ORF LP17780

From Metagenes

Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160098.1
Annotathon code: ORF_LP17780
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : MMMS
Annotated on : 2008-03-19 18:52:37
  • MARILLY Sophie
  • MEGY marion

Contents

Synopsis

Genomic Sequence

>AACY01160098.1 ORF_LP17780 genomic DNA
GTTTCTGACAACTGATATCGAATTATTTATGTATGTAGTATCTGTATAAACATTGGTTAAATAAAGGCCTTCCTCTTTTAAAATAGAATTGTTGAGTTTT
TCCATTGTGATTAATAGTTCTTTTTGAACTTCAATAGTATTTGCACCCGACTCTTTAATTATATTAAGTGCTATTGCATCTTCACCAAGATGTCTCACTA
TATAATTAGAATCCTCATACTCTAAGGCAATTTTGCTTATTTGACCAAGTCTTATAAAATTATTTCCCTGTTTTTTTATTACTAAATCTTCCAGTTCTTT
CAAAGAAGTCGTTTCACCTGTTGTTCTTGCTAAATATTTTCTCTTACCTTCTTCAATAAAACCGGAACTAATATCAACATTACTATTTTGAAGAGTATTC
GCGATTTCAATTAGGCTTAATCCTGCGAGAGCAATCCGGTTTGTATCAATTACGATATGAATTTCTTTAGATCTTCCACCTCTTACACCTGATTCACCAA
CACCTTTTATTCTCTCAAACTGGGTTTTAATATTCTCCTCTACAAAGTTCTTATATTTGAAAATATCTTTTTTTTGATTTTTTGATTTTAATATGAACCA
TGCAATCGGGGATCTCTCTGATGAAACAGATTTAATCGTGGGTCGGTCAGCATCAACAGGTATATCTTTCACTTGATCTAATAGATTGGAAACTTGTATG
ATCGATGTTGAGACATTTTGCTTTGGATTAAGTTCTAATGTGATGGTTCCTTTACCTTCAATTGAGACACTCTCCATCGATTCTAAGCCCTCTAATGATT
TTAATTTATCTTCTTGTCTTATGATTATTTCTCTTTCGATTTCCTCAGGACTTGCACCTG

Translation

[3 - 860/860]   indirect strand
>ORF_LP17780 Translation [3-860   indirect strand]
GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIF
KYKNFVEENIKTQFERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLARTTGETTSLKELEDLVIKKQGNN
FIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVRN
[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

    +-----------------------------------------Spombe  (fungi)  
  !  
  !  +--------------------------------------Bmarina   (plancto)
 14  !  
  !  !  +-----------------------------------Rdenitri  (a-proteo)
  !  !  !  
  +-12  !                       +-----------orf       
     !  !                       !  
     !  !              +-------11  +--------Leptospira (spiro)
     !  !              !        !  !  
     !  !              !        +-13     +--Bgarinii  (spiro)
     +-10              !           !  +--9  
        !  +-----------7           +--8  +--Bafzelii  (spiro)
        !  !           !              !  
        !  !           !              +-----Bburgdorf (spiro)
        !  !           !  
        !  !           !              +-----Csalexi   (g-proteo)
        !  !           +--------------6  
        +--4                          !  +--Sputrefac (g-proteo)
           !                          +--5  
           !                             +--Sbaltica  (g-proteo)
           !  
           !                       +--------Dacetoxi  (d-proteo)
           !                       !  
           +-----------------------3     +--Wsuccinog (e-proteo)
                                   !  +--2  
                                   +--1  +--Cstuttgar (plancto)
                                      !  
                                      +-----Ddesulfur (d-proteo)

