNA gyrase, subunit A, type II ...   254    4e-66   
gi|99911798|ref|ZP_01318614.1|  hypothetical protein Bpse1_030...   254    4e-66 
gi|67546809|ref|ZP_00424719.1|  DNA gyrase, subunit A [Burkhol...   254    4e-66 
gi|42453417|ref|ZP_00153324.1|  COG0188: Type IIA topoisomeras...   254    4e-66 
gi|67735874|ref|ZP_00486808.1|  COG0188: Type IIA topoisomeras...   254    4e-66 
gi|51244502|ref|YP_064386.1|  DNA gyrase, subunit A [Desulfota...   254    5e-66   
gi|115350970|ref|YP_772809.1|  DNA gyrase, A subunit [Burkhold...   254    5e-66   
gi|94264230|ref|ZP_01288025.1|  DNA gyrase, subunit A [delta p...   254    5e-66 
gi|94266204|ref|ZP_01289913.1|  DNA gyrase, subunit A [delta p...   254    5e-66 
gi|78065625|ref|YP_368394.1|  DNA gyrase subunit A [Burkholder...   254    5e-66   
gi|77169256|gb|ABA63565.1|  gyrase subunit A [Clostridium perfrin   253    5e-66 
gi|77168996|gb|ABA63435.1|  gyrase subunit A [Clostridium perf...   253    5e-66 
gi|110599406|ref|ZP_01387645.1|  DNA gyrase, A subunit [Geobac...   253    5e-66 
gi|118057991|ref|ZP_01526454.1|  DNA gyrase, A subunit [Pseudo...   253    5e-66 
gi|116689063|ref|YP_834686.1|  DNA gyrase, A subunit [Burkhold...   253    5e-66   
gi|107022118|ref|YP_620445.1|  DNA gyrase, A subunit [Burkhold...   253    6e-66   
gi|53724794|ref|YP_102248.1|  DNA gyrase subunit A [Burkholder...   253    6e-66   
gi|77169106|gb|ABA63490.1|  gyrase subunit A [Clostridium perf...   253    6e-66 
gi|83720946|ref|YP_442169.1|  DNA gyrase, A subunit [Burkholde...   253    6e-66   
gi|106885811|ref|ZP_01353165.1|  DNA gyrase, A subunit [Clostr...   253    6e-66 
gi|53720131|ref|YP_109117.1|  DNA gyrase subunit A [Burkholder...   253    6e-66   
gi|28376980|ref|NP_783872.1|  DNA gyrase, A subunit [Lactobaci...   253    7e-66   
gi|110598903|ref|ZP_01387151.1|  DNA gyrase, A subunit [Chloro...   253    7e-66 
gi|76795606|ref|ZP_00777978.1|  DNA gyrase, subunit A [Thermoa...   253    7e-66 
gi|77169442|gb|ABA63658.1|  gyrase subunit A [Clostridium perfrin   253    8e-66 
gi|77168984|gb|ABA63429.1|  gyrase subunit A [Clostridium perf...   253    8e-66 
gi|77168992|gb|ABA63433.1|  gyrase subunit A [Clostridium perf...   253    9e-66 
gi|114570423|ref|YP_757103.1|  DNA gyrase, A subunit [Maricaul...   253    1e-65   
gi|16761200|ref|NP_456817.1|  DNA gyrase subunit A [Salmonella...   252    1e-65   
gi|77169138|gb|ABA63506.1|  gyrase subunit A [Clostridium perfrin   252    1e-65 
gi|29141106|ref|NP_804448.1|  DNA gyrase subunit A [Salmonella...   252    1e-65   
gi|15604079|ref|NP_220594.1|  DNA gyrase subunit A [Rickettsia...   252    1e-65   
gi|15794492|ref|NP_284314.1|  DNA gyrase subunit A [Neisseria ...   252    2e-65   
gi|77169372|gb|ABA63623.1|  gyrase subunit A [Clostridium perfrin   252    2e-65 
gi|51473405|ref|YP_067162.1|  DNA gyrase subunit A [Rickettsia...   252    2e-65   
gi|111612459|ref|ZP_01399545.1|  DNA gyrase, A subunit [Vermin...   251    2e-65 
gi|88800758|ref|ZP_01116316.1|  DNA gyrase subunit A [Reinekea...   251    2e-65 
gi|83814088|ref|YP_446304.1|  DNA gyrase, A subunit [Salinibac...   251    3e-65   
gi|111619537|ref|ZP_01406546.1|  DNA gyrase, A subunit [Acidov...   251    3e-65 
gi|116754691|ref|YP_843809.1|  DNA gyrase, A subunit [Methanos...   251    3e-65   
gi|116750116|ref|YP_846803.1|  DNA gyrase, A subunit [Syntroph...   251    3e-65   
gi|88935818|ref|ZP_01141443.1|  DNA gyrase, subunit A [Geobact...   251    3e-65 
gi|82748924|ref|ZP_00911397.1|  DNA gyrase, subunit A [Clostri...   251    4e-65 
gi|82738580|ref|ZP_00901409.1|  DNA gyrase, subunit A [Pseudom...   251    4e-65 
gi|116871429|ref|YP_848210.1|  DNA gyrase subunit A [Listeria ...   251    4e-65   
gi|15677247|ref|NP_274400.1|  DNA gyrase subunit A [Neisseria ...   250    4e-65   
gi|110620291|emb|CAJ35569.1|  type II DNA topoisomerase II (gy...   250    4e-65 
gi|16802055|ref|NP_463540.1|  DNA gyrase subunit A [Listeria m...   250    4e-65   
gi|1170143|sp|P41513|GYRA_ERWCA  DNA gyrase subunit A >gi|5252...   250    5e-65 
gi|46906231|ref|YP_012620.1|  DNA gyrase, A subunit [Listeria ...   250    5e-65   
gi|85059560|ref|YP_455262.1|  DNA gyrase subunit A [Sodalis gl...   250    5e-65   
gi|1790876|gb|AAB41131.1|  DNA gyrase subunit A                     250    5e-65 
gi|15893305|ref|NP_346654.1|  DNA gyrase subunit A [Clostridiu...   250    5e-65   
gi|16765599|ref|NP_461214.1|  DNA gyrase subunit A [Salmonella...   250    6e-65   
gi|62180845|ref|YP_217262.1|  DNA gyrase subunit A [Salmonella...   250    6e-65   
gi|34541069|ref|NP_905548.1|  DNA gyrase, A subunit [Porphyrom...   250    6e-65   
gi|21104368|dbj|BAB93454.1|  DNA gyraseA [Porphyromonas gingivali   250    6e-65 
gi|78188072|ref|YP_378410.1|  DNA gyrase, subunit A [Chlorobiu...   249    8e-65   
gi|91772466|ref|YP_565158.1|  DNA gyrase, A subunit [Methanoco...   249    8e-65   
gi|94499388|ref|ZP_01305925.1|  DNA gyrase subunit A [Oceanoba...   249    8e-65 
gi|67158244|ref|ZP_00419294.1|  DNA gyrase, subunit A [Azotoba...   249    8e-65 
gi|76258570|ref|ZP_00766225.1|  DNA gyrase, subunit A [Chlorof...   249    8e-65 
gi|53804242|ref|YP_113878.1|  DNA gyrase, A subunit [Methyloco...   249    8e-65   
gi|114320084|ref|YP_741767.1|  DNA gyrase, A subunit [Alkalili...   249    9e-65   
gi|114776320|ref|ZP_01451365.1|  DNA gyrase, A subunit [Maripr...   249    9e-65 
gi|39995115|ref|NP_951066.1|  DNA gyrase, A subunit [Geobacter...   249    9e-65   
gi|26988498|ref|NP_743923.1|  DNA gyrase subunit A [Pseudomona...   249    9e-65   
gi|77684207|ref|ZP_00799643.1|  DNA gyrase, subunit A [Alkalip...   249    1e-64 
gi|88941199|ref|ZP_01146622.1|  DNA gyrase, A subunit [Acidiph...   249    1e-64 
gi|21104366|dbj|BAB93453.1|  DNA gyrase A [Actinobacillus actinom   248    2e-64 
gi|50120140|ref|YP_049307.1|  DNA gyrase subunit A [Erwinia ca...   248    2e-64   
gi|89900363|ref|YP_522834.1|  DNA gyrase, A subunit [Rhodofera...   248    2e-64   
gi|59801057|ref|YP_207769.1|  DNA gyrase subunit A [Neisseria ...   248    2e-64   
gi|118047580|ref|ZP_01516213.1|  DNA gyrase, A subunit [Chloro...   248    2e-64 
gi|16799086|ref|NP_469354.1|  DNA gyrase subunit A [Listeria i...   248    2e-64   
gi|89070135|ref|ZP_01157464.1|  DNA gyrase subunit A [Oceanico...   248    2e-64 
gi|117617684|ref|YP_856853.1|  DNA gyrase, A subunit [Aeromona...   248    3e-64   
gi|75814350|ref|ZP_00744951.1|  COG0188: Type IIA topoisomeras...   248    3e-64 
gi|90588644|ref|ZP_01244295.1|  DNA gyrase, subunit A [Flavoba...   248    3e-64 
gi|28898706|ref|NP_798311.1|  DNA gyrase, subunit A [Vibrio pa...   248    3e-64   
gi|68551844|ref|ZP_00591238.1|  DNA gyrase, subunit A [Prosthe...   248    3e-64 
gi|116623071|ref|YP_825227.1|  DNA gyrase, A subunit [Solibact...   247    3e-64   
gi|46199292|ref|YP_004959.1|  DNA gyrase subunit A [Thermus th...   247    3e-64   
gi|55981324|ref|YP_144621.1|  DNA gyrase subunit A [Thermus th...   247    4e-64   
gi|90960996|ref|YP_534912.1|  DNA gyrase subunit A [Lactobacil...   247    5e-64   
gi|110806200|ref|YP_689720.1|  DNA gyrase subunit A [Shigella ...   247    5e-64   
gi|73760122|dbj|BAE19968.1|  DNA gyrase subunit A [Photobacterium   247    5e-64 
gi|116218885|ref|ZP_01484449.1|  hypothetical protein VchoV5_0200   247    5e-64 
gi|59711811|ref|YP_204587.1|  DNA gyrase subunit A [Vibrio fis...   247    5e-64   
gi|84393089|ref|ZP_00991854.1|  DNA gyrase, subunit A [Vibrio ...   247    6e-64 
gi|75211642|ref|ZP_00711721.1|  COG0188: Type IIA topoisomeras...   247    6e-64 
gi|16130166|ref|NP_416734.1|  DNA gyrase subunit A [Escherichi...   247    6e-64   
gi|116215134|ref|ZP_01481223.1|  hypothetical protein VchoR_02002   246    6e-64 
gi|41639|emb|CAA68611.1|  gyrase alpha subunit [Escherichia coli]   246    7e-64 
gi|94987226|ref|YP_595159.1|  Type IIA topoisomerase (DNA gyra...   246    7e-64   
gi|47575157|ref|ZP_00245192.1|  COG0188: Type IIA topoisomeras...   246    7e-64 
gi|114327883|ref|YP_745040.1|  DNA gyrase subunit A [Granuliba...   246    7e-64   
gi|83857350|ref|ZP_00950878.1|  DNA gyrase A subunit [Croceiba...   246    7e-64 
gi|115249009|emb|CAJ66820.1|  DNA gyrase subunit A [Clostridium d   246    7e-64 
gi|86133996|ref|ZP_01052578.1|  DNA gyrase A subunit [Tenaciba...   246    8e-64 
gi|117578008|emb|CAL66477.1|  DNA gyrase subunit A [Gramella fors   246    8e-64 
gi|4886573|dbj|BAA77788.1|  DNA gyrase [Vibrio parahaemolyticus]    246    8e-64 
gi|26248619|ref|NP_754659.1|  DNA gyrase subunit A [Escherichi...   246    8e-64   
gi|75196273|ref|ZP_00706343.1|  COG0188: Type IIA topoisomeras...   246    8e-64 
gi|74312751|ref|YP_311170.1|  DNA gyrase subunit A [Shigella s...   246    8e-64   
gi|15832368|ref|NP_311141.1|  DNA gyrase subunit A [Escherichi...   246    8e-64   
gi|84796010|gb|ABC66093.1|  DNA gyrase subunit A [Bacillus sp. DA   246    9e-64 
gi|77976959|ref|ZP_00832423.1|  COG0188: Type IIA topoisomeras...   246    9e-64 
gi|19705415|ref|NP_602910.1|  DNA gyrase subunit A [Fusobacter...   246    1e-63   
gi|67874885|ref|ZP_00504465.1|  DNA gyrase, subunit A [Clostri...   246    1e-63 
gi|75512707|ref|ZP_00735209.1|  COG0188: Type IIA topoisomeras...   246    1e-63 
gi|77636493|ref|ZP_00798567.1|  COG0188: Type IIA topoisomeras...   246    1e-63 
gi|46143842|ref|ZP_00133972.2|  COG0188: Type IIA topoisomeras...   246    1e-63 
gi|118053103|ref|ZP_01521648.1|  DNA gyrase, A subunit [Comamo...   246    1e-63 
gi|34763291|ref|ZP_00144249.1|  DNA gyrase subunit A [Fusobact...   246    1e-63 
gi|113938229|ref|ZP_01424099.1|  DNA gyrase, A subunit [Herpet...   246    1e-63 
gi|15826871|ref|NP_301134.1|  putative DNA gyrase subunit A [M...   246    1e-63   
gi|13638291|sp|Q57532|GYRA_MYCLE  DNA gyrase subunit A [Contains:   246    1e-63 
gi|86148463|ref|ZP_01066753.1|  DNA gyrase, subunit A [Vibrio ...   245    1e-63 
gi|78221233|ref|YP_382980.1|  DNA gyrase, subunit A [Geobacter...   245    1e-63   
gi|16121507|ref|NP_404820.1|  DNA gyrase subunit A [Yersinia p...   245    1e-63   
gi|1122296|emb|CAA92430.1|  DNA gyrase A subunit [Mycobacteriu...   245    1e-63 
gi|116491824|ref|YP_803559.1|  DNA gyrase, A subunit [Pediococ...   245    1e-63   
gi|90581243|ref|ZP_01237041.1|  putative DNA topoisomerase (AT...   245    1e-63 
gi|15641271|ref|NP_230903.1|  DNA gyrase, subunit A [Vibrio ch...   245    2e-63   
gi|91227187|ref|ZP_01261646.1|  DNA gyrase, subunit A [Vibrio ...   245    2e-63 
gi|29346309|ref|NP_809812.1|  DNA gyrase subunit A [Bacteroide...   245    2e-63   
gi|95929990|ref|ZP_01312730.1|  DNA gyrase, A subunit [Desulfu...   245    2e-63 
gi|116183643|ref|ZP_01473622.1|  hypothetical protein VEx2w_02003   245    2e-63 
gi|91787677|ref|YP_548629.1|  DNA gyrase, A subunit [Polaromon...   245    2e-63   
gi|37526938|ref|NP_930282.1|  DNA gyrase subunit A [Photorhabd...   245    2e-63   
gi|94971797|ref|YP_593845.1|  DNA gyrase, A subunit [Acidobact...   245    2e-63   
gi|51595600|ref|YP_069791.1|  DNA gyrase subunit A [Yersinia p...   245    2e-63   
gi|117674289|ref|ZP_01497347.1|  hypothetical protein YpseI_02...   245    2e-63 
gi|92114290|ref|YP_574218.1|  DNA gyrase, A subunit [Chromohal...   245    2e-63   
gi|90416545|ref|ZP_01224476.1|  DNA gyrase subunit A [marine g...   244    2e-63 
gi|92913834|ref|ZP_01282462.1|  DNA gyrase, subunit A [Mycobac...   244    2e-63 
gi|58582029|ref|YP_201045.1|  DNA gyrase subunit A [Xanthomona...   244    2e-63   
gi|42518090|ref|NP_964020.1|  DNA gyrase subunit A [Lactobacil...   244    2e-63   
gi|78355051|ref|YP_386500.1|  DNA gyrase, A subunit [Desulfovi...   244    3e-63   
gi|15839141|ref|NP_299829.1|  DNA gyrase subunit A [Xylella fa...   244    3e-63   
gi|84714243|ref|ZP_01021708.1|  DNA gyrase, subunit A [Polarom...   244    3e-63 
gi|77960358|ref|ZP_00824233.1|  COG0188: Type IIA topoisomeras...   244    3e-63 
gi|89074076|ref|ZP_01160577.1|  putative DNA topoisomerase (AT...   244    3e-63 
gi|118062825|ref|ZP_01531170.1|  DNA gyrase, A subunit [Roseif...   244    3e-63 
gi|95926320|ref|ZP_01309117.1|  hypothetical protein CburR_010018   244    3e-63 
gi|87199935|ref|YP_497192.1|  DNA gyrase, A subunit [Novosphin...   244    3e-63   
gi|29653864|ref|NP_819556.1|  DNA gyrase, A subunit [Coxiella ...   244    3e-63   
gi|71275186|ref|ZP_00651473.1|  DNA gyrase, subunit A [Xylella...   244    4e-63 
gi|82777638|ref|YP_403987.1|  DNA gyrase, subunit A [Shigella ...   244    4e-63   
gi|49482259|ref|YP_039483.1|  DNA gyrase subunit A [Staphyloco...   244    4e-63   
gi|78047228|ref|YP_363403.1|  DNA gyrase subunit A [Xanthomona...   244    4e-63   
gi|27466923|ref|NP_763560.1|  DNA gyrase subunit A [Staphyloco...   244    4e-63   
gi|28199802|ref|NP_780116.1|  DNA gyrase subunit A [Xylella fa...   244    4e-63   
gi|31791183|ref|NP_853676.1|  DNA gyrase subunit A [Mycobacter...   244    5e-63   
gi|108763597|ref|YP_630704.1|  type II DNA topoisomerase, A su...   244    5e-63   
gi|56460468|ref|YP_155749.1|  DNA gyrase subunit A [Idiomarina...   244    5e-63   
gi|21242381|ref|NP_641963.1|  DNA gyrase subunit A [Xanthomona...   244    5e-63   
gi|63259384|gb|AAY40350.1|  DNA gyrase subunit A [Edwardsiella ta   244    5e-63 
gi|15839378|ref|NP_334415.1|  DNA gyrase subunit A [Mycobacter...   244    5e-63   
gi|52841647|ref|YP_095446.1|  DNA gyrase, A subunit [Legionell...   243    5e-63   
gi|71898266|ref|ZP_00680440.1|  DNA gyrase, subunit A [Xylella...   243    5e-63 
gi|54294303|ref|YP_126718.1|  DNA gyrase, subunit A, type II t...   243    5e-63   
gi|15607148|ref|NP_214520.1|  DNA gyrase subunit A [Mycobacter...   243    5e-63   
gi|1346235|sp|Q07702|GYRA_MYCTU  DNA gyrase subunit A >gi|466275|   243    5e-63 
gi|33152761|ref|NP_874114.1|  DNA gyrase subunit A [Haemophilu...   243    6e-63   
gi|86142208|ref|ZP_01060718.1|  DNA gyrase A subunit [Flavobac...   243    6e-63 
gi|15802778|ref|NP_288805.1|  DNA gyrase subunit A [Escherichi...   243    6e-63   
gi|70725007|ref|YP_251921.1|  DNA gyrase (topoisomerase II) su...   243    7e-63   
gi|88859277|ref|ZP_01133917.1|  DNA gyrase, subunit A, type II...   243    7e-63 
gi|77975439|ref|ZP_00830974.1|  COG0188: Type IIA topoisomeras...   243    7e-63 
gi|56551588|ref|YP_162427.1|  DNA gyrase subunit A [Zymomonas ...   243    7e-63   
gi|73661315|ref|YP_300096.1|  DNA gyrase subunit A [Staphyloco...   243    7e-63   
gi|6006287|dbj|BAA84772.1|  DNA gyrase A subunit [Bacteroides fra   243    7e-63 
gi|41642|emb|CAA40461.1|  DNA gyrase subunit A [Escherichia coli]   243    7e-63 
gi|106891727|ref|ZP_01358909.1|  DNA gyrase, A subunit [Roseif...   243    7e-63 
gi|77956426|ref|ZP_00820526.1|  COG0188: Type IIA topoisomeras...   243    8e-63 
gi|53713702|ref|YP_099694.1|  DNA gyrase A subunit [Bacteroide...   243    8e-63   
gi|110638083|ref|YP_678292.1|  DNA topoisomerase, ATP-hydrolyz...   243    8e-63   
gi|116628689|ref|YP_813861.1|  DNA gyrase, A subunit [Lactobac...   243    8e-63   
gi|110603977|ref|ZP_01392052.1|  DNA gyrase, A subunit [Methan...   243    8e-63 
gi|31044068|dbj|BAC76770.1|  DNA gyrase A [Treponema denticola]     243    9e-63 
gi|94497965|ref|ZP_01304529.1|  DNA gyrase, A subunit [Sphingo...   243    9e-63 
gi|114565582|ref|YP_752736.1|  DNA gyrase, A subunit [Syntroph...   243    1e-62   
gi|33469290|gb|AAQ19682.1|  DNA gyrase subunit A [Staphylococcus    243    1e-62 
gi|94491450|ref|ZP_01298662.1|  hypothetical protein CburD_010...   243    1e-62 
gi|12322780|gb|AAG51377.1|AC011560_9  putative DNA gyrase subunit   243    1e-62 
gi|88712226|ref|ZP_01106313.1|  DNA gyrase A subunit [Flavobac...   243    1e-62 
gi|85711597|ref|ZP_01042654.1|  DNA gyrase subunit A [Idiomari...   242    1e-62 
gi|21231028|ref|NP_636945.1|  DNA gyrase subunit A [Xanthomona...   242    1e-62   
gi|6630561|gb|AAF19580.1|AC011708_23  putative DNA gyrase A subun   242    1e-62 
gi|54297327|ref|YP_123696.1|  DNA gyrase, subunit A, type II t...   242    1e-62   
gi|91214852|ref|ZP_01251825.1|  DNA gyrase A subunit [Psychrof...   242    1e-62 
gi|70731664|ref|YP_261406.1|  DNA gyrase subunit A [Pseudomona...   242    1e-62   
gi|88705960|ref|ZP_01103668.1|  DNA gyrase, subunit A [gamma p...   242    1e-62 
gi|21518737|gb|AAM60780.1|AF516183_1  topoisomerase II subunit A    242    1e-62 
gi|86738730|ref|YP_479130.1|  DNA gyrase, A subunit [Frankia s...   242    1e-62   
gi|54021971|ref|YP_116213.1|  DNA gyrase subunit A [Nocardia f...   242    1e-62   
gi|21281735|ref|NP_644821.1|  DNA gyrase subunit A [Staphyloco...   242    1e-62   
gi|90407750|ref|ZP_01215928.1|  DNA gyrase, A subunit [Psychro...   242    2e-62 
gi|1346236|sp|P48371|GYRA_NEIGO  DNA gyrase subunit A >gi|5294...   242    2e-62 
gi|296396|emb|CAA50571.1|  DNA gyrase [Staphylococcus aureus]       242    2e-62 
gi|1346238|sp|P20831|GYRA_STAAU  DNA gyrase subunit A               242    2e-62 
gi|103486652|ref|YP_616213.1|  DNA gyrase, A subunit [Sphingop...   242    2e-62   
gi|15922996|ref|NP_370530.1|  DNA gyrase subunit A [Staphyloco...   242    2e-62   
gi|90412222|ref|ZP_01220228.1|  putative DNA topoisomerase (AT...   242    2e-62 
gi|90582049|ref|ZP_01237814.1|  DNA gyrase, subunit A [Staphyl...   241    2e-62 
gi|87160436|ref|YP_492728.1|  DNA gyrase, A subunit [Staphyloc...   241    2e-62   
gi|153086|gb|AAA73952.1|  DNA gyrase A subunit                      241    2e-62 
gi|57651114|ref|YP_184917.1|  DNA gyrase, A subunit [Staphyloc...   241    2e-62   
gi|15925711|ref|NP_373244.1|  DNA gyrase subunit A [Staphyloco...   241    2e-62   
gi|31044070|dbj|BAC76771.1|  DNA gyrase A [Treponema denticola]     241    2e-62 
gi|109647875|ref|ZP_01371778.1|  DNA gyrase, A subunit [Desulf...   241    2e-62 
gi|92909292|ref|ZP_01278070.1|  DNA gyrase, subunit A [Mycobac...   241    2e-62 
gi|42525811|ref|NP_970909.1|  DNA gyrase, A subunit [Treponema...   241    2e-62   
gi|89892752|ref|YP_516239.1|  DNA gyrase subunit A [Desulfitob...   241    2e-62   
gi|57865926|ref|YP_190089.1|  DNA gyrase, A subunit [Staphyloc...   241    2e-62   
gi|82749783|ref|YP_415524.1|  DNA gyrase subunit A [Staphyloco...   241    2e-62   
gi|77360364|ref|YP_339939.1|  DNA gyrase, subunit A, type II t...   241    2e-62   
gi|29374667|ref|NP_813819.1|  DNA gyrase, A subunit [Enterococ...   241    3e-62   
gi|111219513|ref|YP_710307.1|  DNA gyrase, subunit A, type II ...   241    3e-62   
gi|71737548|ref|YP_275809.1|  DNA gyrase, A subunit [Pseudomon...   241    3e-62   
gi|104773263|ref|YP_618243.1|  DNA gyrase, subunit A [Lactobac...   241    3e-62   
gi|28868951|ref|NP_791570.1|  DNA gyrase subunit A [Pseudomona...   241    3e-62   
gi|118065777|ref|ZP_01534037.1|  DNA gyrase, A subunit [Serrat...   241    3e-62 
gi|30681440|ref|NP_187680.2|  ATP binding / DNA binding / DNA ...   241    3e-62   
gi|89891307|ref|ZP_01202813.1|  DNA  gyrase (type IIA topoisom...   241    3e-62 
gi|1346229|sp|P48369|GYRA_AERSA  DNA gyrase subunit A >gi|1019...   241    4e-62 
gi|66046876|ref|YP_236717.1|  DNA gyrase subunit A [Pseudomona...   241    4e-62   
gi|2731385|gb|AAB95117.1|  DNA gyrase [Serratia marcescens]         241    4e-62 
gi|497648|gb|AAA57072.1|  DNA gyrase subunit A                      241    4e-62 
gi|12044854|ref|NP_072664.1|  DNA gyrase subunit A [Mycoplasma...   241    4e-62   
gi|86130322|ref|ZP_01048922.1|  DNA gyrase A subunit [Cellulop...   241    4e-62 
gi|77460299|ref|YP_349806.1|  DNA gyrase subunit A [Pseudomona...   241    4e-62   
gi|71083677|ref|YP_266397.1|  DNA gyrase subunit A [Candidatus...   240    4e-62   
gi|13507743|ref|NP_109692.1|  DNA gyrase subunit A [Mycoplasma...   240    4e-62   
gi|78368842|ref|ZP_00839043.1|  DNA gyrase, subunit A [Shewane...   240    5e-62 
gi|118164060|gb|ABK64957.1|  DNA gyrase, A subunit [Mycobacterium   240    5e-62 
gi|54309620|ref|YP_130640.1|  putative DNA topoisomerase (ATP-...   240    5e-62   
gi|121884|sp|P14829|GYRA_KLEOX  DNA gyrase subunit A >gi|43808...   240    5e-62 
gi|111020669|ref|YP_703641.1|  DNA topoisomerase subunit A [Rh...   240    6e-62   
gi|88805253|ref|ZP_01120772.1|  DNA gyrase A subunit [Robigini...   240    7e-62 
gi|69246711|ref|ZP_00604079.1|  DNA gyrase, subunit A [Enteroc...   240    7e-62 
gi|116513234|ref|YP_812140.1|  DNA gyrase, A subunit [Lactobac...   240    7e-62   
gi|41406104|ref|NP_958940.1|  DNA gyrase subunit A [Mycobacter...   239    7e-62   
gi|113946569|ref|ZP_01432256.1|  DNA gyrase, A subunit [Salini...   239    8e-62 
gi|75252690|sp|Q5YLB5|GYRA_NICBE  DNA gyrase subunit A, chloro...   239    8e-62 
gi|88810645|ref|ZP_01125902.1|  DNA gyrase, A subunit [Nitroco...   239    9e-62 
gi|1321899|emb|CAA63254.1|  gyrA [Mycobacterium smegmatis]          239    9e-62 
gi|52424913|ref|YP_088050.1|  DNA gyrase subunit A [Mannheimia...   239    9e-62   
gi|114772487|ref|ZP_01449860.1|  DNA gyrase subunit A [alpha p...   239    9e-62 
gi|72160413|ref|YP_288070.1|  DNA gyrase, subunit A [Thermobif...   239    1e-61   
gi|91763282|ref|ZP_01265246.1|  DNA gyrase subunit A [Candidat...   239    1e-61 
gi|68548475|ref|ZP_00587975.1|  DNA gyrase, subunit A [Shewane...   239    1e-61 
gi|46156537|ref|ZP_00132595.2|  COG0188: Type IIA topoisomeras...   239    1e-61 
gi|1346234|sp|P48354|GYRA_MYCSM  DNA gyrase subunit A >gi|1122...   239    1e-61 
gi|71279745|ref|YP_269051.1|  DNA gyrase, A subunit [Colwellia...   239    2e-61   
gi|106881252|ref|ZP_01348657.1|  DNA gyrase, A subunit [Psychr...   238    2e-61 
gi|15602706|ref|NP_245778.1|  DNA gyrase subunit A [Pasteurell...   238    2e-61   
gi|85374095|ref|YP_458157.1|  type IIA topoisomeraseA subunit ...   238    2e-61   
gi|13812136|ref|NP_113263.1|  DNA gyrase A-subunit [Guillardia...   238    2e-61   
gi|57505476|ref|ZP_00371404.1|  DNA gyrase, A subunit [Campylo...   238    2e-61 
gi|11068127|gb|AAB37247.2|  DNA gyrase subunit A [Mycoplasma homi   238    2e-61 
gi|71892249|ref|YP_277983.1|  DNA gyrase, subunit A [Candidatu...   238    2e-61   
gi|57168897|ref|ZP_00368027.1|  DNA gyrase, A subunit [Campylo...   238    2e-61 
gi|116617180|ref|YP_817551.1|  DNA gyrase, A subunit [Leuconos...   238    2e-61   
gi|25026571|ref|NP_736625.1|  DNA gyrase subunit A [Corynebact...   238    2e-61   
gi|108759045|ref|YP_629032.1|  DNA gyrase, A subunit [Myxococc...   238    3e-61   
gi|19551262|ref|NP_599264.1|  DNA gyrase subunit A [Corynebact...   238    3e-61   
gi|88758890|emb|CAJ77862.1|  DNA gyrase [Acinetobacter baumannii]   238    3e-61 
gi|115314422|ref|YP_763145.1|  DNA topoisomerase (ATP-hydrolyz...   238    3e-61   
gi|89255940|ref|YP_513302.1|  DNA gyrase, subunit A [Francisel...   238    3e-61   
gi|68229379|ref|ZP_00568574.1|  DNA gyrase, subunit A [Frankia...   238    3e-61 
gi|88602336|ref|YP_502514.1|  DNA gyrase, A subunit [Methanosp...   237    4e-61   
gi|77816749|ref|ZP_00815908.1|  DNA gyrase, subunit A [Shewane...   237    4e-61 
gi|118075102|ref|ZP_01543245.1|  DNA gyrase, A subunit [Shewan...   237    4e-61 
gi|32491194|ref|NP_871448.1|  hypothetical protein WGLp445 [Wi...   237    5e-61   
gi|83647663|ref|YP_436098.1|  DNA gyrase, A subunit [Hahella c...   237    5e-61   
gi|26553456|ref|NP_757390.1|  DNA gyrase subunit A [Mycoplasma...   237    5e-61   
gi|77163709|ref|YP_342234.1|  DNA gyrase, subunit A [Nitrosoco...   237    5e-61   
gi|2181179|emb|CAB09528.1|  gyrase alpha subunit [Acholeplasma...   237    5e-61 
gi|1226022|emb|CAA58885.1|  DNA gyrase; DNA topoisomerase (ATP...   237    5e-61 
gi|82743931|ref|ZP_00906544.1|  DNA gyrase, subunit A [Shewane...   237    6e-61 
gi|91770189|ref|ZP_01272017.1|  DNA gyrase, subunit A [Psychro...   237    6e-61 
gi|15643842|ref|NP_228890.1|  DNA gyrase, subunit A [Thermotog...   237    6e-61   
gi|46446708|ref|YP_008073.1|  DNA gyrase subunit A [Candidatus...   236    6e-61   
gi|89340328|ref|ZP_01192600.1|  DNA gyrase, subunit A:Protein ...   236    7e-61 
gi|50085721|ref|YP_047231.1|  DNA gyrase, subunit A, type II t...   236    8e-61   
gi|68543980|ref|ZP_00583661.1|  DNA gyrase, subunit A [Shewane...   236    8e-61 
gi|113951137|ref|ZP_01436729.1|  DNA gyrase, A subunit [Shewan...   236    8e-61 
gi|11498076|ref|NP_069301.1|  DNA gyrase, subunit A (gyrA) [Ar...   236    8e-61   
gi|118054902|ref|ZP_01523422.1|  DNA gyrase, A subunit [Fervid...   236    9e-61 
gi|15639000|ref|NP_218446.1|  DNA gyrase, subunit A (gyrA) [Tr...   236    1e-60   
gi|13357638|ref|NP_077912.1|  DNA gyrase subunit A [Ureaplasma...   236    1e-60   
gi|114563301|ref|YP_750814.1|  DNA gyrase, A subunit [Shewanel...   236    1e-60   
gi|57240554|ref|ZP_00368503.1|  DNA gyrase, A subunit [Campylo...   236    1e-60 
gi|56159846|gb|AAV80734.1|  gyrase subunit A [Bacillus sp. NRRL B   235    1e-60 
gi|78776839|ref|YP_393154.1|  DNA gyrase, subunit A [Thiomicro...   235    1e-60   
gi|116090721|gb|ABJ55987.1|  DNA gyrase subunit A [Bacillus subti   235    2e-60 
gi|29830865|ref|NP_825499.1|  DNA gyrase subunit A [Streptomyc...   235    2e-60   
gi|56708601|ref|YP_170497.1|  DNA gyrase, subunit A [Francisel...   235    2e-60   
gi|56159850|gb|AAV80736.1|  gyrase subunit A [Bacillus sp. NRRL B   235    2e-60 
gi|56159848|gb|AAV80735.1|  gyrase subunit A [Bacillus sp. NRRL B   235    2e-60 
gi|7437481|pir||T10970  DNA topoisomerase (ATP-hydrolyzing) (E...   235    2e-60 
gi|90202201|ref|ZP_01204847.1|  DNA gyrase, subunit A:Protein ...   235    2e-60 
gi|21222281|ref|NP_628060.1|  DNA gyrase subunit A [Streptomyc...   235    2e-60   
gi|88802494|ref|ZP_01118021.1|  DNA gyrase A subunit [Polariba...   235    2e-60 
gi|85708690|ref|ZP_01039756.1|  DNA gyrase subunit A [Erythrob...   235    2e-60 
gi|62185122|ref|YP_219907.1|  DNA gyrase subunit A [Chlamydoph...   235    2e-60   
gi|75430163|ref|ZP_00732662.1|  DNA gyrase (topoisomerase II) ...   235    2e-60 
gi|21672462|ref|NP_660529.1|  DNA gyrase subunit A [Buchnera a...   234    2e-60   
gi|117927217|ref|YP_871768.1|  DNA gyrase, A subunit [Acidothe...   234    3e-60   
gi|37679431|ref|NP_934040.1|  DNA gyrase, subunit A [Vibrio vu...   234    3e-60   
gi|21309846|gb|AAM46065.1|AF263924_4  DNA gyrase alpha subunit [P   234    3e-60 
gi|85857849|ref|YP_460051.1|  DNA gyrase subunit A [Syntrophus...   234    4e-60   
gi|38232651|ref|NP_938418.1|  DNA gyrase subunit A [Corynebact...   234    4e-60   
gi|56159858|gb|AAV80740.1|  gyrase subunit A [Bacillus sp. NRRL B   234    4e-60 
gi|116090719|gb|ABJ55986.1|  DNA gyrase subunit A [Bacillus liche   234    4e-60 
gi|2645226|gb|AAB87144.1|  topoisomerase II subunit A [Thermotoga   234    5e-60 
gi|27366307|ref|NP_761835.1|  Type IIA topoisomerase, A subuni...   233    5e-60   
gi|84497176|ref|ZP_00995998.1|  putative DNA gyrase subunit A ...   233    6e-60 
gi|75911523|gb|ABA29617.1|  DNA gyrase subunit A [Streptococcus p   233    6e-60 
gi|110003911|emb|CAK98251.1|  dna gyrase subunit a protein [Spiro   233    7e-60 
gi|58584662|ref|YP_198235.1|  DNA gyrase subunit A [Wolbachia ...   233    7e-60   
gi|56159860|gb|AAV80741.1|  gyrase subunit A [Bacillus sp. NRRL B   233    7e-60 
gi|81427622|ref|YP_394619.1|  DNA gyrase, A subunit [Lactobaci...   233    8e-60   
gi|114047554|ref|YP_738104.1|  DNA gyrase, A subunit [Shewanel...   233    9e-60   
gi|113970257|ref|YP_734050.1|  DNA gyrase, A subunit [Shewanel...   233    1e-59   
gi|56159834|gb|AAV80728.1|  gyrase subunit A [Bacillus subtilis]    233    1e-59 
gi|56159832|gb|AAV80727.1|  gyrase subunit A [Bacillus subtilis]    233    1e-59 
gi|56416621|ref|YP_153695.1|  DNA gyrase subunit A [Anaplasma ...   232    1e-59   
gi|117920417|ref|YP_869609.1|  DNA gyrase, A subunit [Shewanel...   232    1e-59   
gi|56159844|gb|AAV80733.1|  gyrase subunit A [Bacillus sp. NRRL B   232    1e-59 
gi|56159866|gb|AAV80744.1|  gyrase subunit A [Bacillus sp. NRRL B   232    1e-59 
gi|9230557|gb|AAF85899.1|  DNA gyrase A subunit [Streptococcus pn   232    1e-59 
gi|56159842|gb|AAV80732.1|  gyrase subunit A [Bacillus subtilis]    232    1e-59 
gi|111115262|ref|YP_709880.1|  DNA gyrase, subunit A [Borrelia...   232    1e-59   
gi|3891992|pdb|1AB4|   Chain  , 59kda Fragment Of Gyrase A From E   232    1e-59   
gi|56159864|gb|AAV80743.1|  gyrase subunit A [Bacillus sp. NRRL B   232    1e-59 
gi|24212706|ref|NP_710187.1|  DNA gyrase subunit A [Leptospira...   232    2e-59   
gi|20530727|gb|AAM27206.1|AF503576_1  DNA gyrase GyrA [Streptococ   232    2e-59 
gi|15673093|ref|NP_267267.1|  DNA gyrase subunit A [Lactococcu...   232    2e-59   
gi|116511953|ref|YP_809169.1|  DNA gyrase, A subunit [Lactococ...   232    2e-59   
gi|56159836|gb|AAV80729.1|  gyrase subunit A [Bacillus subtilis]    232    2e-59 
gi|56159828|gb|AAV80725.1|  gyrase subunit A [Bacillus subtilis]    232    2e-59 
gi|13810777|gb|AAK40033.1|AF272023_1  DNA gyrase subunit A [Ba...   232    2e-59 
gi|56159830|gb|AAV80726.1|  gyrase subunit A [Bacillus subtili...   232    2e-59 
gi|56159852|gb|AAV80737.1|  gyrase subunit A [Bacillus sp. NRRL B   231    2e-59 
gi|56159854|gb|AAV80738.1|  gyrase subunit A [Bacillus sp. NRR...   231    2e-59 
gi|24373958|ref|NP_718001.1|  DNA gyrase, A subunit [Shewanell...   231    2e-59   
gi|28189073|dbj|BAC56222.1|  DNA gyrase subunit A [Streptococcus    231    2e-59 
gi|9230555|gb|AAF85898.1|  DNA gyrase A subunit [Streptococcus pn   231    2e-59 
gi|109898785|ref|YP_662040.1|  DNA gyrase, A subunit [Pseudoal...   231    3e-59   
gi|13810763|gb|AAK40026.1|AF272016_1  DNA gyrase subunit A [Bacil   231    3e-59 
gi|56159870|gb|AAV80746.1|  gyrase subunit A [Bacillus sp. NRRL B   231    3e-59 
gi|91793303|ref|YP_562954.1|  DNA gyrase, A subunit [Shewanell...   231    3e-59   
gi|46578421|ref|YP_009229.1|  DNA gyrase, A subunit [Desulfovi...   231    3e-59   
gi|116326861|ref|YP_796581.1|  DNA gyrase subunit A [Leptospir...   231    3e-59   
gi|73662712|ref|YP_301493.1|  topoisomerase IV subunit A [Stap...   231    3e-59   
gi|28189077|dbj|BAC56225.1|  DNA gyrase subunit A [Streptococcus    231    4e-59 
gi|15594780|ref|NP_212569.1|  DNA gyrase, subunit A (gyrA) [Bo...   230    4e-59   
gi|28189081|dbj|BAC56228.1|  DNA gyrase subunit A [Streptococcus    230    4e-59 
gi|42521655|ref|NP_967035.1|  DNA gyrase subunit A [Bdellovibr...   230    5e-59   
gi|13810781|gb|AAK40035.1|AF272025_1  DNA gyrase subunit A [Bacil   230    5e-59 
gi|51598689|ref|YP_072877.1|  DNA gyrase, subunit A [Borrelia ...   230    5e-59   
gi|28492973|ref|NP_787134.1|  DNA gyrase subunit A [Tropheryma...   230    5e-59   
gi|115499631|dbj|BAF33489.1|  DNA gyrase subunit A [Listonella an   230    5e-59 
gi|94676657|ref|YP_588831.1|  DNA gyrase, A subunit [Baumannia...   230    5e-59   
gi|15606292|ref|NP_213671.1|  DNA gyrase A subunit [Aquifex ae...   230    5e-59   
gi|73916202|gb|AAZ92969.1|  DNA gyrase subunit A [Streptococcus p   230    6e-59 
gi|29828965|ref|NP_823599.1|  DNA gyrase subunit A [Streptomyc...   230    6e-59   
gi|73916160|gb|AAZ92948.1|  DNA gyrase subunit A [Streptococcus p   230    7e-59 
gi|73916122|gb|AAZ92929.1|  DNA gyrase subunit A [Streptococcus p   230    7e-59 
gi|73916126|gb|AAZ92931.1|  DNA gyrase subunit A [Streptococcu...   230    7e-59 
gi|73916170|gb|AAZ92953.1|  DNA gyrase subunit A [Streptococcu...   230    7e-59 
gi|73916156|gb|AAZ92946.1|  DNA gyrase subunit A [Streptococcu...   230    7e-59 
gi|3220195|gb|AAC23563.1|  DNA gyrase subunit A [Streptococcus pn   230    7e-59 
gi|73916192|gb|AAZ92964.1|  DNA gyrase subunit A [Streptococcus p   230    7e-59 
gi|73916216|gb|AAZ92976.1|  DNA gyrase subunit A [Streptococcu...   230    7e-59 
gi|73916230|gb|AAZ92983.1|  DNA gyrase subunit A [Streptococcu...   230    7e-59 
gi|73916176|gb|AAZ92956.1|  DNA gyrase subunit A [Streptococcus p   230    7e-59 
gi|15903142|ref|NP_358692.1|  DNA gyrase subunit A [Streptococ...   230    7e-59   
gi|56112326|gb|AAV71141.1|  GyrA [Bacillus amyloliquefaciens]       229    7e-59 
gi|4138535|emb|CAA06715.1|  DNA gyrase subunit A [Streptococcu...   229    8e-59 
gi|73916162|gb|AAZ92949.1|  DNA gyrase subunit A [Streptococcu...   229    8e-59 
gi|73916184|gb|AAZ92960.1|  DNA gyrase subunit A [Streptococcus p   229    8e-59 
gi|73916146|gb|AAZ92941.1|  DNA gyrase subunit A [Streptococcus p   229    8e-59 
gi|73916136|gb|AAZ92936.1|  DNA gyrase subunit A [Streptococcus p   229    8e-59 
gi|73916172|gb|AAZ92954.1|  DNA gyrase subunit A [Streptococcus p   229    8e-59 
gi|73916150|gb|AAZ92943.1|  DNA gyrase subunit A [Streptococcu...   229    8e-59 
gi|15901081|ref|NP_345685.1|  DNA gyrase subunit A [Streptococ...   229    8e-59   
gi|9230559|gb|AAF85900.1|  DNA gyrase A subunit [Streptococcus pn   229    8e-59 
gi|73916182|gb|AAZ92959.1|  DNA gyrase subunit A [Streptococcus p   229    8e-59 
gi|111185876|dbj|BAF02675.1|  DNA gyrase subunit A [Rhodococcus e   229    8e-59 
gi|33519927|ref|NP_878759.1|  DNA gyrase subunit A [Candidatus...   229    9e-59   
gi|73916228|gb|AAZ92982.1|  DNA gyrase subunit A [Streptococcus p   229    9e-59 
gi|73916124|gb|AAZ92930.1|  DNA gyrase subunit A [Streptococcus p   229    9e-59 
gi|15835809|ref|NP_300333.1|  DNA gyrase subunit A [Chlamydoph...   229    9e-59   
gi|93006548|ref|YP_580985.1|  DNA gyrase, A subunit [Psychroba...   229    9e-59   
gi|15618194|ref|NP_224479.1|  DNA gyrase subunit A [Chlamydoph...   229    1e-58   
gi|56159868|gb|AAV80745.1|  gyrase subunit A [Bacillus sp. NRRL B   229    1e-58 
gi|28189058|dbj|BAC56210.1|  DNA gyrase subunit A [Streptococcus    229    1e-58 
gi|71066098|ref|YP_264825.1|  putative DNA gyrase, subunit A [...   229    1e-58   
gi|73916140|gb|AAZ92938.1|  DNA gyrase subunit A [Streptococcus p   229    1e-58 
gi|73916142|gb|AAZ92939.1|  DNA gyrase subunit A [Streptococcus p   229    1e-58 
gi|62946516|gb|AAY22401.1|  GyrA [Bacillus subtilis]                229    1e-58 
gi|90021793|ref|YP_527620.1|  DNA gyrase subunit A [Saccharoph...   229    1e-58   
gi|3550980|dbj|BAA32701.1|  DNA gyrase A subunit [Streptococcus p   229    2e-58 
gi|104773994|ref|YP_618974.1|  DNA topoisomerase IV, subunit A...   228    2e-58   
gi|15835079|ref|NP_296838.1|  DNA gyrase subunit A [Chlamydia ...   228    2e-58   
gi|76788911|ref|YP_327997.1|  DNA gyrase subunit A [Chlamydia ...   228    2e-58   
gi|15604909|ref|NP_219693.1|  DNA gyrase subunit A [Chlamydia ...   228    2e-58   
gi|47079978|gb|AAT10175.1|  gyrase A [Bacillus mojavensis]          228    2e-58 
gi|81096122|ref|ZP_00874472.1|  DNA gyrase, subunit A [Strepto...   228    2e-58 
gi|55377341|ref|YP_135191.1|  DNA gyrase subunit A [Haloarcula...   228    2e-58   
gi|39938985|ref|NP_950751.1|  DNA gyrase alpha subunit [Onion ...   228    2e-58   
gi|57238973|ref|YP_180109.1|  DNA gyrase subunit A [Ehrlichia ...   228    3e-58   
gi|58616969|ref|YP_196168.1|  DNA gyrase subunit A [Ehrlichia ...   228    3e-58   
gi|28189068|dbj|BAC56218.1|  DNA gyrase subunit A [Streptococcus    228    3e-58 
gi|18253149|dbj|BAB83960.1|  DNA gyrase subunit A [Streptococcus    228    3e-58 
gi|85057534|ref|YP_456450.1|  DNA gyrase subunit A [Aster yell...   228    3e-58   
gi|89898308|ref|YP_515418.1|  DNA gyrase subunit A [Chlamydoph...   228    3e-58   
gi|91202854|emb|CAJ72493.1|  strongly similar to DNA gyrase su...   228    3e-58 
gi|47607410|gb|AAT36612.1|  gyrase A [Bacillus mojavensis]          227    4e-58 
gi|32448345|gb|AAO16801.1|  GyrA [Streptococcus pneumoniae]         227    4e-58 
gi|40786593|gb|AAR89868.1|  putative DNA gyrase/topoisomerase ...   227    4e-58 
gi|109691480|ref|ZP_01378548.1|  hypothetical protein Cjejd_01...   227    4e-58 
gi|47459329|ref|YP_016191.1|  DNA gyrase subunit A [Mycoplasma...   227    5e-58   
gi|116515057|ref|YP_802686.1|  DNA gyrase, A subunit [Buchnera...   227    5e-58   
gi|86150936|ref|ZP_01069152.1|  DNA gyrase, A subunit [Campylo...   227    5e-58 
gi|23465217|ref|NP_695820.1|  DNA gyrase subunit A [Bifidobact...   227    5e-58   
gi|110668557|ref|YP_658368.1|  DNA gyrase / DNA topoisomerase ...   227    6e-58   
gi|116668575|ref|YP_829508.1|  DNA gyrase, A subunit [Arthroba...   227    6e-58   
gi|31544927|ref|NP_853505.1|  DNA gyrase subunit A [Mycoplasma...   227    6e-58   
gi|23335944|ref|ZP_00121175.1|  COG0188: Type IIA topoisomeras...   226    6e-58 
gi|28916624|gb|AAO59545.1|  gyrase A [Bacillus mojavensis]          226    7e-58 
gi|86152939|ref|ZP_01071144.1|  DNA gyrase, A subunit [Campylo...   226    7e-58 
gi|15792354|ref|NP_282177.1|  DNA gyrase subunit A [Campylobac...   226    7e-58   
gi|86150440|ref|ZP_01068665.1|  DNA gyrase, A subunit [Campylo...   226    8e-58 
gi|71466854|emb|CAH41001.1|  DNA gyrase subunit A [Oenococcus oen   226    8e-58 
gi|28542821|gb|AAO42742.1|  DNA gyrase subunit A [Campylobacter j   226    8e-58 
gi|116490132|ref|YP_809657.1|  DNA gyrase, A subunit [Oenococc...   226    9e-58   
gi|28543251|gb|AAO42743.1|  DNA gyrase subunit A [Campylobacter j   226    1e-57 
gi|57237914|ref|YP_179162.1|  DNA gyrase subunit A [Campylobac...   226    1e-57   
gi|71365812|ref|ZP_00656362.1|  DNA gyrase, subunit A [Nocardi...   226    1e-57 
gi|42520999|ref|NP_966914.1|  DNA gyrase subunit A [Wolbachia ...   226    1e-57   
gi|42631834|ref|ZP_00157372.1|  COG0188: Type IIA topoisomeras...   226    1e-57 
gi|68250206|ref|YP_249318.1|  DNA gyrase subunit A [Haemophilu...   226    1e-57   
gi|478849|pir||S30571  DNA topoisomerase (ATP-hydrolyzing) (EC...   225    2e-57 
gi|21224180|ref|NP_629959.1|  DNA gyrase subunit A [Streptomyc...   225    2e-57   
gi|69286884|ref|ZP_00617665.1|  DNA gyrase, subunit A [Kineoco...   225    2e-57 
gi|13810761|gb|AAK40025.1|AF272015_1  DNA gyrase subunit A [Bacil   225    2e-57 
gi|68535073|ref|YP_249778.1|  DNA gyrase subunit A [Corynebact...   225    2e-57   
gi|85667686|ref|ZP_01029901.1|  hypothetical protein Badol_010...   224    2e-57 
gi|58336360|ref|YP_192945.1|  DNA gyrase subunit A [Lactobacil...   224    3e-57   
gi|24379546|ref|NP_721501.1|  DNA gyrase subunit A [Streptococ...   224    3e-57   
gi|87305841|ref|ZP_01087994.1|  DNA gyrase, A subunit [Campylo...   224    3e-57 
gi|13810767|gb|AAK40028.1|AF272018_1  DNA gyrase subunit A [Bacil   224    3e-57 
gi|13810765|gb|AAK40027.1|AF272017_1  DNA gyrase subunit A [Bacil   224    3e-57 
gi|50841504|ref|YP_054731.1|  DNA gyrase subunit A [Propioniba...   224    3e-57   
gi|89209969|ref|ZP_01188362.1|  DNA gyrase, subunit A [Halothe...   224    3e-57 
gi|73666865|ref|YP_302881.1|  DNA gyrase subunit A [Ehrlichia ...   224    3e-57   
gi|58698209|ref|ZP_00373130.1|  DNA gyrase, A subunit [Wolbach...   224    4e-57 
gi|94502320|ref|ZP_01308795.1|  DNA gyrase A subunit [Candidat...   224    4e-57 
gi|86160761|ref|YP_467546.1|  DNA gyrase, A subunit [Anaeromyx...   224    5e-57   
gi|2463534|dbj|BAA22542.1|  DNA gyrase subunit A [Streptococcus t   224    5e-57 
gi|16273182|ref|NP_439419.1|  DNA gyrase subunit A [Haemophilu...   224    5e-57   
gi|28916598|gb|AAO59532.1|  gyrase A [Bacillus amyloliquefaciens]   223    6e-57 
gi|13810775|gb|AAK40032.1|AF272022_1  DNA gyrase subunit A [Bacil   223    6e-57 
gi|25011002|ref|NP_735397.1|  DNA gyrase subunit A [Streptococ...   223    7e-57   
gi|32475579|ref|NP_868573.1|  DNA gyrase subunit A [Rhodopirel...   223    7e-57   
gi|28916618|gb|AAO59542.1|  gyrase A [Bacillus subtilis subsp. su   223    9e-57 
gi|28916596|gb|AAO59531.1|  gyrase A [Bacillus subtilis subsp. su   223    9e-57 
gi|29840267|ref|NP_829373.1|  DNA gyrase subunit A [Chlamydoph...   223    1e-56   
gi|68171271|ref|ZP_00544673.1|  DNA gyrase, subunit A [Ehrlich...   223    1e-56 
gi|28564562|dbj|BAC57595.1|  DNA gyraseA [Campylobacter jejuni]     223    1e-56 
gi|28916610|gb|AAO59538.1|  gyrase A [Bacillus subtilis subsp. su   223    1e-56 
gi|56420285|ref|YP_147603.1|  DNA topoisomerase IV subunit A [...   222    1e-56   
gi|58696764|ref|ZP_00372302.1|  DNA gyrase, A subunit [Wolbach...   222    1e-56 
gi|20530729|gb|AAM27207.1|AF503577_1  topoisomerase IV ParC [Stre   222    1e-56 
gi|9230563|gb|AAF85902.1|  topoisomerase IV subunit A [Streptococ   222    2e-56 
gi|14531024|gb|AAK63177.1|  topoisomerase IV subunit A [Streptoco   222    2e-56 
gi|109671795|ref|ZP_01374041.1|  hypothetical protein Ccon1_01...   222    2e-56 
gi|15790025|ref|NP_279849.1|  DNA gyrase subunit A [Halobacter...   222    2e-56   
gi|115380010|ref|ZP_01467060.1|  hypothetical protein STIAU_44...   222    2e-56 
gi|9230565|gb|AAF85903.1|  topoisomerase IV subunit A [Streptococ   221    2e-56 
gi|55823197|ref|YP_141638.1|  DNA gyrase subunit A [Streptococ...   221    2e-56   
gi|117928629|ref|YP_873180.1|  DNA gyrase/topoisomerase IV, su...   221    2e-56   
gi|55821284|ref|YP_139726.1|  DNA gyrase subunit A [Streptococ...   221    2e-56   
gi|76802388|ref|YP_327396.1|  DNA gyrase subunit A [Natronomon...   221    2e-56   
gi|42629396|ref|ZP_00154943.1|  COG0188: Type IIA topoisomeras...   221    2e-56 
gi|4959488|gb|AAD34369.1|AF129764_3  ParC [Streptococcus mitis]     221    2e-56 
gi|81428586|ref|YP_395586.1|  Topoisomerase IV, subunit A [Lac...   221    2e-56   
gi|116628018|ref|YP_820637.1|  DNA gyrase, A subunit [Streptoc...   221    2e-56   
gi|71894333|ref|YP_278441.1|  DNA gyrase subunit A [Mycoplasma...   221    3e-56   
gi|88607482|ref|YP_505474.1|  DNA gyrase, A subunit [Anaplasma...   221    3e-56   
gi|77409786|ref|ZP_00786437.1|  DNA gyrase, A subunit, truncat...   221    3e-56 
gi|28564560|dbj|BAC57594.1|  DNA gyrase A [Campylobacter jejuni]    221    3e-56 
gi|52080435|ref|YP_079226.1|  DNA topoisomerase IV subunit A [...   221    3e-56   
gi|73916866|gb|AAZ93301.1|  topoisomerase IV subunit A [Streptoco   221    4e-56 
gi|15902801|ref|NP_358351.1|  DNA topoisomerase IV subunit A [...   221    4e-56   
gi|32267132|ref|NP_861164.1|  DNA gyrase subunit A [Helicobact...   221    4e-56   
gi|28916592|gb|AAO59529.1|  gyrase A [Bacillus amyloliquefaciens]   221    4e-56 
gi|28916608|gb|AAO59537.1|  gyrase A [Bacillus amyloliquefaciens]   221    4e-56 
gi|73916826|gb|AAZ93281.1|  topoisomerase IV subunit A [Strept...   221    4e-56 
gi|73916846|gb|AAZ93291.1|  topoisomerase IV subunit A [Streptoco   221    4e-56 
gi|73916898|gb|AAZ93317.1|  topoisomerase IV subunit A [Streptoco   221    4e-56 
gi|73916900|gb|AAZ93318.1|  topoisomerase IV subunit A [Streptoco   221    4e-56 
gi|46019126|emb|CAE52027.1|  gyrase subunit A [Bacillus amyloliqu   221    4e-56 
gi|73916832|gb|AAZ93284.1|  topoisomerase IV subunit A [Streptoco   220    4e-56 
gi|28916600|gb|AAO59533.1|  gyrase A [Bacillus amyloliquefaciens]   220    5e-56 
gi|73916844|gb|AAZ93290.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916870|gb|AAZ93303.1|  topoisomerase IV subunit A [Strept...   220    5e-56 
gi|73916932|gb|AAZ93334.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916842|gb|AAZ93289.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916908|gb|AAZ93322.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916820|gb|AAZ93278.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916854|gb|AAZ93295.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916858|gb|AAZ93297.1|  topoisomerase IV subunit A [Strept...   220    5e-56 
gi|73916876|gb|AAZ93306.1|  topoisomerase IV subunit A [Strept...   220    5e-56 
gi|73916848|gb|AAZ93292.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|6851038|emb|CAA91551.2|  DNA topoisomerase IV [Streptococcus p   220    5e-56 
gi|27904671|ref|NP_777797.1|  DNA gyrase subunit A [Buchnera a...   220    5e-56   
gi|73916856|gb|AAZ93296.1|  topoisomerase IV subunit A [Streptoco   220    5e-56 
gi|73916822|gb|AAZ93279.1|  topoisomerase IV subunit A [Strept...   220    6e-56 
gi|73916824|gb|AAZ93280.1|  topoisomerase IV subunit A [Strept...   220    6e-56 
gi|111013719|gb|ABH03380.1|  DNA gyrase A subunit [Helicobacter p   220    6e-56 
gi|22537121|ref|NP_687972.1|  DNA gyrase subunit A [Streptococ...   220    6e-56   
gi|50953932|ref|YP_061220.1|  DNA gyrase subunit A [Leifsonia ...   220    6e-56   
gi|73916868|gb|AAZ93302.1|  topoisomerase IV subunit A [Strept...   220    7e-56 
gi|73916884|gb|AAZ93310.1|  topoisomerase IV subunit A [Strept...   220    7e-56 
gi|73916872|gb|AAZ93304.1|  topoisomerase IV subunit A [Streptoco   220    7e-56 
gi|32448550|gb|AAO16802.1|  ParC [Streptococcus pneumoniae]         220    7e-56 
gi|73916852|gb|AAZ93294.1|  topoisomerase IV subunit A [Streptoco   220    7e-56 
gi|73916890|gb|AAZ93313.1|  topoisomerase IV subunit A [Streptoco   220    7e-56 
gi|88854505|ref|ZP_01129172.1|  DNA gyrase subunit A [marine a...   220    7e-56 
gi|73916830|gb|AAZ93283.1|  topoisomerase IV subunit A [Strept...   220    7e-56 
gi|73916840|gb|AAZ93288.1|  topoisomerase IV subunit A [Streptoco   220    7e-56 
gi|9230567|gb|AAF85904.1|  topoisomerase IV subunit A [Streptococ   220    7e-56 
gi|77407105|ref|ZP_00784104.1|  DNA gyrase, A subunit, FRAMESH...   219    1e-55 
gi|111657636|ref|ZP_01408369.1|  hypothetical protein SpneT_02...   219    1e-55 
gi|9230561|gb|AAF85901.1|  topoisomerase IV subunit A [Streptococ   219    2e-55 
gi|73916836|gb|AAZ93286.1|  topoisomerase IV subunit A [Strept...   218    2e-55 
gi|1495800|emb|CAA65021.1|  DNA topoisomerase IV C subunit [Strep   218    2e-55 
gi|33469294|gb|AAQ19684.1|  topoisomerase IV subunit A [Staphyloc   218    2e-55 
gi|73916926|gb|AAZ93331.1|  topoisomerase IV subunit A [Streptoco   218    2e-55 
gi|73916850|gb|AAZ93293.1|  topoisomerase IV subunit A [Streptoco   218    2e-55 
gi|73916818|gb|AAZ93277.1|  topoisomerase IV subunit A [Streptoco   218    2e-55 
gi|70726554|ref|YP_253468.1|  DNA topoisomerase IV subunit A [...   218    2e-55   
gi|15900740|ref|NP_345344.1|  DNA topoisomerase IV subunit A [...   218    2e-55   
gi|28916604|gb|AAO59535.1|  gyrase A [Bacillus amyloliquefaciens]   218    2e-55 
gi|50364822|ref|YP_053247.1|  DNA gyrase subunit A [Mesoplasma...   218    3e-55   
gi|15616799|ref|NP_240011.1|  DNA gyrase subunit A [Buchnera a...   218    4e-55   
gi|28916620|gb|AAO59543.1|  gyrase A [Bacillus subtilis subsp. su   217    4e-55 
gi|72080859|ref|YP_287917.1|  DNA gyrase subunit A [Mycoplasma...   217    4e-55   
gi|71893880|ref|YP_279326.1|  DNA gyrase subunit A [Mycoplasma...   217    4e-55   
gi|19746099|ref|NP_607235.1|  DNA gyrase subunit A [Streptococ...   217    4e-55   
gi|109673729|ref|ZP_01375903.1|  hypothetical protein Ccur5_01...   217    5e-55 
gi|109644679|ref|ZP_01368599.1|  DNA gyrase, A subunit [Desulf...   217    5e-55 
gi|90587156|ref|ZP_01242827.1|  DNA gyrase/topoisomerase IV, s...   217    5e-55 
gi|54020243|ref|YP_116054.1|  DNA gyrase subunit A [Mycoplasma...   217    6e-55   
gi|28916602|gb|AAO59534.1|  gyrase A [Bacillus amyloliquefaciens]   216    7e-55 
gi|48478487|ref|YP_024193.1|  DNA gyrase subunit A [Picrophilu...   216    7e-55   
gi|58337413|ref|YP_193998.1|  DNA topoisomerase IV subunit A [...   216    8e-55   
gi|89894291|ref|YP_517778.1|  hypothetical protein DSY1545 [De...   216    8e-55   
gi|23465992|ref|NP_696595.1|  DNA gyrase subunit A [Bifidobact...   216    9e-55   
gi|49483548|ref|YP_040772.1|  DNA topoisomerase IV subunit A [...   216    9e-55   
gi|16082084|ref|NP_394514.1|  DNA gyrase subunit A [Thermoplas...   216    9e-55   
gi|34556798|ref|NP_906613.1|  DNA gyrase subunit A [Wolinella ...   216    1e-54   
gi|21282971|ref|NP_646059.1|  DNA topoisomerase IV subunit A [...   216    1e-54   
gi|94988622|ref|YP_596723.1|  DNA gyrase subunit A [Streptococ...   216    1e-54   
gi|62425100|ref|ZP_00380237.1|  COG0188: Type IIA topoisomeras...   216    1e-54 
gi|15614702|ref|NP_243005.1|  DNA topoisomerase IV subunit A [...   216    1e-54   
gi|90582413|ref|ZP_01238177.1|  Gram positive topoisomerase IV...   216    1e-54 
gi|50914216|ref|YP_060188.1|  DNA gyrase subunit A [Streptococ...   216    1e-54   
gi|28916590|gb|AAO59528.1|  gyrase A [Bacillus subtilis]            216    1e-54 
gi|21518734|gb|AAM60779.1|  topoisomerase IV subunit A [Corynebac   216    1e-54 
gi|73916874|gb|AAZ93305.1|  topoisomerase IV subunit A [Strept...   216    1e-54 
gi|94990497|ref|YP_598597.1|  DNA gyrase subunit A [Streptococ...   216    1e-54   
gi|15675129|ref|NP_269303.1|  DNA gyrase subunit A [Streptococ...   216    1e-54   
gi|21910346|ref|NP_664614.1|  DNA gyrase subunit A [Streptococ...   216    1e-54   
gi|113199400|ref|ZP_01410902.1|  hypothetical protein Cfetf_01...   216    1e-54 
gi|87160035|ref|YP_493948.1|  DNA topoisomerase IV, subunit A ...   216    1e-54   
gi|15924345|ref|NP_371879.1|  DNA topoisomerase IV subunit A [...   216    1e-54   
gi|114152112|sp|P0C1U9|PARC_STAAU  DNA topoisomerase 4 subunit...   216    1e-54 
gi|72162530|ref|YP_290187.1|  DNA gyrase subunit A [Thermobifi...   215    1e-54   
gi|57650359|ref|YP_186243.1|  DNA topoisomerase IV subunit A [...   215    2e-54   
gi|50842527|ref|YP_055754.1|  DNA gyrase subunit A [Propioniba...   215    2e-54   
gi|15926935|ref|NP_374468.1|  DNA topoisomerase IV subunit A [...   215    2e-54   
gi|49486198|ref|YP_043419.1|  DNA topoisomerase IV subunit A [...   215    2e-54   
gi|15672966|ref|NP_267140.1|  DNA topoisomerase IV subunit A [...   215    2e-54   
gi|561880|gb|AAA53116.1|  gyrase-like protein alpha subunit         215    2e-54 
gi|116511813|ref|YP_809029.1|  DNA topoisomerase IV subunit A ...   214    2e-54   
gi|56807930|ref|ZP_00365752.1|  COG0188: Type IIA topoisomeras...   214    3e-54 
gi|106886251|ref|ZP_01353595.1|  DNA gyrase/topoisomerase IV, ...   214    3e-54 
gi|13541373|ref|NP_111061.1|  DNA gyrase subunit A [Thermoplas...   214    3e-54   
gi|15828618|ref|NP_325978.1|  DNA gyrase subunit A [Mycoplasma...   214    3e-54   
gi|88608652|ref|YP_506822.1|  DNA gyrase, A subunit [Neoricket...   214    4e-54   
gi|82750948|ref|YP_416689.1|  topoisomerase IV subunit A [Stap...   214    4e-54   
gi|81096605|ref|ZP_00874943.1|  Gram positive topoisomerase IV...   214    4e-54 
gi|28916616|gb|AAO59541.1|  gyrase A [Bacillus subtilis]            214    4e-54 
gi|94988399|ref|YP_596500.1|  topoisomerase IV subunit A [Stre...   214    4e-54   
gi|83280995|dbj|BAE53572.1|  gyrase alpha subunit [Thermoplasma a   214    5e-54 
gi|28916622|gb|AAO59544.1|  gyrase A [Bacillus amyloliquefaciens]   213    7e-54 
gi|116492721|ref|YP_804456.1|  DNA topoisomerase IV subunit A ...   213    8e-54   
gi|46019112|emb|CAE52020.1|  gyrase subunit A [Bacillus subtilis]   213    8e-54 
gi|19745974|ref|NP_607110.1|  DNA topoisomerase IV subunit A [...   213    8e-54   
gi|71903357|ref|YP_280160.1|  DNA topoisomerase IV subunit A [...   213    9e-54   
gi|116629642|ref|YP_814814.1|  DNA topoisomerase IV subunit A ...   213    1e-53   
gi|21910161|ref|NP_664429.1|  DNA topoisomerase IV subunit A [...   212    1e-53   
gi|73921620|sp|Q5XCJ9|PARC_STRP6  DNA topoisomerase 4 subunit A (   212    1e-53 
gi|94990280|ref|YP_598380.1|  Topoisomerase IV subunit A [Stre...   212    1e-53   
gi|50914075|ref|YP_060047.1|  DNA topoisomerase IV subunit A [...   212    1e-53   
gi|28896140|ref|NP_802490.1|  DNA topoisomerase IV subunit A [...   212    1e-53   
gi|71910525|ref|YP_282075.1|  DNA topoisomerase IV subunit A [...   212    1e-53   
gi|15674931|ref|NP_269105.1|  DNA topoisomerase IV subunit A [...   212    1e-53   
gi|94994200|ref|YP_602298.1|  Topoisomerase IV subunit A [Stre...   212    2e-53   
gi|2558947|gb|AAB81615.1|  ParC [Bacillus subtilis]                 212    2e-53 
gi|62423515|ref|ZP_00378677.1|  COG0188: Type IIA topoisomeras...   212    2e-53 
gi|85667302|ref|ZP_01029521.1|  hypothetical protein Badol_010...   211    2e-53 
gi|27467955|ref|NP_764592.1|  DNA topoisomerase IV subunit A [...   211    2e-53   
gi|69269840|ref|ZP_00610144.1|  DNA gyrase, subunit A [Ferropl...   211    2e-53 
gi|16078871|ref|NP_389692.1|  DNA topoisomerase IV subunit A [...   211    2e-53   
gi|94985121|ref|YP_604485.1|  DNA gyrase, A subunit [Deinococc...   211    3e-53   
gi|46019128|emb|CAE52028.1|  gyrase subunit A [Bacillus subtil...   211    3e-53 
gi|83953740|ref|ZP_00962461.1|  DNA gyrase subunit A [Sulfitob...   211    3e-53 
gi|57866862|ref|YP_188505.1|  DNA topoisomerase IV subunit A [...   211    4e-53   
gi|89202826|ref|ZP_01181533.1|  Gram positive topoisomerase IV...   211    4e-53 
gi|116670188|ref|YP_831121.1|  DNA gyrase/topoisomerase IV, su...   210    5e-53   
gi|83816214|ref|YP_445607.1|  type II DNA topoisomerase, A sub...   210    7e-53   
gi|89209136|ref|ZP_01187594.1|  Gram positive topoisomerase IV...   210    8e-53 
gi|116333452|ref|YP_794979.1|  DNA topoisomerase IV subunit A ...   209    8e-53   
gi|92090126|ref|ZP_01275027.1|  Gram positive topoisomerase IV...   209    9e-53 
gi|71368769|ref|ZP_00659254.1|  DNA gyrase/topoisomerase IV, s...   209    9e-53 
gi|89090382|ref|ZP_01163431.1|  Gram positive topoisomerase IV...   209    9e-53 
gi|28493458|ref|NP_787619.1|  DNA gyrase subunit A [Tropheryma...   209    1e-52   
gi|28572429|ref|NP_789209.1|  DNA gyrase subunit A [Tropheryma...   209    1e-52   
gi|603238|gb|AAA57342.1|  DNA gyrase A subunit >gi|1583653|prf...   209    1e-52 
gi|15806912|ref|NP_295636.1|  DNA gyrase, subunit A [Deinococc...   209    1e-52   
gi|69937397|ref|ZP_00632063.1|  Gram negative topoisomerase IV...   209    1e-52 
gi|55820668|ref|YP_139110.1|  DNA topoisomerase IV subunit A [...   208    2e-52   
gi|77412214|ref|ZP_00788533.1|  DNA topoisomerase IV, A subuni...   208    2e-52 
gi|116627478|ref|YP_820097.1|  DNA topoisomerase IV subunit A ...   208    2e-52   
gi|28916612|gb|AAO59539.1|  gyrase A [Bacillus subtilis subsp. su   208    2e-52 
gi|77408983|ref|ZP_00785704.1|  DNA topoisomerase IV, A subuni...   208    3e-52 
gi|22537311|ref|NP_688162.1|  DNA topoisomerase IV subunit A [...   208    3e-52   
gi|77405907|ref|ZP_00782988.1|  DNA topoisomerase IV, A subuni...   208    3e-52 
gi|76799493|ref|ZP_00781631.1|  DNA topoisomerase IV, A subuni...   208    3e-52 
gi|25011277|ref|NP_735672.1|  DNA topoisomerase IV subunit A [...   208    3e-52   
gi|56963753|ref|YP_175484.1|  DNA topoisomerase IV subunit A [...   208    3e-52   
gi|27262294|gb|AAN87428.1|  DNA gyrase subunit A [Heliobacillus m   208    3e-52 
gi|13507862|ref|NP_109811.1|  topoisomerase IV subunit A [Myco...   207    3e-52   
gi|42782666|ref|NP_979913.1|  DNA topoisomerase IV subunit A [...   207    5e-52   
gi|30263544|ref|NP_845921.1|  DNA topoisomerase IV subunit A [...   207    5e-52   
gi|83949819|ref|ZP_00958552.1|  DNA topoisomerase IV subunit A...   207    5e-52 
gi|89053044|ref|YP_508495.1|  DNA topoisomerase IV, A subunit ...   207    6e-52   
gi|47570275|ref|ZP_00240925.1|  DNA topoisomerase IV, A subuni...   207    6e-52 
gi|30021697|ref|NP_833328.1|  DNA topoisomerase IV subunit A [...   207    6e-52   
gi|88856908|ref|ZP_01131560.1|  DNA gyrase subunit A [marine a...   207    6e-52 
gi|42519097|ref|NP_965027.1|  DNA topoisomerase IV subunit A [...   206    8e-52   
gi|32472531|ref|NP_865525.1|  DNA gyrase subunit A [Rhodopirel...   206    8e-52   
gi|42560567|ref|NP_975018.1|  DNA Gyrase Subunit A [Mycoplasma...   206    9e-52   
gi|85705044|ref|ZP_01036144.1|  DNA topoisomerase IV subunit A...   206    9e-52 
gi|29376173|ref|NP_815327.1|  DNA topoisomerase IV subunit A [...   205    2e-51   
gi|15982571|dbj|BAB69481.1|  topoisomerase IV A subunit [Enteroco   205    2e-51 
gi|109947505|ref|YP_664733.1|  DNA gyrase subunit A [Helicobac...   205    2e-51   
gi|15645324|ref|NP_207495.1|  DNA gyrase subunit A [Helicobact...   204    3e-51   
gi|83319625|ref|YP_424037.1|  DNA gyrase, A subunit [Mycoplasm...   204    3e-51   
gi|83941524|ref|ZP_00953986.1|  DNA topoisomerase IV subunit A...   204    3e-51 
gi|62719469|gb|AAX93335.1|  DNA gyrase A subunit [Lactobacillus s   204    4e-51 
gi|84685508|ref|ZP_01013406.1|  DNA topoisomerase IV, A subuni...   203    6e-51 
gi|28378500|ref|NP_785392.1|  DNA topoisomerase IV subunit A [...   203    6e-51   
gi|508471|gb|AAA74376.1|  gyrase A                                  203    7e-51 
gi|84496203|ref|ZP_00995057.1|  DNA gyrase subunit A [Janibact...   203    8e-51 
gi|47094547|ref|ZP_00232209.1|  DNA gyrase/topoisomerase IV, A...   202    1e-50 
gi|108563111|ref|YP_627427.1|  DNA gyrase subunit A [Helicobac...   202    1e-50   
gi|16803327|ref|NP_464812.1|  DNA topoisomerase IV subunit A [...   202    1e-50   
gi|24379629|ref|NP_721584.1|  DNA topoisomerase IV subunit A [...   202    1e-50   
gi|15611708|ref|NP_223359.1|  DNA gyrase subunit A [Helicobact...   202    1e-50   
gi|47097247|ref|ZP_00234808.1|  DNA topoisomerase IV, A subuni...   202    1e-50 
gi|116491057|ref|YP_810601.1|  DNA topoisomerase IV subunit A ...   202    2e-50   
gi|116618458|ref|YP_818829.1|  DNA topoisomerase IV subunit A ...   202    2e-50   
gi|83855001|ref|ZP_00948531.1|  DNA topoisomerase IV subunit A...   201    2e-50 
gi|46907514|ref|YP_013903.1|  DNA topoisomerase IV subunit A [...   201    2e-50   
gi|23099149|ref|NP_692615.1|  DNA topoisomerase IV subunit A [...   201    3e-50   
gi|16800394|ref|NP_470662.1|  DNA topoisomerase IV subunit A [...   201    3e-50   
gi|116872720|ref|YP_849501.1|  DNA topoisomerase IV, A subunit...   200    6e-50   
gi|110678712|ref|YP_681719.1|  DNA topoisomerase IV, A subunit...   200    7e-50   
gi|89070809|ref|ZP_01158057.1|  DNA topoisomerase IV subunit A...   200    7e-50 
gi|56695629|ref|YP_165980.1|  DNA topoisomerase IV subunit A [...   200    8e-50   
gi|23011502|ref|ZP_00051841.1|  COG0188: Type IIA topoisomeras...   200    8e-50 
gi|69289213|ref|ZP_00618620.1|  DNA topoisomerase (ATP-hydroly...   199    1e-49 
gi|114764505|ref|ZP_01443730.1|  DNA topoisomerase IV subunit ...   199    1e-49 
gi|50954717|ref|YP_062005.1|  DNA gyrase subunit A [Leifsonia ...   199    2e-49   
gi|83367875|ref|ZP_00912742.1|  Gram negative topoisomerase IV...   198    2e-49 
gi|90961849|ref|YP_535765.1|  Topoisomerase IV subunit A [Lact...   198    2e-49   
gi|83319790|ref|YP_424430.1|  DNA topoisomerase IV, A subunit ...   198    2e-49   
gi|83311684|ref|YP_421948.1|  Type IIA topoisomerase, A subuni...   198    2e-49   
gi|42561046|ref|NP_975497.1|  TOPOISOMERASE IV SUBUNIT A [Myco...   198    3e-49   
gi|118133402|gb|ABK60446.1|  DNA gyrase, A subunit [Clostridium n   198    3e-49 
gi|110004709|emb|CAK99044.1|  probable topoisomerase iv subunit a   197    3e-49 
gi|12045056|ref|NP_072866.1|  DNA topoisomerase IV, A subunit ...   197    5e-49   
gi|75763035|ref|ZP_00742825.1|  Topoisomerase IV subunit A [Ba...   197    5e-49 
gi|68053906|ref|ZP_00538071.1|  Gram positive topoisomerase IV...   197    6e-49 
gi|28211415|ref|NP_782359.1|  DNA topoisomerase IV subunit A [...   196    8e-49   
gi|113942588|ref|ZP_01428292.1|  DNA gyrase/topoisomerase IV, ...   196    8e-49 
gi|82744989|ref|ZP_00907503.1|  DNA gyrase/topoisomerase IV, s...   196    1e-48 
gi|83371936|ref|ZP_00916716.1|  Gram negative topoisomerase IV...   196    1e-48 
gi|86135755|ref|ZP_01054334.1|  DNA topoisomerase IV, A subuni...   195    2e-48 
gi|116494895|ref|YP_806629.1|  DNA topoisomerase IV subunit A ...   195    2e-48   
gi|84515184|ref|ZP_01002547.1|  DNA topoisomerase IV subunit A...   195    2e-48 
gi|13810771|gb|AAK40030.1|AF272020_1  DNA gyrase subunit A [Bacil   195    2e-48 
gi|77462241|ref|YP_351745.1|  DNA topoisomerase IV subunit A [...   195    2e-48   
gi|99082272|ref|YP_614426.1|  DNA topoisomerase IV, A subunit ...   195    3e-48   
gi|50379830|gb|AAT76293.1|  DNA gyrase subunit A [Fusobacterium c   194    3e-48 
gi|66880186|ref|ZP_00405170.1|  COG0188: Type IIA topoisomeras...   194    4e-48 
gi|50379887|gb|AAT76296.1|  DNA gyrase subunit A [Fusobacterium c   194    4e-48 
gi|84499895|ref|ZP_00998161.1|  DNA topoisomerase IV subunit A...   194    5e-48 
gi|806907|gb|AAC43991.1|  PAR-C                                     193    7e-48 
gi|13358030|ref|NP_078304.1|  topoisomerase IV subunit A [Urea...   193    8e-48   
gi|83648063|ref|YP_436498.1|  DNA topoisomerase IV, A subunit ...   193    8e-48   
gi|117654295|gb|ABK55578.1|  DNA gyrase subunit A [Bacillus mo...   192    2e-47 
gi|15894906|ref|NP_348255.1|  DNA topoisomerase IV subunit A [...   192    2e-47   
gi|50365126|ref|YP_053551.1|  DNA topoisomerase IV subunit A [...   191    2e-47   
gi|117654239|gb|ABK55550.1|  DNA gyrase subunit A [Bacillus at...   191    2e-47 
gi|56415115|ref|YP_152190.1|  DNA topoisomerase IV subunit A [...   191    3e-47   
gi|71057503|emb|CAJ18964.1|  topoisomerse IV subunit [Salmonella    191    3e-47 
gi|28916594|gb|AAO59530.1|  gyrase A [Bacillus subtilis subsp. sp   191    4e-47 
gi|117654265|gb|ABK55563.1|  DNA gyrase subunit A [Bacillus su...   191    4e-47 
gi|117654301|gb|ABK55581.1|  DNA gyrase subunit A [Bacillus mojav   190    6e-47 
gi|117654255|gb|ABK55558.1|  DNA gyrase subunit A [Bacillus am...   190    6e-47 
gi|117654209|gb|ABK55535.1|  DNA gyrase subunit A [Bacillus li...   190    6e-47 
gi|117654267|gb|ABK55564.1|  DNA gyrase subunit A [Bacillus subti   190    7e-47 
gi|117654305|gb|ABK55583.1|  DNA gyrase subunit A [Bacillus mojav   190    7e-47 
gi|26554099|ref|NP_758033.1|  DNA topoisomerase IV subunit A [...   190    7e-47   
gi|117654279|gb|ABK55570.1|  DNA gyrase subunit A [Bacillus su...   190    7e-47 
gi|117654313|gb|ABK55587.1|  DNA gyrase subunit A [Bacillus sp. 3   190    8e-47 
gi|13810773|gb|AAK40031.1|AF272021_1  DNA gyrase subunit A [Bacil   189    1e-46 
gi|117654215|gb|ABK55538.1|  DNA gyrase subunit A [Bacillus li...   189    1e-46 
gi|117654281|gb|ABK55571.1|  DNA gyrase subunit A [Bacillus subti   189    1e-46 
gi|117654319|gb|ABK55590.1|  DNA gyrase subunit A [Bacillus atrop   189    1e-46 
gi|16761950|ref|NP_457567.1|  DNA topoisomerase IV subunit A [...   189    1e-46   
gi|62181688|ref|YP_218105.1|  DNA topoisomerase IV subunit A [...   189    1e-46   
gi|16766474|ref|NP_462089.1|  DNA topoisomerase IV subunit A [...   189    1e-46   
gi|88797643|ref|ZP_01113232.1|  DNA topoisomerase IV, A subuni...   189    2e-46 
gi|117654345|gb|ABK55603.1|  DNA gyrase subunit A [Bacillus halod   189    2e-46 
gi|78367101|ref|ZP_00837375.1|  Gram negative topoisomerase IV...   189    2e-46 
gi|117654343|gb|ABK55602.1|  DNA gyrase subunit A [Bacillus valli   189    2e-46 
gi|28916614|gb|AAO59540.1|  gyrase A [Bacillus amyloliquefaciens]   188    2e-46 
gi|75229297|ref|ZP_00715856.1|  COG0188: Type IIA topoisomeras...   188    3e-46 
gi|15803563|ref|NP_289596.1|  DNA topoisomerase IV subunit A [...   188    3e-46   
gi|117654211|gb|ABK55536.1|  DNA gyrase subunit A [Bacillus liche   187    3e-46 
gi|117654189|gb|ABK55525.1|  DNA gyrase subunit A [Bacillus li...   187    3e-46 
gi|114564486|ref|YP_752000.1|  DNA topoisomerase IV, A subunit...   187    3e-46   
gi|82778369|ref|YP_404718.1|  DNA topoisomerase IV subunit A [...   187    3e-46   
gi|82545280|ref|YP_409227.1|  DNA topoisomerase IV subunit A [...   187    3e-46   
gi|147106|gb|AAA24297.1|  topoisomerase IV subunit                  187    3e-46 
gi|71042522|pdb|1ZVU|A  Chain A, Structure Of The Full-Length E.    187    3e-46   
gi|75178923|ref|ZP_00698959.1|  COG0188: Type IIA topoisomeras...   187    3e-46 
gi|75240524|ref|ZP_00724452.1|  COG0188: Type IIA topoisomeras...   187    3e-46 
gi|26249591|ref|NP_755631.1|  DNA topoisomerase IV subunit A [...   187    4e-46   
gi|117654289|gb|ABK55575.1|  DNA gyrase subunit A [Bacillus subti   187    4e-46 
gi|74313561|ref|YP_311980.1|  DNA topoisomerase IV subunit A [...   187    4e-46   
gi|83593183|ref|YP_426935.1|  Gram negative topoisomerase IV, ...   187    4e-46   
gi|117654167|gb|ABK55514.1|  DNA gyrase subunit A [Bacillus li...   187    4e-46 
gi|117654183|gb|ABK55522.1|  DNA gyrase subunit A [Bacillus liche   187    5e-46 
gi|84703883|ref|ZP_01017711.1|  DNA topoisomerase IV subunit A...   187    5e-46 
gi|154235|gb|AAA27180.1|  parC                                      186    7e-46 
gi|111617848|ref|ZP_01404875.1|  DNA topoisomerase IV, A subun...   186    8e-46 
gi|4886575|dbj|BAA77789.1|  DNA topoisomerase IV [Vibrio parahaem   186    1e-45 
gi|28916606|gb|AAO59536.1|  gyrase A [Bacillus mojavensis]          186    1e-45 
gi|71899845|ref|ZP_00681994.1|  Gram negative topoisomerase IV...   186    1e-45 
gi|56159862|gb|AAV80742.1|  gyrase subunit A [Bacillus sp. NRRL B   185    2e-45 
gi|110803503|ref|YP_699348.1|  DNA topoisomerase, GyrA/ParC su...   185    2e-45   
gi|110799869|ref|YP_696748.1|  DNA topoisomerase, GyrA/ParC su...   185    2e-45   
gi|53805051|ref|YP_113320.1|  DNA topoisomerase IV subunit A [...   185    2e-45   
gi|18311050|ref|NP_562984.1|  DNA topoisomerase IV subunit A [...   185    2e-45   
gi|6502510|gb|AAF14339.1|U86302_2  ParC [Caulobacter crescentu...   185    2e-45 
gi|16125813|ref|NP_420377.1|  DNA topoisomerase IV subunit A [...   185    2e-45   
gi|71277810|ref|YP_270822.1|  DNA topoisomerase IV, A subunit ...   185    2e-45   
gi|89360921|ref|ZP_01198738.1|  Gram negative topoisomerase IV...   184    3e-45 
gi|117619627|ref|YP_858203.1|  DNA topoisomerase IV, A subunit...   184    3e-45   
gi|28897205|ref|NP_796810.1|  DNA topoisomerase IV subunit A [...   184    3e-45   
gi|116183476|ref|ZP_01473470.1|  hypothetical protein VEx2w_02003   184    4e-45 
gi|31544623|ref|NP_853201.1|  ParC/GyrA [Mycoplasma gallisepti...   184    4e-45   
gi|92117770|ref|YP_577499.1|  DNA topoisomerase IV, A subunit ...   184    4e-45   
gi|53728649|ref|ZP_00131992.2|  COG0188: Type IIA topoisomeras...   184    4e-45 
gi|117654165|gb|ABK55513.1|  DNA gyrase subunit A [Bacillus liche   184    5e-45 
gi|88948755|ref|ZP_01151518.1|  Gram negative topoisomerase IV...   184    5e-45 
gi|91770118|ref|ZP_01271947.1|  Gram negative topoisomerase IV...   183    6e-45 
gi|91228381|ref|ZP_01262308.1|  DNA topoisomerase IV subunit A...   183    6e-45 
gi|94492743|ref|ZP_01299950.1|  hypothetical protein CburD_010...   183    7e-45 