Annotator commentaries

On a d'abord soumis notre séquence initiale à orfinder,ce qui nous a permis de trouver tous les cadres de lecture dans les deux sens du brin,sans imposer la méthionine comme codon start.On a choisi l'orf la plus longue c'est à dire la première du cadre 3 dans le sens inverse sachant que le 5' et le 3' sont incomplets.On a ensuite soumis la traduction de cette orf à un blastp contre swissprot.Celui-ci n'était pas assez précis nos scores n'était pas très élevés.On a donc fait un blastp contre nr qui nous a donné de meilleurs scores et une fonction récurrente:acriflavin resistance protein.Pour confirmer et préciser notre étude,on a établit une phylogénie.Nous avions beaucoup de proteobacteries mais également des planctomycètes et spirochaetes avec des scores élevés.Nous ne pouvions donc pas les négliger.Nous avons donc choisi comme groupe d'etude les bacteries et avons poussé notre blast jusqu'à 5000 alignements pour obtenir un groupe externe n'appartenant pas aux bacteries.Il s'agit d'un fungi.Après avoir fait l'alignement multiple,nous avons obtenu un arbre avec la methode neighbor joining. L'arbre que nous avons obtenu nous indique que le plus proche orthologue de notre orf est leptospira, un spirochaete.Pour situer mieux notre orf, nous avons rajouté des spirochaetes dans notre arbre.La méthode de neighbor joining ne nous donnait pas un arbre convenable. Nous avons utilisé la méthode de parcimonie qui nous confirme que notre orf est proche des spirochaetes.L'orthologue le plus proche est toujours Leptospira. On peut en déduire que la fonction de notre orf est similaire à celle de cet orthologue. Notre gène est AcrB.Il code pour une proteine conférant la résistance à l'acriflavine.Son fonctionnement repose certainement sur la présence de pompes et canaux qui rejette cet antobiotique hors de la bactérie.

Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Ddesulfur       MPSACNLRILARSKTATCACAALRRSTTVSLYFTLPFMYECHVFHSCTPTLTSGRTMDFL
Cstuttgar       --------------------------------------------------------MDSI
Wsuccinog       ----------------------------------------------------------MI
Dacetoxi        --------------------------------------------------------MSVL
Sbaltica        ----------------------------------------------------------ML
Sputrefac       ----------------------------------------------------------ML
Csalexi         ----------------------------------------------------------MF
Bburgdorf       ---------------------------------------------------------MLV
Bafzelii        ---------------------------------------------------------MLV
Bgarinii        ---------------------------------------------------------MLV
Rdenitri        --------------------------------------------------------MDLI
orf             ------------------------------------------------------------
Bmarina         --------------------------------------------------------MNFI
Leptospira      -------------------------------------------------------MKSVV
Spombe          -----------------------------------------MSTLGNSTVKPTNAEFPGL
                                                                            

Ddesulfur       QFSIRKPVSILVGVILIALFGTLGLLGMPYQLSPTVTEPEITVRTTWTGATPYEVERDVL
Cstuttgar       RFSIEKPVTIIVGIIFVVLFGVISLLTMTYQLSPTITEPEITVTTTWVGATPYNIEREII
Wsuccinog       KYVIAKPVVVIVGIILVALFGVLSLSQMPYQLTPSVTRPIITINTLWTGATPYEMEREII
Dacetoxi        HYSIKKPVSVAVFVIMILMFGIIGLNKLPVQLTPDVELPEITVTTTWPGATPYDIEQEII
Sbaltica        KFGIKHGTLLSVIVLIFCVLGTAAALRIPIQMIPDLDVRTISVATGWPGATPQDVEKEIL
Sputrefac       KFGIKHGTLLTVMVLIFCVLGTAAALRIPVQMIPDLDVRTISVTTGWPGATPQDVEKEIL
Csalexi         ATIIRHGILVSVVTLILLIVGIAAIWRIPVQMIPDLETRVIGIETEWAGANPQDIEKDIL
Bburgdorf       KRIVGKPITMLILFSLLLMISLYTFSRLKVDLLPGIDIPQISIHTVYPGASPREVEESVS
Bafzelii        KRIVGKPITMLILFSLLMMISLYTFSRLKVDLLPGIDIPQISINTVYPGASPKEVEESVS
Bgarinii        KRIVGKPITMLILFSLVMMISLYTFSRLKIDLLPGIDIPQISIHTAYPGASPREVEESVS
Rdenitri        RYAIDRPIAVMAAVIMAVLFGTIAVSRIPIQLAPDVRKPIVVIETQWPGAAPSEIEREIV
orf             ------------------------------------------------GASPEEIEREII
Bmarina         QMSVKQPITVAVGVILSVLAGVIAFSRVPIQMTPEVQSVVISVSTYWENASAQEIESDVI
Leptospira      RFCVSKPITVLMAWFAIIIFGIIGLKNAKITLLPEIVFPKISVITGYPNASPEEIENLIT
Spombe          HAMERYKPATSESLYVKGHYGPHPHKEHPAAYVAAKTGFNATSRRQSVREHHSSHEGSAQ
                                                                     . *    