>gi|78778390|ref|YP_396502.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
str. MIT 9312]
 gi|78711889|gb|ABB49066.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
str. MIT 9312]
Length=813

 Score =  456 bits (1174),  Expect = 4e-127, Method: Composition-based stats.
 Identities = 254/283 (89%), Positives = 269/283 (95%), Gaps = 0/283 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
            GFLEEI SETVNFSNNFDGSQKEPDVLPAQLPFL LNGSSGIAVGMATNIPPHNLGEIVD
Sbjct  132  GFLEEIDSETVNFSNNFDGSQKEPDVLPAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIAL+ NK+++NKKLS IIKGPDFPTGGELI ++AIEELY TGKGS+ IRGVIN E IN
Sbjct  192  GLIALINNKEVSNKKLSNIIKGPDFPTGGELIYSRAIEELYATGKGSITIRGVINSEAIN  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
            LGKGKHKRNALIITELP+QISKAGWIEKLAELVNS+KINGI+DIRDESDRDGMRIVIELK
Sbjct  252  LGKGKHKRNALIITELPFQISKAGWIEKLAELVNSSKINGISDIRDESDRDGMRIVIELK  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            KDSN ELVISNLYKKTTLQTNFGAIFL L++GKPVQLNLKQYLNYFLEFREETIRKRT Y
Sbjct  312  KDSNAELVISNLYKKTTLQTNFGAIFLALIKGKPVQLNLKQYLNYFLEFREETIRKRTNY  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
            FLKNTLEKLEILEGLSKATK+IK+IIEIIE+SENS EAKSKLI
Sbjct  372  FLKNTLEKLEILEGLSKATKNIKKIIEIIEDSENSAEAKSKLI  414


>gi|33860565|ref|NP_892126.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
subsp. pastoris str. CCMP1986]
 gi|33633507|emb|CAE18464.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
subsp. pastoris str. CCMP1986]
Length=813

 Score =  417 bits (1072),  Expect = 3e-115, Method: Composition-based stats.
 Identities = 217/282 (76%), Positives = 251/282 (89%), Gaps = 0/282 (0%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
            FL+EI SETV++SNNFDGSQ+EPD+LPAQLPFL LNGSSGIAVGMATNIPPHNLGEIVD 
Sbjct  133  FLQEIGSETVSYSNNFDGSQQEPDILPAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVDG  192

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL  121
            LIAL+ +K+I++ +LSKII GPDFPTGGELI N A+ E+Y  G+GSV +RGVI  EEINL
Sbjct  193  LIALINDKEISDLRLSKIILGPDFPTGGELICNSAMNEVYLQGRGSVTVRGVIKNEEINL  252

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
            GKG+HK+NALII+ELPYQISKAGWIEKLAELVN  KI+GI+DIRDESDRDGMR+VIELKK
Sbjct  253  GKGRHKKNALIISELPYQISKAGWIEKLAELVNLGKIDGISDIRDESDRDGMRVVIELKK  312

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
            DSN+E+V+SNL+KKT LQ+NFGAIFL LV GKP+QL L++YLNYFLEFREETIRKRT YF
Sbjct  313  DSNSEIVVSNLFKKTALQSNFGAIFLALVDGKPIQLTLRKYLNYFLEFREETIRKRTKYF  372

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
            L+   EK EILEG S ATK+IK IIE+I+ SEN+ EAKS LI
Sbjct  373  LRIASEKFEILEGFSIATKNIKDIIEVIQNSENATEAKSILI  414


>gi|56752405|ref|YP_173106.1|  DNA gyrase A subunit [Synechococcus elongatus PCC 6301]
 gi|56687364|dbj|BAD80586.1|  DNA gyrase A subunit [Synechococcus elongatus PCC 6301]
Length=858

 Score =  355 bits (912),  Expect = 1e-96, Method: Composition-based stats.
 Identities = 166/282 (58%), Positives = 219/282 (77%), Gaps = 0/282 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              LEEI  ETV+F  NFD SQ+EP VLPAQLPFL LNG SGIAVGMATNIPPHNLGEIVD
Sbjct  139  ALLEEIGEETVDFVANFDNSQQEPSVLPAQLPFLLLNGCSGIAVGMATNIPPHNLGEIVD  198

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
            ALIAL++   ++++ L + + GPDFPTGGE+I +Q I + Y  G+GS+ +RG+   EEI 
Sbjct  199  ALIALIDRPQLSDRDLLRYVPGPDFPTGGEVIGSQGILDAYLEGRGSIPVRGIARIEEIQ  258

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKG+H+R  +I+TELPYQ+SKAGWIEK+A+LVN  K+ GIADIRDESDR+GMR+VIEL+
Sbjct  259  PGKGRHRRPVIIVTELPYQVSKAGWIEKVADLVNDGKLQGIADIRDESDREGMRVVIELR  318

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D+  + V+  LYK+T LQ+NFGAI L +V+G+P QL+LKQ L  FL FRE T+R+R G+
Sbjct  319  RDAQADKVLEQLYKRTALQSNFGAILLAIVEGQPQQLSLKQLLEQFLSFREGTLRRRYGH  378

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
             L+ T  +L ILEGL ++  D+  +IEI+ +S + G A+++L
Sbjct  379  ELEQTERRLMILEGLLRSLSDLDGLIEILRQSPDGGTARARL  420


>gi|81300503|ref|YP_400711.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus elongatus 
PCC 7942]
 gi|81169384|gb|ABB57724.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus elongatus 
PCC 7942]
Length=858

 Score =  355 bits (912),  Expect = 1e-96, Method: Composition-based stats.
 Identities = 166/282 (58%), Positives = 219/282 (77%), Gaps = 0/282 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              LEEI  ETV+F  NFD SQ+EP VLPAQLPFL LNG SGIAVGMATNIPPHNLGEIVD
Sbjct  139  ALLEEIGEETVDFVANFDNSQQEPSVLPAQLPFLLLNGCSGIAVGMATNIPPHNLGEIVD  198

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
            ALIAL++   ++++ L + + GPDFPTGGE+I +Q I + Y  G+GS+ +RG+   EEI 
Sbjct  199  ALIALIDRPQLSDRDLLRYVPGPDFPTGGEVIGSQGILDAYLEGRGSIPVRGIARIEEIQ  258

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKG+H+R  +I+TELPYQ+SKAGWIEK+A+LVN  K+ GIADIRDESDR+GMR+VIEL+
Sbjct  259  PGKGRHRRPVIIVTELPYQVSKAGWIEKVADLVNDGKLQGIADIRDESDREGMRVVIELR  318

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D+  + V+  LYK+T LQ+NFGAI L +V+G+P QL+LKQ L  FL FRE T+R+R G+
Sbjct  319  RDAQADKVLEQLYKRTALQSNFGAILLAIVEGQPQQLSLKQLLEQFLSFREGTLRRRYGH  378

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
             L+ T  +L ILEGL ++  D+  +IEI+ +S + G A+++L
Sbjct  379  ELEQTERRLMILEGLLRSLSDLDGLIEILRQSPDGGTARARL  420


>gi|113953878|ref|YP_729244.1|  DNA gyrase subunit A [Synechococcus sp. CC9311]
 gi|113881229|gb|ABI46187.1|  DNA gyrase subunit A [Synechococcus sp. CC9311]
Length=820

 Score =  346 bits (887),  Expect = 9e-94, Method: Composition-based stats.
 Identities = 164/283 (57%), Positives = 230/283 (81%), Gaps = 0/283 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
            G L+EI  +TV+F++NFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  132  GLLDEIGDDTVDFASNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIALV+N D++  ++ K+I GPDFPTGGE++    + E Y  G+GS+ +RGV + EE++
Sbjct  192  GLIALVQNPDLSENEVLKLIPGPDFPTGGEVLLGSGVRETYLRGRGSIPMRGVAHIEEVH  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKGKH+RNA+I+TELPYQ+SKAGWIEKLAE VN  KI GIADIRDESDR+GMR+V+EL+
Sbjct  252  PGKGKHRRNAVIVTELPYQLSKAGWIEKLAEHVNDGKIGGIADIRDESDREGMRVVVELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D++ E V+++L ++T+LQ+NFGAI L LV G+P QL L+Q L  FL++RE TI +RT +
Sbjct  312  RDADPETVLTDLQRRTSLQSNFGAILLALVDGRPQQLTLRQLLQTFLDYRELTIIRRTNH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
             L+ T ++LE++EGL+ A   ++++I +I+E+ ++ +A++ L+
Sbjct  372  ALRKTEDRLEVVEGLTTALASLQQVIAMIQEARDAAKARASLM  414


>gi|87301556|ref|ZP_01084396.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 
5701]
 gi|87283773|gb|EAQ75727.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 
5701]
Length=820