Ddesulfur       EEQEKALKGLTGLLVMESTASNGRGEITLRFAVGTNLDDAVLRVSNKLDEVP-SYPDNVD
Cstuttgar       EEQEKVLKGIPGLVEMESESFDGMGSITLKFTIETRIDDALLRVSNKLNEVP-EYPENVD
Wsuccinog       ERQEKVLKGIDNLISMESRSRNGRADITLEFKIGTSLTEAMLKVSNKLDEVK-KYPDGID
Dacetoxi        EDQEDALKGLQNLISLESSSYNNYGTISLVFKVGVDIDNALLRVANKLDEVG-DYPENVD
Sbaltica        LEQERYLRTLPNLQRMTSWADTGSAWIELEFPQSTEISDALIRVSNALSQVS-SYPENVD
Sputrefac       LEQERHLRNLPNLQRMTSWADTGSAWIELEFPQSTEISDALIRVSNALSQVS-AYPENVD
Csalexi         IEQEEYLRNVPNLQRMESTASSGSAEIELEFPFGVDLTETLIRVNNALSQVP-SYPTNVD
Bburgdorf       RVLESGLSSVKNLKNIYSVSSKESSTVSLEFYHGTDLDLVLNEIRDALELVKSSLPSKSQ
Bafzelii        RVLESGLSSLKNLKNIYSISSKENSTVSLEFYHGTDLDLVLNEIRDALELVKSSLPSRAQ
Bgarinii        RVLESGLSSVKNLKNIYSTSSKESSTVSLEFYHGTDWDLVLNEIRDALELVKSLLPSKSQ
Rdenitri        NPQEEALRGLEGLDIMTSRSRTGEAEITLEFGVGTDMVQSLLLVSNRLDRVG-DYPDEAS
orf             IRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLLDQVK-DIPVDAD
Bmarina         QEQEQRLGDLAGLVAMTSMSQPGSGQIRLEFQTGTNIDEAMSEVDQKLSEVP-GYPIGVD
Leptospira      KPLTDSIGTVGGIEKVTSESLEGISIITVQFSFHKSVDFAMIELREKIDLIRDQLPQDAS
Spombe          LNPDRILYMSAGAVTAAVPNKEHTDNVTTSQTIRYETSSQPSQEVYHPHAGKAAQSAHVM
                      :    .              :                            .    

Ddesulfur       RPVISATGASSSPIVWMVLKALPDNPR--SVETYRTFFEDEVRQDLERVKGVAELMVYGG
Cstuttgar       KPIINPTGSAASPVIWIILHATEDNPR--SIYSYRTYFEDEVRQYLDRVKGVADLAIHGG
Wsuccinog       KPIITATGESTSPVVWMVLKTQKENPR--HINEYRTFFNESVIQYFERIDGVAEVFFPSG
Dacetoxi        KPIIEAAGANSSPVIWLLLKTKQGNET--PIDQYRTFYDNEVEQHLERIDGVGSLFVGGG
Sbaltica        QPRLYSSSYSDNAFMYFRLVPVAGNPLNLDIDMMRDFANDFIRPQMERVKGVSSVTIQGG
Sputrefac       QPRLYSSSYSDNAFMYFRLMPIAGNPLGLDIDMMRDFANDHIRPQMERVKGVSSVTIQGG
Csalexi         QPRIVANSFSANAFMYFNVGPREGNPRQLDMPAMRDYLEDNVRPRMESVSGVSEVSVSGG
Bburgdorf       TPRIFRYNLKNIPVMEIVINSVRPVSE------LKRYADEIIKPGLERLDGVAIVTVNGG
Bafzelii        TPRIFRYNLKNIPVMEIVINSVRPVSE------LKRYADEIIKPGLERLDGVAIVTVNGG
Bgarinii        APRIFRYNLKNIPVMEITINSVRPVSE------LKRYADEVIKPGLERLDGVAIVTVNGG
Rdenitri        EPTLDTSGADDSPIAWILLTAQEGNTR--EMATYGDFVEDVIQDRIERIEGVSAVNVFGG
orf             RPTIKSVSSERSPIAWFILKSKNQKKD---IFKYKNFVEENIKTQFERIKGVGESGVRGG
Bmarina         QPQIEDFDPES--VDYISWIGLASTDPNFDATTLYDFMERRLRPRFERINGVSQVGIRGA
Leptospira      KPIATRFDPAQSAFQEIIIFPKNESDS----KSLKSFIEENVKVFLERIEGMAYVQISGG
Spombe          NSTESRPSSAHVSSSYTQKPFAFPLGPVFATSSQAAASETALPSGYEPDEARFIGASQLA
                 .     .                              :  :    :  ..        .