 Score =  345 bits (884),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 155/270 (57%), Positives = 219/270 (81%), Gaps = 0/270 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              L+EI S+TV+F++NFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+V+
Sbjct  132  ALLDEIGSDTVDFTSNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVE  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
            ALIAL+   +++++KL +++ GPDFPTGGE++    + + Y  G+GS+ +RG+ + EE+ 
Sbjct  192  ALIALIRKPELSDEKLLELVPGPDFPTGGEVLVGSGVRDTYLQGRGSIPMRGIAHIEEVQ  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKG+H+R+A++ITELPYQ+SKAGWIEKLA+ VN  KI GIADIRDESDR+GMR+VIEL+
Sbjct  252  PGKGRHRRSAVVITELPYQLSKAGWIEKLADQVNDGKIGGIADIRDESDREGMRVVIELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D+    V+++L ++T+LQ+NFGAI L LV G+P QL+L+Q LN+FLE+RE T+ +RT +
Sbjct  312  RDTEASKVLTDLQRRTSLQSNFGAILLALVNGQPQQLSLRQLLNHFLEYREHTLIRRTSH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIE  270
             L+ T ++LE++EGL +A   +  +IE I+
Sbjct  372  ALRRTEDRLEVVEGLIRALDALPEVIERIQ  401


>gi|72383169|ref|YP_292524.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
str. NATL2A]
 gi|72003019|gb|AAZ58821.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
str. NATL2A]
Length=827

 Score =  340 bits (873),  Expect = 3e-92, Method: Composition-based stats.
 Identities = 175/281 (62%), Positives = 231/281 (82%), Gaps = 0/281 (0%)

Query  3    LEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDAL  62
            L EI  ETV+FS NFDGSQ+EPDVLPAQLPFL LNGS+GIAVGMAT+IPPHNL E+V+AL
Sbjct  134  LSEIDQETVDFSPNFDGSQQEPDVLPAQLPFLILNGSTGIAVGMATSIPPHNLNEVVEAL  193

Query  63   IALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINLG  122
            IA+++   +N +KL +II GPDFPTGGE++ +  I+E Y  G+GS+ +RG+   EEIN G
Sbjct  194  IAIIKKPSLNEEKLLEIIPGPDFPTGGEILVSNGIKETYTKGRGSITMRGIARIEEINPG  253

Query  123  KGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKKD  182
            KGKHKR+ +II+ELPYQ++KA WIEKLA+LVN+ KI+GIADIRDESDRDGMRI++E+K+D
Sbjct  254  KGKHKRSGIIISELPYQLNKASWIEKLADLVNNGKISGIADIRDESDRDGMRILVEVKRD  313

Query  183  SNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYFL  242
            S+ + ++  LY+KT+LQ+NFGAI L LV G+PVQL LK+ LN FLEFRE TI  R+ Y L
Sbjct  314  SDPKKILDFLYQKTSLQSNFGAILLALVNGQPVQLTLKKLLNNFLEFRENTILLRSNYLL  373

Query  243  KNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
            KN   + EI++ L +AT ++K++I++IE+S+++ EAKS LI
Sbjct  374  KNIKNREEIVDALIQATNNVKKVIDLIEKSKDTPEAKSNLI  414


>gi|33864544|ref|NP_896103.1|  putative DNA topoisomerase chain A [Synechococcus sp. WH 8102]
 gi|33632067|emb|CAE06520.1|  putative DNA topoisomerase chain A [Synechococcus sp. WH 8102]
Length=824

 Score =  338 bits (867),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 153/271 (56%), Positives = 215/271 (79%), Gaps = 0/271 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              LEEI  +TV+F+ NFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  132  ALLEEIGDDTVDFAPNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             L+AL+   ++++ KL ++I GPDFPTGGE++ +  + + Y  G+GS+ +RG+ + EE+ 
Sbjct  192  GLVALIRQPELSDSKLLELIPGPDFPTGGEVLLSSGLRDTYLVGRGSIPMRGIAHIEEVQ  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKG HKRNA+++TELPYQ+SKAGWIEKLAE VN  KI GIADIRDESDR+GMR+V+EL+
Sbjct  252  PGKGHHKRNAVVVTELPYQLSKAGWIEKLAESVNDGKIGGIADIRDESDREGMRVVVELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D++   V+++L ++T LQ+NFGAI L LV G+P QL+L+Q L  FL++RE T+ +RT +
Sbjct  312  RDADPAKVLADLQRRTALQSNFGAILLALVDGQPRQLSLRQLLQTFLDYRELTLIRRTSH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEE  271
             L+ T ++LE+++GL  A  +++ +I +I+E
Sbjct  372  ALRKTEDRLEVVDGLITALNNLQAVITMIQE  402


>gi|33862278|ref|NP_893838.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
str. MIT 9313]
 gi|33640391|emb|CAE20180.1|  DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus 
str. MIT 9313]
Length=829

 Score =  337 bits (863),  Expect = 4e-91, Method: Composition-based stats.
 Identities = 161/271 (59%), Positives = 216/271 (79%), Gaps = 0/271 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              L+EI  ETV+F+ NFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  132  ALLDEIGEETVDFTANFDGSQQEPSVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIAL+   D+++ KL  +I GPDFPTGGE++    I E Y  G+GS+ +RGV + EEI 
Sbjct  192  GLIALIRKPDLSDDKLLGLIPGPDFPTGGEILLGTGIHETYLKGRGSIPMRGVAHVEEIQ  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKG+H+R+A+++TELPYQ+SKAGWIEKLA+LVN+ KI GIADIRDESDR+GMRIV+EL+
Sbjct  252  PGKGRHRRSAVVVTELPYQLSKAGWIEKLADLVNNGKIGGIADIRDESDREGMRIVVELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D+N E V+ +L+++T+LQ+NFGAI L LV G+P QL+L++ L  FLE+RE T+ +RT +
Sbjct  312  RDANPENVLGDLHRRTSLQSNFGAILLALVNGQPQQLSLRKLLQTFLEYRELTVIRRTNH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEE  271
             L+ T  +LE++EGL  A   ++ +I +I+E
Sbjct  372  ALEKTKARLEVVEGLITALNALQAVIAMIQE  402


>gi|88809359|ref|ZP_01124867.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 
7805]
 gi|88786578|gb|EAR17737.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 
7805]
Length=821

 Score =  336 bits (862),  Expect = 6e-91, Method: Composition-based stats.
 Identities = 163/271 (60%), Positives = 220/271 (81%), Gaps = 0/271 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
            G L+EI ++TV+F+NNFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  132  GLLDEIGNDTVDFANNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIALV   D++N KL K+I GPDFPTGGE++    + + Y  G+GS+ +RGV + EE+ 
Sbjct  192  GLIALVREPDLSNDKLLKLIPGPDFPTGGEVLLGSGVRDTYLRGRGSIPMRGVAHVEEVQ  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
            LGKG+HKRNA+I+TELPYQ+SKAGWIEKLAE VN  KI GIADIRDESDR+GMR+V+EL+
Sbjct  252  LGKGRHKRNAVIVTELPYQLSKAGWIEKLAEQVNDGKIGGIADIRDESDREGMRVVVELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D++ + V+ +L ++T+LQ+NFGAI L LV G+P QL+L+Q L  FL++RE T+ +RT +
Sbjct  312  RDADPDAVLKDLQRRTSLQSNFGAIMLALVDGQPQQLSLRQLLQTFLDYRELTLIRRTTH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEE  271
             L+   ++LE++EGL  A + ++R+I +I+E
Sbjct  372  ALRKAEDRLEVVEGLITALQSLQRVIAMIQE  402


>gi|87123344|ref|ZP_01079195.1|  putative DNA topoisomerase chain A [Synechococcus sp. RS9917]
 gi|86169064|gb|EAQ70320.1|  putative DNA topoisomerase chain A [Synechococcus sp. RS9917]
Length=831

 Score =  336 bits (861),  Expect = 8e-91, Method: Composition-based stats.
 Identities = 160/271 (59%), Positives = 222/271 (81%), Gaps = 0/271 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
            G L+EI  +TV+F+ NFDGSQ+EP VLPAQLPFL LNG +GIAVGMATNIPPHNLGE+VD
Sbjct  132  GLLDEIGDDTVDFAPNFDGSQQEPTVLPAQLPFLLLNGCAGIAVGMATNIPPHNLGEVVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
            AL+ALV   ++++ KL  +I GPDFPTGGE++    + E Y +G+GS+ +RGV + EE+ 
Sbjct  192  ALVALVRQPELSDDKLLTLIPGPDFPTGGEVLLGSGVRETYLSGRGSIPMRGVAHIEEVQ  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKG+HKRNA++ITELP+Q+SKAGWIEKLAE VN  +I GIADIRDESDRDGMR+V+EL+
Sbjct  252  PGKGRHKRNAVVITELPFQLSKAGWIEKLAEQVNEGRIGGIADIRDESDRDGMRVVVELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +DS+   V+++L ++T+LQ+NFGAI L LV G+P QL+L+Q L  FLE+RE+T+ +RT +
Sbjct  312  RDSDPGKVLADLQRRTSLQSNFGAILLALVNGQPQQLSLRQLLQTFLEYREQTLIRRTSH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEE  271
             L+ T ++LE++EGL++A + ++++I +I+E
Sbjct  372  ALRKTEDRLEVVEGLNRALEALQQVISMIQE  402


>gi|78183589|ref|YP_376023.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. CC9902]
 gi|78167883|gb|ABB24980.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. CC9902]
Length=806

 Score =  334 bits (856),  Expect = 3e-90, Method: Composition-based stats.
 Identities = 160/283 (56%), Positives = 227/283 (80%), Gaps = 0/283 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              LEEI  +TV+F++NFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  118  ALLEEIGDDTVDFASNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVD  177

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIAL+    +++++L ++I GPDFPTGGE++ +  +++ Y  G+GS+ +RGV + EE+ 
Sbjct  178  GLIALIRQPGLSDERLLELIPGPDFPTGGEVLLSSGLQDTYLQGRGSIPMRGVAHTEEVQ  237

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
            LGKG+HKRNA+++TELPYQ+SKAGWIEKLAE VN  KI GIADIRDESDRDGMR+V+EL+
Sbjct  238  LGKGRHKRNAVVVTELPYQLSKAGWIEKLAESVNDGKIGGIADIRDESDRDGMRVVVELR  297

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D+  E V+ +L ++T LQ+NFGAI L LV G+P QL+L+Q L  FL++RE T+ +RT +
Sbjct  298  RDAEPEKVLKDLQRRTALQSNFGAILLALVNGQPQQLSLRQLLQTFLDYRELTLIRRTSH  357

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
             L+ T ++LE++EGL  A  +++ +I +I+E++++  A++ L+
Sbjct  358  ALRKTEDRLEVVEGLITALNNLQAVIAMIQEAKDAASARASLM  400


>gi|33239457|ref|NP_874399.1|  Type IIA topoisomerase, A subunit, ParC [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gi|33236982|gb|AAP99051.1|  Type IIA topoisomerase, A subunit, ParC [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
Length=828

 Score =  333 bits (855),  Expect = 4e-90, Method: Composition-based stats.
 Identities = 175/283 (61%), Positives = 226/283 (79%), Gaps = 0/283 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              L EI  +TV+FS NFDGSQ+EPDVLPAQLPFL LNG SGIAVGMATNIPPHN+ EI++
Sbjct  132  ALLNEIDDKTVDFSQNFDGSQQEPDVLPAQLPFLVLNGCSGIAVGMATNIPPHNINEIIN  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIAL++  +++  KL +II GPDFPTGGE++ +  I+E Y  GKGS+ +RG+ + EEIN
Sbjct  192  GLIALIKKPELSEDKLIEIIPGPDFPTGGEILLSNGIKETYLKGKGSIPMRGITHIEEIN  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
             GKGKH++  ++ITELPYQ++KA WIEKLA+LVN++KI+GIADIRDESDRDGMRIVIEL+
Sbjct  252  PGKGKHRKKGIVITELPYQVNKAAWIEKLADLVNNSKIDGIADIRDESDRDGMRIVIELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D + E+V   LY+KT LQ NF A  L LV G+P QL+LK+ L  FLE+RE TIRKRT  
Sbjct  312  RDIDHEIVKDTLYQKTNLQNNFSATLLALVNGQPKQLSLKRLLIIFLEYRELTIRKRTKN  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
             LK TL +LEILEGL KA K++K++I +IE +++S +AK K++
Sbjct  372  KLKQTLARLEILEGLIKALKNLKKVINLIENAKDSIDAKIKIM  414


>gi|116071803|ref|ZP_01469071.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. BL107]
 gi|116065426|gb|EAU71184.1|  DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. BL107]
Length=820

 Score =  333 bits (854),  Expect = 5e-90, Method: Composition-based stats.
 Identities = 159/283 (56%), Positives = 227/283 (80%), Gaps = 0/283 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              LEEI  +TV+F++NFDGSQ+EP VLPAQLPFL LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  132  ALLEEIGDDTVDFASNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVD  191

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LIAL+    +++++L ++I GPDFPTGGE++ +  +++ Y  G+GS+ +RGV + EE+ 
Sbjct  192  GLIALIRQPSLSDERLLELIPGPDFPTGGEVLLSSGLQDTYLQGRGSIPMRGVAHTEEVQ  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
            LGKG+HKRNA+++TELPYQ+SKAGWIEKLAE VN  KI GIADIRDESDRDGMR+V+EL+
Sbjct  252  LGKGRHKRNAVVVTELPYQLSKAGWIEKLAESVNDGKIGGIADIRDESDRDGMRVVVELR  311

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            +D+  + V+ +L ++T LQ+NFGAI L LV G+P QL+L+Q L  FL++RE T+ +RT +
Sbjct  312  RDAEPDKVLKDLQRRTALQSNFGAILLALVNGQPQQLSLRQLLQTFLDYRELTLIRRTSH  371

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI  283
             L+ T ++LE++EGL  A  +++ +I +I+E++++  A++ L+
Sbjct  372  ALRKTEDRLEVVEGLITALNNLQAVIAMIQEAKDAASARASLM  414


BLASTp : ORF contre la banque SWISSPROT .

                                                                  Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|8469101|sp|Q55738|GYRA_SYNY3  DNA gyrase subunit A               303    4e-82  
gi|7404425|sp|P73077|PARC_SYNY3  DNA topoisomerase 4 subunit A (T   291    2e-78
gi|121881|sp|P05653|GYRA_BACSU  DNA gyrase subunit A                262    8e-70
gi|110808537|sp|Q7XZF7|GYRA_ORYSA  Probable DNA gyrase subunit...   261    2e-69
gi|4033397|sp|O50628|GYRA_BACHD  DNA gyrase subunit A               261    2e-69
gi|1346237|sp|P48372|GYRA_PSEAE  DNA gyrase subunit A               257    4e-68
gi|20138264|sp|Q92IZ6|GYRA_RICCN  DNA gyrase subunit A              256    7e-68
gi|729651|sp|P41080|GYRA_RICPR  DNA gyrase subunit A                251    1e-66
gi|18273029|sp|P94605|GYRA_CLOAB  DNA gyrase subunit A              249    5e-66
gi|1170143|sp|P41513|GYRA_ERWCA  DNA gyrase subunit A               249    1e-65
gi|17865733|sp|P37411|GYRA_SALTY  DNA gyrase subunit A              248    1e-65
gi|84028817|sp|P0AES4|GYRA_ECOLI  DNA gyrase subunit A >gi|840...   246    8e-65
gi|13638291|sp|Q57532|GYRA_MYCLE  DNA gyrase subunit A [Contains:   246    9e-65
gi|59797754|sp|Q6GKT9|GYRA_STAAR  DNA gyrase subunit A              244    3e-64  
gi|82592835|sp|P0C0R0|GYRA_STAES  DNA gyrase subunit A              244    3e-64  
gi|1346235|sp|Q07702|GYRA_MYCTU  DNA gyrase subunit A               242    1e-63
gi|38604895|sp|Q8NKW8|GYRA_STAAW  DNA gyrase subunit A >gi|597...   242    1e-63  
gi|93204587|sp|Q2FKQ0|GYRA_STAA3  DNA gyrase subunit A              241    1e-63  
gi|81695633|sp|Q5HJZ0|GYRA_STAAC  DNA gyrase subunit A              241    1e-63  
gi|38605032|sp|Q99XG5|GYRA_STAAN  DNA gyrase subunit A              241    1e-63  
gi|1346238|sp|P20831|GYRA_STAAU  DNA gyrase subunit A               241    1e-63
gi|38604966|sp|Q932M0|GYRA_STAAM  DNA gyrase subunit A              241    1e-63  
gi|81672841|sp|Q5HK04|GYRA_STAEQ  DNA gyrase subunit A              241    2e-63  
gi|1346236|sp|P48371|GYRA_NEIGO  DNA gyrase subunit A               241    2e-63
gi|1346233|sp|P47250|GYRA_MYCGE  DNA gyrase subunit A               241    3e-63
gi|110808536|sp|Q9CAF6|GYRA_ARATH  Probable DNA gyrase subunit...   241    3e-63  
gi|2507467|sp|P22446|GYRA_MYCPN  DNA gyrase subunit A               241    3e-63
gi|1346229|sp|P48369|GYRA_AERSA  DNA gyrase subunit A               239    6e-63
gi|75252690|sp|Q5YLB5|GYRA_NICBE  DNA gyrase subunit A, chloropla   239    7e-63
gi|121884|sp|P14829|GYRA_KLEOX  DNA gyrase subunit A                239    1e-62
gi|1346234|sp|P48354|GYRA_MYCSM  DNA gyrase subunit A               237    3e-62
gi|6831558|sp|O33926|GYRA_THEMA  DNA gyrase subunit A (Topoisomer   236    5e-62
gi|4033399|sp|O83051|GYRA_TREPA  DNA gyrase subunit A               236    7e-62
gi|19858823|sp|P35885|GYRA_STRCO  DNA gyrase subunit A              234    2e-61
gi|11386848|sp|Q9PR63|GYRA_UREPA  DNA gyrase subunit A              234    2e-61
gi|25008529|sp|Q8K9W2|GYRA_BUCAP  DNA gyrase subunit A              234    3e-61
gi|6647520|sp|O67108|GYRA_AQUAE  DNA gyrase subunit A               230    5e-60
gi|3913797|sp|O51396|GYRA_BORBU  DNA gyrase subunit A               229    6e-60
gi|30913085|sp|Q8DPM2|GYRA_STRR6  DNA gyrase subunit A              229    7e-60  
gi|17377446|sp|P72524|GYRA_STRPN  DNA gyrase subunit A              229    7e-60
gi|12644500|sp|Q9Z8R4|GYRA_CHLPN  DNA gyrase subunit A              228    2e-59
gi|13627142|sp|Q9PKK4|GYRA_CHLMU  DNA gyrase subunit A              228    3e-59
gi|13627049|sp|O84192|GYRA_CHLTR  DNA gyrase subunit A              227    3e-59
gi|33860161|sp|P47719|GYRA_MYCGA  DNA gyrase subunit A              226    6e-59
gi|417099|sp|Q03470|GYRA_CAMJE  DNA gyrase subunit A                226    9e-59
gi|1170144|sp|P43700|GYRA_HAEIN  DNA gyrase subunit A               224    4e-58
gi|31076739|sp|Q89AS3|GYRA_BUCBP  DNA gyrase subunit A              220    4e-57
gi|19861240|sp|P72525|PARC_STRPN  DNA topoisomerase 4 subunit A (   218    2e-56
gi|73919728|sp|Q8P116|GYRA_STRP8  DNA gyrase subunit A              217    4e-56
gi|11132931|sp|P57277|GYRA_BUCAI  DNA gyrase subunit A              217    4e-56
gi|73919727|sp|Q5XC58|GYRA_STRP6  DNA gyrase subunit A              215    1e-55
gi|18203224|sp|Q9L7Q5|GYRA_STRP1  DNA gyrase subunit A              215    1e-55
gi|73919726|sp|Q8K7H2|GYRA_STRP3  DNA gyrase subunit A              215    1e-55
gi|1346230|sp|P47235|GYRA_CAMFE  DNA gyrase subunit A               215    1e-55
gi|81651177|sp|Q6GH50|PARC_STAAR  DNA topoisomerase 4 subunit A (   215    2e-55  
gi|38604913|sp|Q8NWU8|PARC_STAAW  DNA topoisomerase 4 subunit A (   214    2e-55  
gi|20178000|sp|Q931S2|PARC_STAAM  DNA topoisomerase 4 subunit A (   214    3e-55  
gi|114152112|sp|P0C1U9|PARC_STAAU  DNA topoisomerase 4 subunit A    214    3e-55
gi|81694551|sp|Q5HG64|PARC_STAAC  DNA topoisomerase 4 subunit ...   214    3e-55  
gi|81649352|sp|Q6G9K4|PARC_STAAS  DNA topoisomerase 4 subunit A (   214    3e-55  
gi|20178001|sp|Q93KF4|PARC_STAAN  DNA topoisomerase 4 subunit A (   214    3e-55  
gi|73921621|sp|Q8P1B3|PARC_STRP8  DNA topoisomerase 4 subunit A (   213    6e-55
gi|73921620|sp|Q5XCJ9|PARC_STRP6  DNA topoisomerase 4 subunit A (   212    1e-54
gi|73921619|sp|Q8K7U6|PARC_STRP3  DNA topoisomerase 4 subunit A (   212    1e-54
gi|20139229|sp|Q9L7Q4|PARC_STRP1  DNA topoisomerase 4 subunit A (   212    1e-54
gi|38604845|sp|Q8CSN8|PARC_STAES  DNA topoisomerase 4 subunit A (   211    3e-54  
gi|81674759|sp|Q5HPI5|PARC_STAEQ  DNA topoisomerase 4 subunit A (   210    5e-54  
gi|3914271|sp|Q45066|PARC_BACSU  DNA topoisomerase 4 subunit A (T   209    6e-54
gi|2501298|sp|P75352|PARC_MYCPN  DNA topoisomerase 4 subunit A (T   206    7e-53
gi|2507466|sp|P48370|GYRA_HELPY  DNA gyrase subunit A               204    2e-52
gi|9789773|sp|Q9ZLD9|GYRA_HELPJ  DNA gyrase subunit A               201    3e-51  
gi|1352714|sp|P47446|PARC_MYCGE  DNA topoisomerase 4 subunit A (T   195    1e-49
gi|20141710|sp|P26973|PARC_SALTY  DNA topoisomerase 4 subunit A (   189    1e-47
gi|84028840|sp|P0AFI3|PARC_ECO57  DNA topoisomerase 4 subunit ...   187    3e-47
gi|13638360|sp|O54478|PARC_CAUCR  DNA topoisomerase 4 subunit A (   184    2e-46
gi|20139049|sp|Q92JH0|PARC_RICCN  DNA topoisomerase 4 subunit A (   179    9e-45
gi|1172017|sp|P43702|PARC_HAEIN  DNA topoisomerase 4 subunit A (T   178    2e-44
gi|7387992|sp|Q9ZE79|PARC_RICPR  DNA topoisomerase 4 subunit A (T   171    3e-42
gi|7387990|sp|Q59749|PARC_RHIME  DNA topoisomerase 4 subunit A (T   160    5e-39
gi|1352715|sp|P48374|PARC_NEIGO  DNA topoisomerase 4 subunit A (T   155    2e-37
gi|462225|sp|P34030|GYRA_SPICI  DNA gyrase subunit A                112    2e-24
gi|3914263|sp|O51066|PARC_BORBU  DNA topoisomerase 4 subunit A (T  85.1    2e-16
gi|2501246|sp|Q49608|GYRA_MYCKA  DNA gyrase subunit A [Contains:   75.9    1e-13
gi|2501245|sp|Q49467|GYRA_MYCGO  DNA gyrase subunit A [Contains:   75.9    1e-13
gi|3023910|sp|P72065|GYRA_MYCXE  DNA gyrase subunit A [Contains:   75.9    1e-13
gi|2501244|sp|Q49166|GYRA_MYCFV  DNA gyrase subunit A [Contains:   75.9    1e-13
gi|135994|sp|P27570|TOP2_CRIFA  DNA topoisomerase 2 (DNA topoisom  47.0    7e-05
gi|1351263|sp|P07065|TOP5_BPT4  DNA topoisomerase medium subunit   44.7    4e-04  
gi|135998|sp|P12531|TOP2_TRYBB  DNA topoisomerase 2 (DNA topoisom  42.4    0.002
gi|267151|sp|P30190|TOP2_TRYCR  DNA topoisomerase 2 (DNA topoisom  40.4    0.006
gi|6094499|sp|P90520|TOP2M_DICDI  DNA topoisomerase II, mitochond  40.4    0.006
gi|6094496|sp|O24308|TOP2_PEA  DNA topoisomerase 2 (DNA topoisome  40.4    0.008
gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisom  39.3    0.016
gi|730968|sp|P41001|TOP2_PLAFK  DNA topoisomerase 2 (DNA topoisom  38.9    0.020
gi|464905|sp|P34203|TOP2_ASFM2  DNA topoisomerase 2 (DNA topoisom  38.5    0.026
gi|7388329|sp|Q9Y8G8|TOP2_PENCH  DNA topoisomerase 2 (DNA topoiso  37.7    0.041
gi|3122959|sp|O42131|TOP2B_CHICK  DNA topoisomerase 2-beta (DNA t  37.7    0.045  
gi|76363529|sp|Q64511|TOP2B_MOUSE  DNA topoisomerase 2-beta (DNA   37.7    0.049  
gi|1174740|sp|P30182|TOP2_ARATH  DNA topoisomerase 2 (DNA topoiso  37.4    0.064  
gi|14195328|sp|O84290|Y288_CHLTR  Hypothetical protein CT_288      37.0    0.073
gi|13959708|sp|O42130|TOP2A_CHICK  DNA topoisomerase 2-alpha (DNA  36.2    0.11   
gi|20141946|sp|Q02880|TOP2B_HUMAN  DNA topoisomerase 2-beta (DNA   36.2    0.11   
gi|3024753|sp|Q64399|TOP2B_CRILO  DNA topoisomerase 2-beta (DNA t  36.2    0.12 
gi|51338747|sp|O93794|TOP2_CANGA  DNA topoisomerase 2 (DNA topois  36.2    0.13 
gi|18266788|sp|O61078|TOP2_LEICH  DNA topoisomerase 2 (DNA topois  35.4    0.21 
gi|1351262|sp|P06786|TOP2_YEAST  DNA topoisomerase 2 (DNA topoiso  35.4    0.22   
gi|2501297|sp|P87078|TOP2_CANAL  DNA topoisomerase 2 (DNA topoiso  35.0    0.25 
gi|6094494|sp|O16140|TOP2_BOMMO  DNA topoisomerase 2 (DNA topoiso  34.3    0.43   
gi|1174742|sp|P41516|TOP2A_RAT  DNA topoisomerase 2-alpha (DNA to  34.3    0.45   
gi|24638478|sp|P34534|TOP2M_CAEEL  Putative DNA topoisomerase II,  34.3    0.47   
gi|6175065|sp|Q23670|TOP2_CAEEL  Probable DNA topoisomerase 2 (DN  34.3    0.51   
gi|1174741|sp|P41515|TOP2A_CRIGR  DNA topoisomerase 2-alpha (DNA   33.5    0.77 
gi|12644105|sp|P08096|TOP2_SCHPO  DNA topoisomerase 2 (DNA topois  33.5    0.85 
gi|81832290|sp|Q74KY3|PURA_LACJO  Adenylosuccinate synthetase ...  32.7    1.5  
gi|13959709|sp|P11388|TOP2A_HUMAN  DNA topoisomerase 2-alpha (DNA  32.3    1.7    
gi|6094498|sp|O46374|TOP2A_PIG  DNA topoisomerase 2-alpha (DNA to  32.0    2.6    
gi|38372195|sp|Q886M3|ENO1_PSESM  Enolase 1 (2-phosphoglycerat...  32.0    2.7  
gi|135995|sp|P15348|TOP2_DROME  DNA topoisomerase 2 (DNA topoisom  31.6    3.5    
gi|22653668|sp|Q9UIF8|BAZ2B_HUMAN  Bromodomain adjacent to zinc f  30.4    7.0    
gi|23822200|sp|Q971X1|SYR_SULTO  Arginyl-tRNA synthetase (Arginin  30.0    9.2  


>gi|8469101|sp|Q55738|GYRA_SYNY3  DNA gyrase subunit A
Length=860

 Score =  303 bits (776),  Expect = 4e-82, Method: Composition-based stats.
 Identities = 150/281 (53%), Positives = 207/281 (73%), Gaps = 1/281 (0%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
             L +I +ETV+F +NFDGSQ+EP VLPA++P L +NGSSGIAVGMATNIPPHNLGE++D 
Sbjct  135  LLRDIEAETVDFIDNFDGSQQEPTVLPARIPQLLINGSSGIAVGMATNIPPHNLGEVIDG  194

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL  121
             IAL+ N +I  ++L +II GPDFPTG +++    I E Y TG+GS+ +RGV + E +  
Sbjct  195  AIALIRNPEITEQELMQIIPGPDFPTGAQILGRSGIREAYLTGRGSITMRGVASIETME-  253

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
              G+  R+A+I+TELPYQ +KA  IE++A+LVN  KI+GIADIRDESDRDGMRIVIELK+
Sbjct  254  HPGRPDRDAIIVTELPYQTNKAALIERIADLVNDKKIDGIADIRDESDRDGMRIVIELKR  313

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
            D+   +V++NLYK+T +Q+NFGA  L LV G P  L +K++L  F EFR ETI +RT Y 
Sbjct  314  DAYARVVLNNLYKQTPIQSNFGANLLALVNGTPEVLTIKKFLTVFWEFRIETITRRTRYE  373

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            L+   E+  +L+GL  A  ++  +I +I  + ++  AK++L
Sbjct  374  LRKAEERDHLLQGLLIALDNLDAVIRLIRGAADTASAKTEL  414


>gi|7404425|sp|P73077|PARC_SYNY3  DNA topoisomerase 4 subunit A (Topoisomerase IV subunit A)
Length=920

 Score =  291 bits (745),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 142/283 (50%), Positives = 204/283 (72%), Gaps = 1/283 (0%)

Query  1    GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD  60
              LE I+   V+F+ NFD SQ+EP V+PAQLP L LNG SGIAVGMAT+IPPHNLGE+VD
Sbjct  137  AMLEGISEAIVDFTGNFDNSQEEPTVVPAQLPLLLLNGCSGIAVGMATSIPPHNLGEVVD  196

Query  61   ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN  120
             LI L+   D+++++L K+I GPDFPTGG +++++ I + Y+TG+G + +RGV + E I 
Sbjct  197  GLIGLINKPDLSDQELFKLIPGPDFPTGGHILDSEGILQAYQTGRGLIPVRGVSHIETIR  256

Query  121  LGKGK-HKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIEL  179
              K + H R A++ITELP+Q++KA WIEK+A LVN  K++GI+D+RDESDR GMR+VIEL
Sbjct  257  GEKKRSHNRTAIVITELPFQVNKAAWIEKIASLVNDGKLDGISDLRDESDRTGMRVVIEL  316

Query  180  KKDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTG  239
            K+D+    ++  LY+ T LQ+NFG IFL LV  +PVQ++L+Q L  FL+FRE+T+ ++  
Sbjct  317  KRDAEPNAILQKLYRMTPLQSNFGVIFLALVNNQPVQMSLRQILQEFLQFREDTLLRQYE  376

Query  240  YFLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
              L     +LE+L GL    +++  +IEI+  + +   AK +L
Sbjct  377  NELGENRRRLELLTGLLIGLENLDALIEILRFAADGTTAKIQL  419


>gi|121881|sp|P05653|GYRA_BACSU  DNA gyrase subunit A
Length=821

 Score =  262 bits (670),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 131/280 (46%), Positives = 196/280 (70%), Gaps = 5/280 (1%)

Query  3    LEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDAL  62
            L +I  +T+++ +N+DGS++EP V+P++ P L +NG++GIAVGMATNIPPH LGEI+D +
Sbjct  136  LRDITKDTIDYQDNYDGSEREPVVMPSRFPNLLVNGAAGIAVGMATNIPPHQLGEIIDGV  195

Query  63   IALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINLG  122
            +A+ EN DI   +L ++I GPDFPT G+++    I + YE+G+GS+ IR     E+ + G
Sbjct  196  LAVSENPDITIPELMEVIPGPDFPTAGQILGRSGIRKAYESGRGSITIRAKAEIEQTSSG  255

Query  123  KGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKKD  182
            K +     +I+TELPYQ++KA  IEK+A+LV   KI GI D+RDESDR GMRIVIE+++D
Sbjct  256  KER-----IIVTELPYQVNKAKLIEKIADLVRDKKIEGITDLRDESDRTGMRIVIEIRRD  310

Query  183  SNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYFL  242
            +N  ++++NLYK+T LQT+FG   L LV G+P  L LKQ L ++L+ ++  IR+RT Y L
Sbjct  311  ANANVILNNLYKQTALQTSFGINLLALVDGQPKVLTLKQCLEHYLDHQKVVIRRRTAYEL  370

Query  243  KNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            +    +  ILEGL  A   +  +I +I  S+ +  A++ L
Sbjct  371  RKAEARAHILEGLRVALDHLDAVISLIRNSQTAEIARTGL  410


>gi|110808537|sp|Q7XZF7|GYRA_ORYSA  Probable DNA gyrase subunit A, chloroplast/mitochondrial precursor
Length=939

 Score =  261 bits (668),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 128/272 (47%), Positives = 188/272 (69%), Gaps = 3/272 (1%)

Query  11   VNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDALIALVENKD  70
            V+F  NFD SQKEP +LPA++P L LNGSSGIAVGMATNIPPHNLGE+VD L  ++EN +
Sbjct  220  VDFVPNFDNSQKEPSLLPARVPSLLLNGSSGIAVGMATNIPPHNLGELVDVLSVMIENPE  279

Query  71   INNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINLGKGKHKRNA  130
               ++L + + GPDFPTGG ++ NQ I E Y+TG+G V++RG  + E I++   K KR+A
Sbjct  280  ATLQELLECMPGPDFPTGGTIVGNQGILEAYKTGRGRVVMRGKTDIETIDV---KSKRSA  336

Query  131  LIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKKDSNTELVIS  190
            +II E+PYQ +K+  +E++AELV    + GI+DIRDESDR GMR+VIELK+ ++  +V++
Sbjct  337  IIIKEVPYQTNKSTLVERIAELVEEKVLEGISDIRDESDRSGMRVVIELKRGADPAIVLN  396

Query  191  NLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYFLKNTLEKLE  250
            NLY+ T LQ++F    + ++ G+P  + LK+ L  F++FR   I +R  + L   LE+  
Sbjct  397  NLYRHTALQSSFSCNMVAILDGQPKLMGLKEILQAFIDFRCSVIERRARFKLSQALERKH  456

Query  251  ILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            I+EG+     ++  +I+II  + N   A+  L
Sbjct  457  IVEGIVIGLDNLDSVIQIIRGTSNHAMARESL  488


>gi|4033397|sp|O50628|GYRA_BACHD  DNA gyrase subunit A
Length=833

 Score =  261 bits (667),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 130/281 (46%), Positives = 195/281 (69%), Gaps = 6/281 (2%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
             + +I  +T+++ +N+DGS+KEP V+P++ P L +NG+SGIAVGMATNIPPH LGE++D 
Sbjct  135  LVRDINKDTIDYQDNYDGSEKEPVVMPSRFPNLLVNGASGIAVGMATNIPPHQLGEVIDG  194

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL  121
            ++AL +N DI+  +L + I GPDFPTG E++    I + Y+TG+GS+ +R     EE   
Sbjct  195  VLALSKNPDISVPELMEHIPGPDFPTGAEILGRSGIRKAYQTGRGSITLRAKTEIEE---  251

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
                H +  +I+ E+PYQ++KA  IEK+AELV   KI+GI D+RDESDR+GMRIVIE++K
Sbjct  252  ---HHGKQRIIVHEIPYQVNKAKLIEKIAELVRDKKIDGITDLRDESDRNGMRIVIEVRK  308

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
            D+N  ++++NLYK+T LQT+FG   L LV+G+P  LNLK+ L ++L  +   IR+RT + 
Sbjct  309  DANANVLLNNLYKQTALQTSFGINLLALVEGQPKVLNLKECLEHYLAHQVIVIRRRTAFE  368

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            L+    +  ILEGL  A   +  +I +I  S+ +  A++ L
Sbjct  369  LRKAEARAHILEGLRIALDHLDEVISLIRSSQTTEIARNGL  409


>gi|1346237|sp|P48372|GYRA_PSEAE  DNA gyrase subunit A
Length=923

 Score =  257 bits (656),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 135/281 (48%), Positives = 188/281 (66%), Gaps = 3/281 (1%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
             L ++  ETV++  N+DG+++ P V+P ++P L +NGSSGIAVGMATNIPPHNLGE++D 
Sbjct  134  LLADLEKETVDWVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMATNIPPHNLGEVIDG  193

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL  121
             +AL++N D+   +L + I GPDFPT G +     I E Y TG+G + IR     EE+  
Sbjct  194  CLALMDNPDLTVDELMQYIPGPDFPTAGIINGRAGIIEAYRTGRGRIYIRARAVVEEMEK  253

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
            G G   R  +IITELPYQ++KA  IEK+AELV   KI GI+++RDESD+DGMR+VIEL++
Sbjct  254  GGG---REQIIITELPYQLNKARLIEKIAELVKEKKIEGISELRDESDKDGMRVVIELRR  310

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
                E+V++NLY +T LQ+ FG   + LV G+P  LNLK  L  F+  R E + +RT Y 
Sbjct  311  GEVGEVVLNNLYAQTQLQSVFGINVVALVDGQPRTLNLKDMLEVFVRHRREVVTRRTVYE  370

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            L+   E+  ILEG + A  +I  +IE+I+ S    EAK +L
Sbjct  371  LRKARERGHILEGQAVALSNIDPVIELIKSSPTPAEAKERL  411


>gi|20138264|sp|Q92IZ6|GYRA_RICCN  DNA gyrase subunit A
Length=905

 Score =  256 bits (653),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 136/281 (48%), Positives = 187/281 (66%), Gaps = 5/281 (1%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
             +E+I  ETV+F+ N+DGS++EP VLPA  P L +NGS GIAVGMATNIPPHNLGE++DA
Sbjct  135  LVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATNIPPHNLGEVIDA  194

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL  121
                ++N DI    L +++KGPDFPTG  ++    I   Y TG+GS+I+RG    E I  
Sbjct  195  CCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSIIMRGRAEIENIG-  253

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
                + R A+IITE+PY ++KA  +EK+AE+V   +I GI+D+RDES+++G+RI IELKK
Sbjct  254  ----NNRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVRIFIELKK  309

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
            D   E+V++ +Y  T LQT+FG I L L  G P  +NLK+ +  F+ FRE  I  RT Y 
Sbjct  310  DVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVITNRTIYL  369

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            L    ++  IL GL+ A  +I  II II+ S +S  AK +L
Sbjct  370  LNKARDRAHILLGLTIAVSNIDEIIRIIKASNDSNAAKQEL  410


>gi|729651|sp|P41080|GYRA_RICPR  DNA gyrase subunit A
Length=905

 Score =  251 bits (642),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 139/282 (49%), Positives = 190/282 (67%), Gaps = 7/282 (2%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
             +E+I   TV+F+ N+DGS++EP VLPA  P L +NGS GIAVGMATNIPPHNLGEI+DA
Sbjct  135  LVEDIDKGTVSFNINYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATNIPPHNLGEIIDA  194

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEI-N  120
                ++N DI    L +++KGPDFPTG  ++    I   Y TG+GS+I+RG   K EI N
Sbjct  195  CCLYIDNHDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSIIMRG---KAEIEN  251

Query  121  LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK  180
            +G   + R A+IITE+PY ++KA  +EK+AE+V   +I GI+D+RDES+++G+RI IELK
Sbjct  252  VG---NSRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGIRIFIELK  308

Query  181  KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY  240
            KD   E+V++ +Y  T LQTNFG I L L  G P  +NLK+ +  F+ FRE  I  RT Y
Sbjct  309  KDVVAEVVLNQIYACTQLQTNFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVITNRTIY  368

Query  241  FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
             L    ++  IL GL+ A  +I  II II+ S ++  AK +L
Sbjct  369  LLNKARDRAHILLGLTIAISNIDEIIYIIKASNDTNLAKQEL  410


>gi|18273029|sp|P94605|GYRA_CLOAB  DNA gyrase subunit A
Length=830

 Score =  249 bits (637),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 135/278 (48%), Positives = 188/278 (67%), Gaps = 7/278 (2%)

Query  3    LEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDAL  62
            + +I   TV+F  NFDG +KEP VLP++ P L +NGS+GIAVGMATNIPPHNLGE++D +
Sbjct  134  VRDIGKNTVDFIPNFDGEEKEPVVLPSRFPNLLVNGSAGIAVGMATNIPPHNLGEVIDGI  193

Query  63   IALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL-  121
              L++N +    +L   IKGPDFPT G ++    I   YETG+G + +R    K EI + 
Sbjct  194  TMLIDNPEATILELMAQIKGPDFPTAGIIMGKSGIRAAYETGRGKITVRA---KSEIEVE  250

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
              GK K   +IITE+PYQ++KA  +E +A+LV   +I GI+D+RDESDRDGMRIVIE+KK
Sbjct  251  DNGKQK---IIITEIPYQVNKARLVESIADLVKDKRIVGISDLRDESDRDGMRIVIEIKK  307

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
            D+N+ ++++ LYK T LQ  FG   L LV  +P  LNLKQ L ++++F+E+ IR+RT + 
Sbjct  308  DANSNIILNQLYKHTRLQDTFGINMLALVDNRPEVLNLKQILQHYIKFQEQVIRRRTEFD  367

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAK  279
            L+    +  ILEGL  A   I  +I +I  S+ + EAK
Sbjct  368  LEKASARAHILEGLKIALDHIDEVISLIRGSKTAQEAK  405


>gi|1170143|sp|P41513|GYRA_ERWCA  DNA gyrase subunit A
Length=878

 Score =  249 bits (635),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 129/281 (45%), Positives = 189/281 (67%), Gaps = 4/281 (1%)

Query  2    FLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDA  61
             L ++  ETV+F  N+DG+++ PDV+P ++P L +NGSSGIAVGMATNIPPHNL E+V+ 
Sbjct  134  LLADLEKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHNLTEVVNG  193

Query  62   LIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEINL  121
             +A +++++I+ + L + IKGPDFPT   +   + IEE Y TG+G + IR     E    
Sbjct  194  CLAYIDDENISLEGLMEHIKGPDFPTAAIINGRRGIEEAYRTGRGKIYIRARAEVE----  249

Query  122  GKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKK  181
               K  R  +I+ E+PYQ++KA  IEK+AELV   +I GI+ +RDESD+DGMRIVIE+K+
Sbjct  250  ADAKTGRETIIVHEIPYQVNKARLIEKIAELVKDKRIEGISALRDESDKDGMRIVIEIKR  309

Query  182  DSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYF  241
            D+  E+V++NLY +T LQT+FG   + L QG+P  + LK  L  F+  R E + +RT + 
Sbjct  310  DAVGEVVLNNLYSQTQLQTSFGINMVALHQGQPKIMPLKDILVAFVRHRREVVTRRTIFE  369

Query  242  LKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL  282
            L+   ++  ILEGL+ A  +I  IIE+I  + +  EAK+ L
Sbjct  370  LRKARDRAHILEGLAIALANIDPIIELIRRAASPAEAKASL  410



>ORF traduction [3-848 sens direct]
GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVDALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEEL
YETGKGSVIIRGVINKEEINLGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELKKDSNTELVISNLYKKTTLQT
NFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGYFLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKL


>cyano1 gi|78778390| DNA gyrase/topoisomerase IV [Prochlorococcus marinus str. MIT 9312]
MDKKKFTSISLQEEMQRSYLEYAMSVIVGRALPDARDGLKPVQRRILFAMYELGLTPDKPFRKCARVVGD
VLGKYHPHGDQAVYDALVRLVQNFSTKYPTLDGHGNFGSVDNDPPAAMRYTETRLAPISHKGFLEEIDSE
TVNFSNNFDGSQKEPDVLPAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVDGLIALINNKEVSNKKLSNI
IKGPDFPTGGELIYSRAIEELYATGKGSITIRGVINSEAINLGKGKHKRNALIITELPFQISKAGWIEKL
AELVNSSKINGISDIRDESDRDGMRIVIELKKDSNAELVISNLYKKTTLQTNFGAIFLALIKGKPVQLNL
KQYLNYFLEFREETIRKRTNYFLKNTLEKLEILEGLSKATKNIKKIIEIIEDSENSAEAKSKLIDIFYLS
AKQANSVLDMPLKKLTNLEKNQIDEDIRKLQEKKDYFQNLLNERKLLLELLVDELLILKKKYNVKRKTKL
LKNIDQNEELETINNQILEDFINKKTKLFIDNRLYLRKMILNNYKKSFEDVNKIIDNKNIQKFICNIDKN
VKIIGITYTGKVFHINWESNINNDYKLDKKIIGNIDQNKIINFHSIKKGIKNYLCILNSDGRFKKVLFDE
DMIKSNRCFSITKLKNNIKTIDSFIFSEEKNLIILTSIGRMFKFNLSNKFLTPTTKQSQGLMLTKLLPTE
KIVSCCSYQNGENIYLVSRKGKIFCINSNEIYYANEYSLGYLNEITQLKNDYFLKILPSNHYLDIETNKN
KSARLNFDKLNFKSKKTNFLIDFLKLDDEEYIENCFQLENFLD

>cyano2 gi|33860565|DNA gyrase/topoisomerase IV [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
MTKEKFTSISLQEEMQRSYLEYAMSVIIGRALPDARDGLKPVQRRILFAMHELGLTPDRPFRKCARVVGD
VLGKYHPHGDQAVYEALVRLVQDFSTKYPTLDGHGNFGSVDNDPPAAMRYTETRLAPIAHECFLQEIGSE
TVSYSNNFDGSQQEPDILPAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVDGLIALINDKEISDLRLSKI
ILGPDFPTGGELICNSAMNEVYLQGRGSVTVRGVIKNEEINLGKGRHKKNALIISELPYQISKAGWIEKL
AELVNLGKIDGISDIRDESDRDGMRVVIELKKDSNSEIVVSNLFKKTALQSNFGAIFLALVDGKPIQLTL
RKYLNYFLEFREETIRKRTKYFLRIASEKFEILEGFSIATKNIKDIIEVIQNSENATEAKSILIVKLSLS
EKQADAVLSMPLKKLTTLERKQIEIDMKELLEKKKYLNNLLNNRRLLLDTLIEELKSLKKKFNVKRKTKI
LKDINQEKEIDTINNQILEDLINKETKISVDNRFYFKKIIYNNYKKILDHENKFIDNKNVQKFICRIDKS
LKIIGITSSGKIIQIDWKSNITSEFKMDKKVLGNIDPKEIINFHYLDSKLKNYLCILSSDGRFKKVLFDE
DMIKSNRIFSITKLKNSTSIIDSFILNKQQQLVILTSIGRLFKFDLSDKNLNPSTKQSLGLLLVNLLPTE
QIVSCCKSKDKEILYLVSKKGKFFKLKIDDIYNSYNSKLGYVNEKMQLKDDHFITVLSSNQYIDIETNKN
KSARLNLNKLDNNSGKNMLKIDFLNLEKDEYLDNCYRLEKYIN

>cyano3 gi|72383169| DNA gyrase/topoisomerase IV [Prochlorococcus marinus str. NATL2A]
MAKERLKPISLHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRRILFAMHELGLTPERPYRKCARVVGD
VLGKYHPHGDQAVYDALVRQVQVFNSRYPILDGHGNFGSIDDDPPAAMRYTETRLAPISNDAILSEIDQE
TVDFSPNFDGSQQEPDVLPAQLPFLILNGSTGIAVGMATSIPPHNLNEVVEALIAIIKKPSLNEEKLLEI
IPGPDFPTGGEILVSNGIKETYTKGRGSITMRGIARIEEINPGKGKHKRSGIIISELPYQLNKASWIEKL
ADLVNNGKISGIADIRDESDRDGMRILVEVKRDSDPKKILDFLYQKTSLQSNFGAILLALVNGQPVQLTL
KKLLNNFLEFRENTILLRSNYLLKNIKNREEIVDALIQATNNVKKVIDLIEKSKDTPEAKSNLIISLKIN
ERQADGILGMPLKKITGLEKDSLKNELKDLKTKRAELELIINDKENLMKVMVKELKDLKKRFGSKRRTKL
IEGGDALIAEKMANQRPNKELQRINALKELSKDSEIIIQSNNEIKIIPSLTIKKLKLKEINQERKDILPA
KLIWPIKNEPKILAVSQEGKIGLLKWEFAGQKPGPLKQFLPAGLENDKIINLIPLTEIRDISIGLISTDG
KFKRISINEISDISNRSTTILKLKDSVKLKSCILCKENSYLYIVSDIGRIIKIKITENDFPFMGKLAQGT
NIIKLFPNENIVEALSFQEKKNKDLILITNKGFFVKHSTKEITISKKGALGTMGIHFKDNKTIKERVIDC
FINNKHVYVKTDKDRYQRLKTDQIDNSSYRKENKLNIDLKNDEFLKSTFSMKVPDKN