Ddesulfur       TEREMQVMIDPSRLAAHGLTINDLRRVLEAENVNISAGNLDVGRRAYRIRTVGNFSSPDD
Cstuttgar       TDKEMHIIINPQKMAAYGVTITELVSLLKAENVNISSGIMGIERRDYRIRTIGEFNSAKE
Wsuccinog       TDREMHVVIDHNKLASYQLTLQDLISVLDLENANVSAGTMDYGRRSYRVRSVAEYKSPEQ
Dacetoxi        TEKELQVVVDREKMARHNITISQVTHSLQQANENTSAGNLSIGKKDYRIRTVSRFQNETD
Sbaltica        AERQIQILLDPAKLAQRGISIMDVRQAIRDRNKDTSAGDIDSGKKRYLLRVIGRFEDLNQ
Sputrefac       AERQIQILLDPAKLAQRGISIMDVRQAIRERNKDTSAGDIDSGKKRYLLRVIGRFEDLDQ
Csalexi         AERQMQLLLDPDALAARDLSISDIQAALEARNQDVSGGNLESGKRRYLLRTVGRFDDVKS
Bburgdorf       SKKRVLIEVSQNRLESYGLSLSRISSIIASQNLELSAGNILENNLEYLVEVSGKFKSIEE
Bafzelii        SKKRVLIEVSQNRLESYGLSLSKVSSIIASQNLELSAGNILENNLEYLVQVSGKFKSIEE
Bgarinii        SKKRVLIEVSQNRLESYGLSLSRISSIIASQNLELSAGNIIENNLEYLVQVSGKFKSIEE
Rdenitri        VTRELQVVVDPRRLSRFDLTVPEVVRVLRDENISLSAGDVEEGKRRYVVRAEGNLNTVEA
orf             RSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLARTTGETTSLKE
Bmarina         REREVQVRVNPTALAQRGITYAELVAALQMNNGNYSGGKLADGKSDIRVRMVGRFREADW
Leptospira      FEKEVRVEIDPERMTTYGVSIPEIQKSIVSANINVPAGSLPVGNKDLLLRTVGEYKSLED
Spombe          KLSASHAHQTPAQTVDDDVPLPTRMAATELVGHIPLRAANYANEYSQDVPASTHRAASEL
                                  :.           .     .     .         .      

Ddesulfur       IEQVVIQSTGQN----------RIRVGDVARVSFGYAKRTVSIQHNG-------------
Cstuttgar       IENIIIKSDGQQ----------RIVLSDLAKVSFGYEKLSNVMLHNG-------------
Wsuccinog       IEQTVVWSDGQR----------RVRIADLGYVKEGYARPTAYVEHNF-------------
Dacetoxi        PLDVVLVDDGIK----------RVYLRDVATTQEGFEKRTFAVQNNG-------------
Sbaltica        LKQLILKRQGNT----------NILLQDVAEIKLDHAEIRELSFAEQ-------------
Sputrefac       LKQLVLKRQGNT----------NILLQDVAEIKLDHAEIRELSFAEQ-------------
Csalexi         LEALILRRQGDE----------LVRLGDVAEVQQSYAELTSRSYNAAG------------
Bburgdorf       IGNVVIAYKIPDISSGINLSPIEIKLKDIANIKTDFEDLSEYVEYNG-------------
Bafzelii        IGNVVIAYKMPDNSSGINLSPIEIKLKDIANIKTDFEDLSEYVEYNG-------------
Bgarinii        IGNVVIAYKIPAISSGINSSAIEIKLKDIANIKTDFEDLSEYVEYNG-------------
Rdenitri        IKSVVLRSDIGTGGSG------RVRVADVADVSFSFEEANSRLRFRG-------------
orf             LEDLVIKKQGNN----------FIRLGQISKIALEYEDSNYIVRHLG-------------
Bmarina         VEGLVIRREASG----------PIYLRDVAEVVETHKEMTEWVRARG-------------
Leptospira      IKETIIATNNTG---------IPIPIGSVASVYRSYRERTGLARYNG-------------
Spombe          VHGVPMRASGINDPKHDLDAATRHNINSVAAASYVAARSRVIEEEEEPPNEVKERMDYEA
                     :                   : .:.                              