>cyano4 gi|33862278| DNA gyrase/topoisomerase IV [Prochlorococcus marinus str. MIT 9313]
MAEERLQPIALHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRRILFAMHELGLTPDRPYRKCARVVGD
VLGKYHPHGDQAVYDALVRLVQNFSSRFPVLDGHGNFGSVDDDPPAAMRYTETRLASIAHMALLDEIGEE
TVDFTANFDGSQQEPSVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALIRKPDLSDDKLLGL
IPGPDFPTGGEILLGTGIHETYLKGRGSIPMRGVAHVEEIQPGKGRHRRSAVVVTELPYQLSKAGWIEKL
ADLVNNGKIGGIADIRDESDREGMRIVVELRRDANPENVLGDLHRRTSLQSNFGAILLALVNGQPQQLSL
RKLLQTFLEYRELTVIRRTNHALEKTKARLEVVEGLITALNALQAVIAMIQEAADAAAARARLMVQLDLN
EKQADAVLAMPLRRLTSLEQSSLRQEAKELQEKQEQLQFLLENRESMLEVLIQELRQLKKRFNNPRRTRL
VEGGDDLVAERAANQRPNAEVQRQQALSALPSDGRILIQQDSQVKVMSPQILGRLHLNEACKLSDGPSPA
RLILPIEPAPRLLAVTNNGRVALVRWEFAGQQPGSLERFLPGGLEKETLINIFPLPVDQNLSLGLLSSDG
RFKRLPIEEVMELSGRAATIVKLKDGVILKSAFICKANDDVILASNIGRVIRINVNNDSMPLMGKLAQGP
MTMRLLPEEMVVGAVSCPPNCESTVLLATRLGKFAKILVSSIRICQRGDLGEIGLTIKDSSRDQDRVVDI
CNGNRLVGLVSSQGRHGRIEAGKLELTIPIKPSLNIVELKDNEEIQKLVPLITTNNTLD

>cyano5 gi|33239457| Type IIA topoisomerase, ParC [Prochlorococcus marinus subsp. marinus str. CCMP1375]
MAKERFQPISLHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRRILYAMHELGLTPERPFRKCARVVGD
VLGKYHPHGDQAVYDALVRLVQSFSSRYPVLDGHGNFGSIDDDPPAAMRYTETRLAPIANQALLNEIDDK
TVDFSQNFDGSQQEPDVLPAQLPFLVLNGCSGIAVGMATNIPPHNINEIINGLIALIKKPELSEDKLIEI
IPGPDFPTGGEILLSNGIKETYLKGKGSIPMRGITHIEEINPGKGKHRKKGIVITELPYQVNKAAWIEKL
ADLVNNSKIDGIADIRDESDRDGMRIVIELRRDIDHEIVKDTLYQKTNLQNNFSATLLALVNGQPKQLSL
KRLLIIFLEYRELTIRKRTKNKLKQTLARLEILEGLIKALKNLKKVINLIENAKDSIDAKIKIMSELKLN
EKQSEGILSMPLRKLTNLETQGLYNEANDLKILEKNLREILENRSQLLSEMVNELKLLKKKFGSQRKTKL
VEGGDELVAERNANLRPNAELQRKKAFESLPKDGYLLIQDDDQVKILRPQILTKLNLTESCLLGEGPVPT
RLLWPIAKQPKILAITNHGKIALLKWEFAGSQPGQLNRFLPSGLEGEKITNLLPLLNTENLSLGLLSTDG
RFKRTNLNEIIDISGRATTILKLKDGVFLKSALLCPLNGHLLVVTNIGRIIKLKINEESIPLMGKLAQGS
VMIKLFPGENIIGALTTKEKENCNIILISEKGTVIKHSLKSIKESSKGDLGEIGISFKDKNNQKDRLIQT
YNAKQLVGIKTNQGKHGRVSSNQIEKLKFNEEQKKAFNLEKNELLEKIIPLIEENSYN

>cyano6 gi|88809359|DNA gyrase/topoisomerase IV [Synechococcus sp. WH 7805]
MAEERVQPIALHQEMQRSYLEYAMSVIVGRALPDVRDGLKPVQRRILYAMHELGLTPDRPYRKCARVVGD
VLGKYHPHGDQAVYDALVRLVQTFSSRHPLLDGHGNFGSVDDDPPAAMRYTETRLAPIAHEGLLDEIGND
TVDFANNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALVREPDLSNDKLLKL
IPGPDFPTGGEVLLGSGVRDTYLRGRGSIPMRGVAHVEEVQLGKGRHKRNAVIVTELPYQLSKAGWIEKL
AEQVNDGKIGGIADIRDESDREGMRVVVELRRDADPDAVLKDLQRRTSLQSNFGAIMLALVDGQPQQLSL
RQLLQTFLDYRELTLIRRTTHALRKAEDRLEVVEGLITALQSLQRVIAMIQEAQDAAAARASLMVHLDLS
ERQADAVLAMPLRRLTGLERESLRQEAEELRAQRQRLKLLLDNRDQLLDALTKELRQLKKRFATPRRTRL
VEGGDHLLAERAANQRPNAELQRRQALDALPPDSRILIQDDGQVKVISPQLMGRLHLNEPTALGDEPSPA
RVILPIKPVAKLLAVTASGRVALIRWEFAGQQPGSLERFLPTALQGDPVVSVLQLPDADADSNKAAVSSL
GLLSSDGRFKRLPMQELLDLSGRAASVVKLKEGVELKTAVICREGGTLSLISDLGRVLPLPVTEDNLPLM
GKLAQGPVTMRLLPGETLIAAVATDPEQQDPLLLFSRHGRIKPLSLDTVRLCQRGNLGVIGWQPEQDGNE
GEDRLCAACVGSGLVGIVTSSGRHGRLLTREPNDLTLKSGETLERIVPLLN

>cyano7 gi|78183589|DNA gyrase/topoisomerase IV [Synechococcus sp. CC9902]
MQRSYLEYAMSVIVGRALPDARDGLKPVQRRILYAMQELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVY
DALVRLVQTFASRHPLLDGHGNFGSVDDDPPAAMRYTETRLAPIAHQALLEEIGDDTVDFASNFDGSQQE
PTVLPAQLPFLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALIRQPGLSDERLLELIPGPDFPTGGEVLL
SSGLQDTYLQGRGSIPMRGVAHTEEVQLGKGRHKRNAVVVTELPYQLSKAGWIEKLAESVNDGKIGGIAD
IRDESDRDGMRVVVELRRDAEPEKVLKDLQRRTALQSNFGAILLALVNGQPQQLSLRQLLQTFLDYRELT
LIRRTSHALRKTEDRLEVVEGLITALNNLQAVIAMIQEAKDAASARASLMVRLDLNERQADAVLAMPLRR
LTGLEQESLRQEVDNLRNEKERLKLLLENRDQLLDAMVAELKTLKKRFSTPRRTRLVEGGDALIAERAAS
QRPNTELLRQQALAALPGDGRLLIQADGQVKIVTPQVLGRLHFGDPCPVSDAPSPARVILPIEPPPRLLA
ISANGRVALVRWEFAGQQPGALERFLPSGLEGEPIVAIAPLPMQESSDLSLGLLSSDGRFKRLPLAEVLE
LSGRATSVVKLKDGVQLKAAVICHEHHDLILVSDIGRMLRLPINEDVLPRMGRLAQGPMTMRLLPGEHLI
GALCPTKPTALLVSEQGRLARIDLTSIRSSQRGDLGSMAIQLVGDTDRITGLTEASGLIGMVSTEQRHGR
IDPTTLEITNPGEEFSNQIELHQGETITDLIPQISG

>alpha1 gi|110679940|DNA gyrase [Roseobacter denitrificans OCh 114]
MRPERPVYDGPSVSIEQEMRTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILFAMHETGNTHDKPYRKSAR
PVGDVMGQYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDNPAAMRYTEVRMDKPAAYLLADI
DKDTVDFQDNYDGKQKEPTVLPARFPNMLVNGAGGIAVGMATNIPPHNLGEVIDATLALIEEPDLTSEQL
IDYVPGPDFPTGGIMLGRGGARKAYLEGRGSVIIRAKTRVEEIRKDRWAIIVDEIPYQVNKATMIEKIAE
QVREKKIDGIAHVQDESDRNGVRVVIELKRDATAEVVMNQLYRFTPLQTYFGCNMLALNGGRPEQLTLRK
FLTYFIDFREDVVARRTAYLLRKARERSHVLCGLAVAVTNIDEVVATIRASADAAEAREKLMTRRWPAQD
ILPYIALIDDPTHTANDDGTYNLSETQARAILDLRLQRLTQIGVKEVTDELEELAGKIKEYLEILGSRDR
IMGIIADELREVRELFAVPRRTEIVDWSGDMEDEDLIAREDMVVTVTQGGYIKRTPLADFRSQRRGGKGL
SGGSLKEDDVVTTLFVANTHTQLLFFTTDGMAYKLKTWRLPQGARTSKGKAIVNILPIPQGVSIAAILPI
DRDEKDWSQLQIVFATSAGTVRRNALSDFTNVKSNGKIAMKFEDEHAETTLINARIASPDDDVMLVTASG
RAIRFPSEDVRVFNSRSSVGVRGVKLSGHDKVVSMSVIRHFDATADERAAYLKMRRAMVGLTDDSETSDE
DETSANATISPDRYAEMSAAENLILTLTAGGAGKLSSSHDYPVRGRGGMGVTAWDKRMQTGQIVASFPVE
MDDQIMLATSKGQSIRVPVEGISFRSRSAGGVKVFNTGKGEEVVSVAWIADQGEDDTDGEDAQNA

>alpha2 gi|16125827|DNA gyrase subunit A [Caulobacter crescentus CB15]
MSDDHNTIPADGSRGDIAPINIEDELRRSYLDYAMSVIVSRALPDARDGLKPVHRRVLFSMHEQGQTPER
PYVKSARVVGDVMGKYHPHGDASIYFTLVRMTQSFSMGLVLIDGQGNFGSVDGDMPAAMRYTECRMAPPA
MALLADLDKDTVDFADNYDGKEQEPTVLPSRIPNLLVNGAGGIAVGMATNIPPHNLGEVIDACLLLIDQP
DVTTDQLLDLVPGPDFPTGGEIIGRAGPRQALLTGRGSVIMRGVASVEELRAGREAIIVTEIPYQVNKAN
LVEHIAELVRDKKIEGVADIRDESNRDGMRIVVELKRDASGEVILNQLYRFTALQSSFGVNMLALNRGRP
EQMGLHQLIQLFVDFREEVVVRRTKFELGKARDRGHVLVGLTIAVANIDEFIHIIRSSKDPTEARERLVA
KSWPAGDMLPLVELIADPRTVQEDGGLIRLTDEQARAILALTLSRLTGLGRDEIGNEAAALADAIRGYLE
LLSDRANIMAVVREELVEVREKFAIPRRCQIVDGDADMEDEDLIVREDMVITVTMGGYVKRTPLANYRTQ
HRGGKGKSGMATKNEDAVTRVFSASTHAPLLFFTSGGKVYKMKVWRLPLGVANSRGKAFVNLLPIEPGET
ITSILALPEDEATWGGLDVMFATRSGSVRRNKLSDFVDVRRNGKIAMKLDEGDGIVGVAVCNADQDVLLT
TAAGRCIRFSVDEVRVFASRDSTGVRGVKLLDGDQVISMAVLRSVDATPAERAAYLKHQRAMLRAADGEE
GEDTATAADDGDEEVGEASLTPERIAELGAAEEILLTVSSEGFGKRTSAYDFRRTGRGGQGLAAQDLSKR
GGRLVGSFPIDESDQILLVTDQGQLIRVPVSQIRVAARNTQGVTIFRTAQDEHVVSVERLADSGGDDNQG
EDSGADETP

>gramplus1 gi|51891145|DNA gyrase[Symbiobacterium thermophilum IAM 14863]
MAGDFAQRILTKEIKHEMETSYLTYSMSVIVGRALPDVRDGLKPVQRRILYAMYESGNTADKPFRKSAKT
VGDVLSKYHPHGDAAVYDTMVRMAQDFVLRYPLVEGQGNFGSIDGDPPAAMRYTEARLSRLAHEMLADIE
KNTVDFEDNYDNSEKEPTVLPSRFPNLLVNGSTGIAVGMATNIPPHNLGEVIDGIIRLIDQPDISIEELN
RIIKGPDFPTGALILGHEGIRRAYQTGKGSITLRARTQIETLQNGRNRIVVTELPYGVNKAKLIERIAEL
HRDRKIDGITDLRDESDRSGLRIAIELRRDANPHVILNQLFKYTALQQNFGIIMLALVENRPRLLNLKQM
LHYYLQHQLEVIVRRTQFDLQKALDRAHILEGLLKALDIIDEVINTIRSSPTTDEARSRLMSNFGFTEVQ
AQHILDMQLRRLTALEREKLQEEYDELQDRIAYYRAVLASEKMQYDIIKQELGEIKKKYGDPRRTRITPD
DGDIDIEDLIADEDVVVTISHSGYIKRVPLSTYRQQRRGGRGVQGAGTKEEDFIEHIFTTTTHHDMMFFT
DQGRVYRIRCHEIPEASRQARGTAIVNLIPLLPGEKVNTVIPVKEGDQEEGYIFFATRSGWVKKTAVTEF
QNVRSTGIIAIKLEEGDTLVGARLTRGNDEIILVSSAGYALRFHEDDVRPMGRDTRGVKGITLGPDEYVV
GMDGVVPGADLLVVSETGVGKRTPLTEYPTYKRGARGVITIQLLPERHGRLVGVKAVTEGNDLMLVSEQG
VLIRIPVEEVRRSGRNTQGVQLMNLDANDRVSAVAQVVTRDEE

>alpha3 gi|115524770|DNA gyrase,[Rhodopseudomonas palustris BisA53]
MPLSDTDDRKPGEPPAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILFGMYENGFE
WNKPYRKSARTVGDVIGKYHPHGDQSVYDAMVRMAQDFSMRVPLIDGQGNFGSVDGDAPAAMRYTESRLT
KIAQLLLDDLDKDTVDYQDNYDGSFREPRVLPAKFPNLLVNGAGGIAVGMATNIPPHNLGEVIDACVALI
EDPALSIDDLSKIIPGPDFPTGGIILGRAGIRLAYHTGRGSIVMRGKVSIEPARKDREAIIISEIPYQVN
KATMVERIAELVREKKIEGISDLRDESDRDGFRVVIELRRDAVADVVLNQLYRFTPLQTNFGANMVALDA
GRPLLMNLKDLLTLFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRASPDPATARDT
LMSRDWPAQDVAAMITLIDDPRHRLNEDGTARLSFEQAKAILDLRLQRLTALGREEISEELDKLAVEIAD
YLEILRSRARVQTIIKDELAAVKAEFATPRRTEIIEQEGEVEDEDLIQREDMVVTVSHAGYVKRVPLSTY
RAQRRGGKGRAGMATREEDFVSRLFVASTHTPVLFFSSRGQVYKEKVWRLPLAPPNGRGKALINILPLEQ
GERINTIMPLPEDESSWAEFDVMFATTRGTVRRNKLSDFVDVRRSGIIAMKLDDGEAIVDVQICTDRDDV
LLTAAEGQCIRFAVTDVRVFQSRASMGVRGMALANGDQVISLTILRHFDATPAERTTYLKQSGAIRRAAT
GEEVEPSEVVEAAVEPEEETDGLAALSPERYAEMSANEQFVLTISENGFGKRTSSFEYRTTGRGGKGIVA
MSVNARNGKLVASFPVEEEDQIMLVTDKGQLIRCPVGGIRIVGRSTQGVTVFNTAEDEHVVSVEHIGEEA
ENGNGDGG

>alpha4 gi|39935665|DNA gyrase [Rhodopseudomonas palustris CGA009]
MKRSYLDYAMSVIVARALPDARDGLKPVHRRILYGMYENGFEWNKQYRKSARTVGDVIGKYHPHGDQSVY
DALVRMAQDFSMRVPLIDGQGNFGSVDGDMPAAMRYTESRLTKIAQTLLDDIDKDTVDFQPNYDNSEREP
QVLPAKFPNLLVNGAGGIAVGMATNIPPHNLGEVIDACIALIDDPALSIDDLNKIVPGPDFPTGGIILGR
AGIRAAYQTGRGSIVMRGKVEIETVRKDREAIIVSEIPYQVNKATMVERIAELVREKKIEGIGDLRDESD
RDGFRVVIELRRDAVPEVVLNQLYKFTPLQTNFGANMVALEGGRPQLMNLKDLLTVFVAFREQVVTRRTK
FLLNKARDRAHILVGLAIAVANIDEIIRVIRNSPDPNTARETLMSRDWPAADVAAMITLIDDPRHKLNPD
GTARLSFEQAKAILDLRLQRLTALGREEISEELDKLAVEIADYLEILRSRARVQAIVKTELGEVKAEFAT
PRRTVIAEQEGEVEDEDLIQREDMVVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVAS
THTPVLFFSSRGQVYKEKVWRLPLAPPNGRGKALINILPLEQGERITTIMPLPEDEASWSELDVMFATTG
GNVRRNKLSDFVDVRRSGIIAMKLDEGEAIVDVQICTERDDVLLTAAGGQCIRFPVPDVRVFSGRTSMGV
RGIALSSGDTVISLSILRHFEATPAERSTYLKQSGAIRRAATGEENEPVETPEAEAEEGDTSAALSQERY
AEMSASEQFVLTISENGYGKRTSSFEYRTTGRGGKGIVAMSVNSRNGKLVASFPVEDSDQIMLVTDNGQL
IRCPVEGIRVAGRSTQGVIVFNTADDEKVVSVERIPETDDGENGNGG

>eubact1 gi|78045002| DNA gyrase [Carboxydothermus hydrogenoformans Z-2901]
MFSIGKVLPVKLEEEMKSSYLDYAMSVIVGRALPDVRDGLKPVHRRILYAMHILGMTPDKPHRKSAHIVG
EVLGKFHPHGDVAVYDAMVRMAQDFSTRYPLIDGHGNFGSVDGDSAAAMRYTEARMAKITVEMLRDIDKE
TVDFMPNYDNSTKEPVVLPSRIPNLLVNGSSGIAVGMATNIPPHNLREVIDGVVKMIDDPEVEIGELMKI
IKGPDFPTGGKIMGRQGIRQAYTTGRGTIKVRAVTTFEKLSGGKTAIIVTELPYQVNKAKLIEKIAELVR
DKKIDGIADLRDESDRKGMRIVIELKRDANPQVVLNQLFKHTQLQDTFGIIMLALVDNQPRILNLKEILF
YYLEHQKDVVTRRTRYDLNKAEERAHILEGLKIALANLDEVIKIIRGSKDVDTAREGLMSRFGLTEKQAQ
AILDMRLQRLTALEREKIDEEYRELIKKIEYFNSILADERVLLGVIRQELLEIKEKYGDARRTQITNEES
IFDEEDLIAEEDMVITITHQGYIKRLPVDTYKNQRRGGRGVTAMATKEEDFVRHLFVTSTHNYLLFFTNK
GKVYRLKVHEIPEAGRQAKGTPIVNLLYVDQDERITAIIPVKEFTDDHYLFMVTKNGIVKKTVLSEYDSS
RRDGIIALSLEEGDKLIDVKLSTGQEEVIIGTKKGMAIRFSETDVRPMGRTARGVKGITLSPGDEVIGLE
VVDEQAELLTVTSKGFGKKTPFSEYRVQGRGGKGIINMKVTQKNGEVVGIVAVRPEDEVMAISGEGIMIR
VKAAEISTQGRATQGVTLMKLNKDDQLTAVAKIAAQEDEEND

>eubact2 gi|82499796| DNA gyrase,[Caldicellulosiruptor saccharolyticus DSM 8903]
MEEFDFRIIPVEIQEEMKRSYIDYAMSVIVSRALPDVRDGLKPVHRRILYAMNEIGLTPDKPYRKSATVV
GHVLAKYHPHGDAAVYESLVRMAQDFSMRHPLVDGHGNFGSVDGDPPAAMRYTEARMSKIAIEMLRDIEK
ETVDFMPNFDESAKEPKVLPSRFPNLLVNGSQGIAVGMATNIPPHNLAEVIDAIVYLLDNENAGLDDIMK
IIKGPDFPTGGYIIGKKGIRDAYATGKGKIIVRAKATIEQTSKGRQRIVVTELPYMVNKARLIEKIAELV
HEKRIDGISDIRDESDKEGLRIVIEIKKDADANVVLKQLYKNTQLQDSFGIIMLALVDNQPKVLTLLDML
NYYIEHQKDVIVRRTKYDLKKAEERAHILEGLKKALDHIDEIISIIRSSRTVNEAKERLIKRFGFTEVQA
QAILDMRLQRLTGLERQKIEEELAELLKMIEYYKNVLANEAMVKEIIKKEILEIKEKYKDERRTKIIQDE
QEDFEEEELIQEQDTVITLTHFGYIKRLPLDTYKSQKRGGKGITGISTREEDFVEEVFVTTTHHYILFFT
DKGKAYRLRAYEVPEASRQAKGTAIVNLIQIGKDEKITACMTVKDFKEGFLMMCTKNGTIKKVLLSEFEN
TTKAGKKAITLAEDDCLIDVKLTSGNDEMVLVSSGGYCVVFNENDVRVMGRSAQGVKGMTLEDGDFVVGM
EKASDGKYLLCVTENGFGKRSDIEEYRKTKRGAKGVLTYKVTEKTGRIVDIKMVNDEDEIMLCSTEGIFI
RLEMSQVPVQGRNTQGVKLMRIDSDSIKVSSIARIKAEQ

>eubact3 gi|56418541|DNA gyrase [Geobacillus kaustophilus HTA426]
MAEHEQPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPVHRRILYAMHDLGMTADKPYKKSARI
VGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLVDGHGNFGSIDGDAAAAMRYTEARMSKIAMELLRDIN
KDTIDYQDNYDGSEKEPVVLPSRFPNLLVNGSSGIAVGMATNIPPHQLGEVIDALLALSQNPEMTVADLM
EYIPGPDFPTAGQIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGKETIIVTELPYQVNKAKLIERIAEL
VRDKKIDGITDLRDESDRSGMRIVIEVRRDANAKVVLNNLYKHTALQTSFGINMLALVNGEPKVLNLKEC
LEHYLNHQKTVIRRRTAFELKKAEARAHILEGLRIALDHLDEVIDLIRRSQTTEAAREGLMARFSLSERQ
AQAILDMRLQRLTGLEREKIEQEYQDLVRLIAELRGVLADEEKVLQIIRDELSEIKERFNDERRTEIVSG
AVEQFDDEDLIPQEHVVITLTHKGYIKRLPLSTYRSQKRGGRGVQGMHTAEDDFVEHLLITSTHDTVLFF
TNKGKVYQAKGYEIPEFGRTAKGLPIINLLELDKDEWINAMIPIESEFSDERYLVFATKQGIAKRSPLSA
FAHIRNNGLIAIHLREGDELISVRLTDGKKHLIIGTKNGMLIRFPETDVRAMGRSATGVKAITLDDGDEV
VGMEILEDHHDVLVVTKKGFGKRTPASEYRVQSRGGKGLKTCNVTDKNGPVVAVTTVVGNEDVMVITTGG
VLIRIAVSDISRTGRIAQGVKLIRLSGEDGHECVATVAKVPEEERDEE

>beta1 gi|94309658|DNA gyrase [Ralstonia metallidurans CH34]
MDQFAKETLPVSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELNNDWNRPYKKSARIV
GDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNAAAMRYTEIRLSKIAHEMLQDIDK
ETVDFEPNYDGSEKEPGILPARIPNLLINGSSGIAVGMATNIPPHNLNEVVDACLHLLRNPDATVDELIE
LVPAPDFPTAGIIYGIQGVREGYRTGRGRVVMRARTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAEL
VTEKKVEGISDIRDESDKSGMRVVIELKRNEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQM
LDAFLSHRREVVTRRTVFELRKARERGHVLEGLAVALANIDEFIAIIKAAPTPPIAKQELMSKPWDSGLV
REMLARAESDTAGGRASYRPDGLPAVFGMQPDGLYRLSDGQAQEILQMRLQRLTGLEQDKIVQEYREVMG
LIADLLDILARPERITTIITEELGAIRAEFGDERRSQIELNATELDTEDLITPQDMVVTLSHSGYMKSQP
ISEYRAQKRGGRGKLATATKEDDWIDTLFVANTHDYILCFSNRGRLYWLKVYEVPQGSRNSRGRPIVNMF
PLADGEKINVILPVRQFDAEHFIFMATARGTVKKTVLTDFSNPRKAGIIAVDLDEGDFLIGAAVTDGQHD
VMLFSDAGKAVRFDENDVRPMGRQARGVRGMNLDEGQAVIAMLVAPAESAETESSVAEGDVSPVGSVLTA
TENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGRVVAAALVSPEDEIMLITTGGVLIRTRVAEIREMGR
ATQGVTLINVDEGTKLSGLQRIVESDADNGSGAEEGEAADDAAGATDAGATDAGANS

>beta2 gi|71906869|DNA gyrase subunit A [Dechloromonas aromatica RCB]
MDQFAKETLPISLEDEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLFAMHELNNDWNKAYKKSARIV
GDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDSAAAMRYTEVRMAKIGHQMLEDLDK
ETVDFGPNYDGSENEPLVMPARIPNLLINGSSGIAVGMATNIPPHNLNEVIAGCLALLENPALSIEDLIA
YIPAPDFPTAGLIYGMTGVREGYQTGRGRVIMRARTHFEDMEKSNGRQALIVDEIPYQVNKKSLIEKIAE
LVNEKKIEGISDIRDESDKSGMRIVIELKRGEVGEVILNNLYKQTQLQDTFGMNMVALVDGQPRLLNLKQ
MLECFLSHRREVITRRTVYELRKARERGHILEGLAVALSNVDEIITLIKAAPTPADAKRGLMERTWRSAV
VEEMLVRAASDASRPEGLAPEFGLSAQGYRLSDAQAQAILELRLQRLTGLEQDKIVGEYKDVMAKILDLL
DILAKPERITEIIVTELVAIREQFGDERRSEIILQTHELSLEDLITPQDMVVTLSHGGYIKAQPLADYRA
QRRGGRGKQAAAIKDEDFVDHLFMANTHDFILCFSNRGRCYWLKVYEAPQGSRVSRGKPIVNLFPLEEGE
RINAVLPVKEFADDKFIFMATRAGTVKKTPLSDFSNPRKAGIIAVDLLDDDYLIGVELTTGQSDIVLVSN
AGKAVWFDEEDVRPMGRGARGVRGMKLQAGQAVISLLVAESDQQTVLVATENGFGKRTVLADFRHSGRGT
QGVKAIADSERNGVVIGAKLVDDNDEVMLITTGGVLIRTRVSEIRGMGRATQGVTLISLDDGEKLAGLEK
VAESVAEAEVEGESEVVAPETGDAAPSEGDVASNEGGEV

>gama1 gi|110834612|DNA gyrase [Alcanivorax borkumensis SK2]
MTDLAREVTPVNIEDELKQSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELNNDWNKAYKKSARVV
GDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEVRMAKIAHELLADLDK
ETVDFVDNYDGTERIPDVMPTRVPNLLVNGSSGIAVGMATNIPPHNLGEVVDGCLALIDDDSLTPDDLME
YIKGPDFPTAGIINGRAGIVQAYRTGRGRVYMRARAEIEATDKSGKEAIIVTEIPYQVNKARLIEKIAEL
VKDKKIEGITELRDESDKEGMRIVIELRRGENAEVVLNNLYQQTQMESVFGINTVALVDGQPKILNLREL
LDAFIRHRREVVTRRTVYELRKAREKAHLLEGLAVALSNIDPVIELIKASPSGAEAKAKLLDKGWKPGDV
LQMLERAGGENAARPDGLDEQYGLVDGLYHLSPEQAQAILDLRLQKLTGLEREKLINDYQELLEQIAELL
KILGNPERLMEVIREELQAVREEYADERRSEIVASRQDFSMEDLIAEETVVVTLSNGGYAKMQPIDTYRA
QKRGGRGKSAGQLKDQDYVEHLLVAGTHDTLLLFTNAGKVFWLRTFELPQGGRASRGKPIVNLLPALGAD
ERITAILRLDADMVRQQKAGGEEDIVDVDDAADVIEDETDSDVEVEGEVEAVTDTVPGPFIFMATSSGIV
KRTALANFARPRSSGLIAVKLQEGEHLVNVAITQGHEDIMLVARNGKAVRFHQSKVRVMSRLARGVRGIK
LAEGVDVISLIVPEENGQILTASEHGYGKRTPLTDYPTKGRGGQGVIAMVINERNGELVGATQVFGEEDI
MLISNQGTLVRTGVNQVSTSGRNTQGVRLIRLADGEALCGLATIPELEGVEEEDGEADEVLDGEATPEAP
KSDASDDAEE


>gs1 gi|21672982|DNA gyrase [Chlorobium tepidum TLS]
MQREKILPISIEEEMRDSYLDYSMSVIVSRALPDVRDGLKPVHRRVLYGMHELGLQAGKPYKKSARVVGE
VLGKYHPHGDSAVYDSLVRMVQDFSLRYPLIDGQGNFGSVDGDSPAAMRYTEVRMKAIAGEMLKDLDKET
VDFSLNFDDSLEEPTVLPAAIPNLLVNGASGIAVGMATNIPPHNMREVVSGLIALIENPEIEIGDLMKHV
TAPDFPTGGIIYGYEGVRQAYLTGRGKVVIRARAVVEVTQKNGRESIIVTELPYQVNKVRLIEKIVELVH
DKKVEGIADIRDESDREGMRLVIELKRDAVAKVVLNNLYKHTPMQDTFGVIMLALVDGVPRVLNLKEMMQ
YYIRHRNEIVLRRTQYDLNAAEKRAHILEGLKICLDNLDEVISTIRQSPDTPAAQSRLMDRFGLTEAQSK
AILEMRLQRLTGMERQKIDDEYRETLALIEELKSILESPAKQMEIIKAELLKVSDVYGDERRTELRPQEG
DFSIEDMIAQEDVVITITHEGFIKRFPVSGYRRQHRGGRGVAGAQAKNEDFIEHMFIASTHNYILFFTTA
GRCYWLKVYEIPEAGRAARGRSLANIMELPPGEKIRTYINVRNFDDPHFIIMATAKGIVKKTSLEEYSHP
RRTGINAITIDEGDELIEARLTDGDHQIILAKSSGYAVRFPESEVRSMGRTAMGVKGITLDEDERCISMV
TTKRNDTSLLAVTDNGYGKRSKVEDYRMTKRGARGVITIKAHEKIGNLVGLLDVNDEDDLIIITTNGIVI
RQHVSDIRVLGRNTSGVRLIRLDAGDRISATARVPKSDDDSATEPLGDEGQIDLEF

>gs2 gi|67934854|DNA gyrase [Chlorobium phaeobacteroides DSM 266]
MQRERILPISIEEEMRDSYLDYSMSVIVSRALPDVRDGLKPVHRRVLYGMHELGLQAGKPHKKSARIVGE
VLGKFHPHGDTAVYDSLVRLVQDFSMRYPLIDGQGNFGSIDGDSPAAMRYTEVRMKAIAGEMLKDLDKET
VDFSLNFDDSLEEPTVLPSAIPNLLVNGSSGIAVGMATNIPPQNLREVVDGIIALIENPDIEIADLMKHV
IAPDFPTAGIIYGYEGVKQAYLTGRGKVVIRARALVEVTQKNGRESIIVTELPYQVNKVRLIEKIVELVH
DKKLEGIADIRDESDRDGMRLVIELKRDAVAKVVLNNLYKHTPMQDTFGVIMLALVDGMPRVLNLKQMME
YYIRHRNEIVLRRTQYDLTAAEKRAHILEGLKICLDNLDEVITTIRQSPDAPTAQSSLMEKFGLTEIQSK
AILEMRLQRLTGMERKKIDMEYQETLLLIDELRSILANPQKQMQIIREELLKVKDVYGDARRTEIVPQEG
DFSIEDMIAQEDVVITITHDGFIKRFPVSGYRRQARGGKGVAGAQAKHDDFVEHMFIASTHNYILFFTTR
GRCYWLKVYEIPEAGRTARGRSLANIMELQPAEKIRAYINIRNFDEPGFIVMATGNGTVKKTGLDEFSRP
RRNGIAAITIEENDELIDARLTDGDHQIILAKSSGYVVRFPESEIRSMGRTAMGVRGITLDADEKCISMV
TTKRFDTTLLAVTDNGFGKRSRVEDYRLTKRGARGVITLKAHEKTGAMVGLLDVNDEDDLIIITNNGIVN
RQHVSDIRLTGRNTSGVRLIRLMAGDIISALARVPKSDEEIDPDSLPENPDGQIDLF


>gns1 gi|73749403|DNA gyrase [Dehalococcoides sp. CBDB1]
MVTGNTRPINIEDEMKGSYLDYAMSVIVSRALPDVRDGLKPVQRRILYAMNDLGMKHNTPYKKSARIVGE
VLGKYHPHGDSSVYDAMVRMAQPFSYRYPLVDGQGNFGSVDNDPAAAMRYTEARLAQIAEHLLADIDKNT
VDFMPNFDSSLEEPTVLPARIPNLLMNGSSGIAVGMATNIPPHNLAELCQAICYLIDNPDCGVDELMQFV
SGPDFPTGGTILGTDGIKSAYATGKGKIVIQAKAHIGEVETRKAIFVTEIPYQVNKAELVAKIAELVKER
KVTGISDLRDESDRQGMRVVIELKRDAEPQQVLNSLYKHTNMRTSFFVNMLALVDGQPQVLSLKEVLKNF
IDFRHLIITRRSQFELKAAKDRAHILEGLKKALDFIDRIIAIIRGSENGDAARKNLIAEFDFSVVQAQAI
LDLQLRRLANLERQKILDEYAELMKRIGYLEDLLSHPEKIYALVKEDAKDLKSSYGQPRATEISNQGVIE
FRVEDLVPHMDVIVTLSERGFIKRVPANVFRLQHRGGTGIMGMPTREADAVRFLSVSDTHDTLLFFTNRG
KVFSLRCFDIPDDSSRIAKGTAIVNLIPVTQDERITAILDLKSFPADHFLLMATNKGEIKKTSLQEFTAV
RSSGLIAMDLTASDELVAAVETIEEKDILLATRLGQSIRFPVSELRTSLRASGGVKAIVLSMEDEVVSMD
VAQEGTMVITVTENGAGKLTAIEEYPQQHRAGSGVINFKVVDKTGEVVASKVVSVTDQMMLISADGMVTR
TQVKEEDPSHGIPIMGRATQGVRVMRLEEGDRVVAVATF

>gns2 gi|57233707|DNA gyrase [Dehalococcoides ethenogenes 195]
MVTGNTRPINIEEEMKGSYLDYAMSVIVSRALPDVRDGLKPVQRRILYAMNDLGMKHNTPYKKSARIVGE
VLGKYHPHGDSSVYDAMVRMAQPFSYRYPLVDGQGNFGSVDNDPPAAMRYTEARLAQIAEQLLTDIDKNT
VDFMPNFDASLEEPTVLPARIPNLLMNGSSGIAVGMATNIPPHNLAELCQAICYLIDNPDCGVDDLMQFV
SGPDFPTGGTILGTDGIKSAYATGKGKIVIQAKAHIGEVDNRKAIFVTEIPYQVNKAELVVKIAELVKDR
KIVGISDLRDESDRQGMRVVIELKRDAEPQQVLNSLYKHTNMRTSFFVNMLALVDGQPQVLSLKEVLKNF
IDFRHLIITRRSQFELKAAKDRAHILEGLKKALDFIDRIIAIIRNSENGDTARKNLVAEFDFSVIQAQAI
LDLQLRRLANLERQKILDEYAELMKRIGYLEDLLSHPEKIYALVKEDAKDLKGSYGQPRATEISSQGVIE
FRVEDLVPHMDVIVTLSERGFIKRVPANVFRLQHRGGTGIMGMPTREADAVRFLSVSDTHDTLLFFTNRG
KVFSLRCFDIPDDASRIAKGTAIVNLIPVTQDERITAILDLKSFPADHFLLMATNKGEIKKTSLQEFTAV
RSSGLIAMDLATSDELVAAVETTEEKDILLATRMGQSIRFPVSELRTSLRASGGVKAIVLSKGDEVVSMD
VAQEGTLVITVTENGAGKLTAIEEYPQQHRAGSGVINFKVVDKTGEVVASKVVSETDQMMLISADGMVTR
TQVKEEDPSHGIPIMGRATQGVRVMRLEEGDRVVAVATF



Groupe extérieur

>eury1 gi|21228522DNA gyrase[Methanosarcina mazei Go1]
MDTGPEEPEDEEPVRAGVTPILIDDEMKRSYINYAMSVIVGRALPDARDGLKPVHRRILFSMNESGITHD
KPYKKSARIVGDVLGKYHPHGDSAVYDTIVRMVQDFSLRYPLIDGQGNFGSIDGDSAAAMRYTEVRMDRI
AEEMLVDIEKETVPFIPNYDGSLKEPEVLPARLPNLLINGSTGIAVGMATNMPPHNISEVIDGILMLIEN
PETQISELMTVIKGPDFPTGAHILGTAGIRSAYMTGRGPIRMRAVAEIQELKKDRQQIIVTELPYQVNKA
KLIENIAQLVREKVINGISDLRDESDREGIRVVVELSRGVNPNVVLNQLYKHTQMATTFGVINLALVDGK
PKELNLKQLLEIYLEYRMEIIQKRTLYDLRKSEERAHILEGLRIALDNIDAVVALIKGSANADQAKQGLI
DNFALDEVQAKAILEMRLQRLTGLETRKILDELEALVKQIEELRKILASDELKYEIIRTELSELKDKYGD
IRRTRIVHNTENVTDEDLIPEEDVVVTITNSGYIKRIPLDTYTMQRRGGRGIIGMEMKEEDFVENLFISS
THNYILFFTNRGRLYWQKVYEIPEGSRQSRGKAIVNLLELQEGEMVNAMISVEEFAEDKYLFMATRAGTV
KKTPLSEFRNPRRAGIIAVSLDEGDELVKVLLTDGKQEIMMVSKKGKAIRFSEEDVRPMGRTARGVRGMT
LEGPDDEVVSLDLVDETTTLLTVTDNGFGKRTEYSQYPVHRRGGKGVITIVTNLRNGFVSNVKSVAEDDE
LMFTSAEGIIIRIPAKDISIQGRNTQGVRVMNIKSGDKVGGMARIKNGKEDEKLKLTALAKKAAKEKVPG
SESEEDESEDLDEFEGSDEFGEEPEKEEFEDSESEDSESEDSEEEEEEEEEEEEEKEEEY

>eury2 gi|116754691|DNA gyrase[Methanosaeta thermophila PT]
MAEIDVDVTEEMKSSYIDYAMSVIVGRALPDVRDGLKPVHRRILYAMYEQGVTFDQPYKKSARIVGDVMG
KYHPHGDVAIYDTMVRMAQDFSMRYTLIDGQGNFGSVDGDPPAAMRYTEVRLSKIAGEMLADIEKDTVDF
VPNYDGSLKEPTVLPSRLPNLLVNGSTGIAVGMATNIPPHNLREVVYALIHLIENPDASVTDLMNFIRGP
DFPTGGYIVGRSGIESAYSTGRGTITIRARSEIEEGRRGSRIIFTELPYQVNKAKVVEDIAELVKAGRVD
GISEIRDESDREGIRLVVELKQGVNPQVVLNQLHKHTQLETTYGIINLVLVDGQPRTLTLKETLEQYINY
RAEVIERRTRFELEQAEKRAHILAGILIALRDIDEVIALIRGSPSPSDARNLLMNRFGLSEEQARAILDM
RLQRLTGLEQEKVASEARELESTIARLKGILASRTEVLDIIKNELRELDEIYGDDRRTEILESVESVRPE
DLIQDEEVAVIITNNGYIKRQPLSVYRMQRRGGKGSIGAETKSEDFVTDIFTASTLDYLMIFTDRGKAHW
LRVYEIPMVSKVARGRPIASLLQLEENERITEAIPVESFGTDEYIVLATRNGSIVKTPLRAFSNPRRGGI
KAVNLRGDSLVAARLTDGSRELIVATKKGKAIRFHESDVRSSGRGSMGVKAINLSEGDELISMDVVKEGE
TLFTITTQGYGKRTELSEYPLQRRGGKGVKNIDTRRGDVVAAITVSDDDGLLITTKEGVMIRIAASDVRV
QGRATQGVKIMDVKPGDEISDVARVD

>eudi1 gi|75252690|sp|Q5YLB5|GYRA_NICBE DNA gyrase chloroplast/mitochondrial precursor
MKLHTLNPQTPLTQSKPMAFSTGITPSRFSGLRKTSSELRFLSSVTPPPRKQLRPVSARRKEEEVGDEGN
GSVILRDRGENEDRNGGERVVLTELHKEATEAYMSYAMSVLLGRALPDVRDGLKPVHRRILYAMHELGLS
SKKPYKKCARVVGEVLGKFHPHGDTAVYDSLVRMAQDFSLRSPLIRGHGNFGSIDADPPAAMRYTECRLE
ALTESMLLADLEQNTVDFVPNFDNSQKEPSLLPARVPNLLLNGASGIAVGMATNIPPHNLGELVDALSAL
IHNPEATLQELLEYMPGPDFPTGGIIMGNIGILEAFRTGRGRVVIRGKTDIELLDSKTKRAAIIIQEIPY
QTNKASLVEKIADLVENKILEGVSDIRDESDRSGMRIVIELKRGSDPAIVLNNLYRLTALQSSFSCNMVG
ILNGQPKLMGLKELLQAFLDFRCSVVERRARFKLSQAQERNHIVEGIIVGLDNLDEVINTIRKASSNALA
AASLRKEFELSEKQAEAILDISLRRLTALERNKFVEEGKSLRTQISKLEELLSSKKQILQLIEEEAIEIK
NKFFNPRRSMLEDTDSGDLEDIDVIPNEEMLLAISEKGYVKRMKPDTFNLQNRGTIGKSVGKLRVNDAMS
DFLVCRAHDKVLYFSDKGTVYSSPAYKIPECSRTAAGTPLVQILSLSDGERITSIIPVSEFAADQYLVML
TVNGYIKKVSLNYFASIRCTGIIAIQLVPDDELKWVKCCSNNDFVAMASQNGMVILTPCANIRALGRNTR
GSVAMRLKEGDKVASMDIIPDALQKELDKTLEVQQRQYRSMKGPWLLFVSESGYGKRVPVSRFRTSPLNR
VGLFGYKFSSEDCLAAVFVVGFSLGEDGESDEQVVLVSQSGTVNRIKVRDISIQSRYARGVILMRLEHAG
KIQSASLISAADADPEDEDATAVAA

>crypto gi|13812136|DNA gyrase A-subunit [Guillardia theta]
MIRVQSILFNCILKKGFIFNLGENKNFVDKFNRNVKFSKFLIFSSYSSENNGSIKVKYTNDKTRIINTEL
QNEMAKSYMEYALSVIYGRALPDIRDGLKPVHRRILFAMYELNLVPEAPYRKCARVVGEVLGKYHPHGDT
AVYDSLVRMSQEFSMRKVLILGHGNFGSIDHDPPAAMRYTECKLSNLSVDTLLKELDFKTVEYVYNFDGS
SIEPSIMPSVIPSILLNGSSGIAVGMATSIPPHNLGEIVRSCLALIDNYNITNQELIKYLPCPDFPTGGL
IIGNNSCKDLYEKGISSIILRGKINVEFSKSVKKVSKYNLIITEIPFQINKSMLIAKLADLVNSKIIQGI
SDIRDESDRKGIRIVIEIKRDYDPIKIVKIILKKSSLQITFSSYMLCIVDKQPILVNLKEILSLFLHFRR
KIIRKNIKFELKNILKKKNILKGISISLEKIDLTIEKIKKSINNLEAKCILMEFGLSQEQSEAILNLQLR
RLTKLESKKIDNDFEITKSSLNELKCILSSNILIDGIIKNQIKNISEIYGFPRKTLLINSINENIIEELE
TIENYESVIMITQYYIKKMFLESFESQTRGTKGKRGLIISDGDEISHFFSCNNRDDLIAISSGGIAYKIK
VSRIPISKRNSKGTPILSILKGLENNQISSIIATSNCETEKFLVLLTQKGLIKRTSISNFNNISSRGLII
LTLDENDSLKWVRKCYNDDSVIISTKKGKLLRFNASQKELKSTGRTSKGIKSIDLDSNDIISDFDIIPSQ
AITNFIILLTEMGYGKRIKVTELKIQKRGKKGIKVISLRENVNDYLISSRFCIENEEILISTSYGNVVKQ
KISDIAVQKKNSKGIIIQRLTEGDKVSKISIINSVIN





ORF finding

Recherche d'un ORF : anycodon , Direct .

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 851.
GGATTTCTAGAAGAAATTGCATCAGAAACGGTAAACTTCTCAAATAACTTTGACGGTTCA
CAAAAAGAACCAGATGTTCTTCCAGCTCAACTTCCGTTTTTATTTTTGAACGGATCATCA
GGAATTGCCGTTGGAATGGCAACTAATATCCCCCCTCACAACCTTGGAGAAATAGTAGAT
GCTTTAATTGCTTTAGTAGAAAATAAAGATATAAATAATAAAAAACTCTCTAAAATAATT
AAAGGACCTGATTTCCCTACTGGAGGAGAATTAATTAATAATCAAGCAATAGAGGAACTT
TACGAAACTGGAAAAGGATCAGTAATAATAAGAGGGGTAATAAATAAAGAAGAAATAAAT
TTAGGCAAAGGTAAACACAAAAGAAATGCATTAATCATTACGGAACTTCCTTATCAAATT
AGTAAAGCAGGTTGGATTGAAAAACTAGCTGAACTTGTTAATTCAAACAAAATCAATGGT
ATCGCTGATATTCGGGATGAAAGCGATAGAGATGGCATGAGAATTGTAATAGAGTTAAAA
AAAGATTCTAATACTGAACTTGTAATTTCCAATTTATATAAAAAAACAACTCTCCAAACC
AACTTTGGTGCAATATTTTTAACTTTAGTACAAGGGAAACCTGTTCAACTAAACTTAAAG
CAATATCTTAACTATTTTCTTGAATTCCGAGAAGAAACTATTAGAAAAAGAACTGGTTAT
TTTCTAAAAAATACACTTGAAAAACTAGAAATATTAGAAGGTTTGTCTAAAGCAACAAAA
GACATAAAAAGAATTATTGAGATTATTGAAGAATCAGAAAATTCTGGAGAAGCAAAATCA
AAACTAATT

>Translation of ORF number 1 in reading frame 3 on the direct strand.
GFLEEIASETVNFSNNFDGSQKEPDVLPAQLPFLFLNGSSGIAVGMATNIPPHNLGEIVD
ALIALVENKDINNKKLSKIIKGPDFPTGGELINNQAIEELYETGKGSVIIRGVINKEEIN
LGKGKHKRNALIITELPYQISKAGWIEKLAELVNSNKINGIADIRDESDRDGMRIVIELK
KDSNTELVISNLYKKTTLQTNFGAIFLTLVQGKPVQLNLKQYLNYFLEFREETIRKRTGY
FLKNTLEKLEILEGLSKATKDIKRIIEIIEESENSGEAKSKLI

Recherche d'un ORF : anycodon , Reverse .

>ORF number 1 in reading frame 1 on the reverse strand extends from base 208 to base 438.
ACAGGTTTCCCTTGTACTAAAGTTAAAAATATTGCACCAAAGTTGGTTTGGAGAGTTGTT
TTTTTATATAAATTGGAAATTACAAGTTCAGTATTAGAATCTTTTTTTAACTCTATTACA
ATTCTCATGCCATCTCTATCGCTTTCATCCCGAATATCAGCGATACCATTGATTTTGTTT
GAATTAACAAGTTCAGCTAGTTTTTCAATCCAACCTGCTTTACTAATTTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
TGFPCTKVKNIAPKLVWRVVFLYKLEITSSVLESFFNSITILMPSLSLSSRISAIPLILF
ELTSSASFSIQPALLI*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.