Ddesulfur       ---DAGIVCGIKAEPGANVLDVTNDTEAVVNALNDGI----------LKENGLFFEWSSD
Cstuttgar       ---EEAIAIGVKPESGVNVLELTNTIYEVVDWLNKEK----------LAEEKVYLKWVYD
Wsuccinog       ---ESGAVVGIKPTPGTNILELSDEVERVFFRLNEGV----------LAKEGLYLDWMYD
Dacetoxi        ---KPCIVVGIRKEKGANVIDLVQRAHETIDELNAGL----------LADNGLTFDWVYD
Sbaltica        ---ERTLSLAVKRDVGSNVIAIKAAMMPVVAQINQNQ----------LAQHAMQLELFSD
Sputrefac       ---ERTLTLAVKRDVGSNVIAIKAAMMPVITQINQNQ----------LAQHAMQLELFSD
Csalexi         ---EPVLSVQVRREPGANVIDIKREMLEEVEALNDGL----------LAEQGMQITLSND
Bburgdorf       ---LPSISLSVQKRSDSNSIAVSNVVMNEIEKLKLS------------MPKDMKLEIASD
Bafzelii        ---LPSISLSVQKRSDANSITVSNVVTGEIEKLKLS------------MPKDMRLEIASD
Bgarinii        ---LPSISLSVQKRSDANSIAVSNVVVREIEKLKLS------------MPKDMKLEIASD
Rdenitri        ---EPGLAFNIVREPGANVIETMAEVKEVLAELSAGP----------VAEVGLNMRQAYD
orf             ---EDAIALNIIKESGANTIEVQKELLITMEKLNNSI----------LKEEGLYLTNVYT
Bmarina         ---QRMPFFNFMLESGGNLLETMDSINAEVARLNEPGGVLEQEAKALGVNGTFELVQTYD
Leptospira      ---KDCIVLYLYKESGRNSVELADKVTKELESINTTF------------ADKLSAQLVYD
Spombe          DAQRRIRKMNVFGSAGAALRERTQQDLMANEQEHSGEFAGFSRNLTNTAAAPTTYEYKRP
                          .    .                                            

Ddesulfur       QRPYINGAIDLVKQNIIIGGVLAVCVLLVFLQSVSSTVIVAVAIPISVVGTFIFMNLFGR
Cstuttgar       QRPYINGAIRLVKNNILIGGFLAIAVLLLFLRNVSSTVIIATSIPISIFGTFLFLKAFGR
Wsuccinog       QRSYINGAISLVRQNILIGAFLAVVVLWLFLRSFTSTVVIALSMPISILGTFIVMNALGR
Dacetoxi        QTPYINTAISIVKQNALIGGLLAIVVLLVFLRSVSGTAITAIAIPVSVIGTFISLWVFHR
Sbaltica        DVRYVQDSVENVWVNLGLGALLATLVMYLFLRSSRATLIGVIGIPLCTLAAFVGLLVFNR
Sputrefac       DVRYVQDSVKNVWFNLSLGALLATLVMYLFLRSHRATMIGVLGIPICTLAAFVGLLIFGR
Csalexi         DVRYVEASIANVWFNLGLGALFATLVMYAFLRSARATFAGVIGIPICTIAAFLGLLLAGR
Bburgdorf       STDFIKASISTVVNSAYFGAMLAIFVIFFFLRSFRATIIIGISIPIAIVLTFCLMYFVNI
Bafzelii        STNFIKASISTVVSSAYFGAMLAIFVIFFFLRSFRATIIIGISIPIAIVLTFCLMYFVNI
Bgarinii        STNFIKASISTVVNSAYFGAILAIFVIFFFLRSFRATIIIGISIPIAIILTFCLMYFLNI
Rdenitri        ETVYINGAIDLVTQNIWIGGALAAAVLMAFLRSPRATLVVSLAIPVSIVSTFVAMAATGR
orf             DTTYINNSISVVRN----------------------------------------------
Bmarina         ATTYVVDAIDLVQSNILVGGLLAVMTLLLFLRSVRTIGIIGIAIPISTVVAVVVMVMLGR
Leptospira      ESVFIRDSVWGLVWSLILGAFLAFLILMLLIQSFRAPLILLIIIPASLLATFLLFYIFHI
Spombe          TSSYTAKDATSKVYRSNTYKPKSSVNGSVYRSKSVKSTTSHNKVPERNSVPAYNEKLMHS
                   :                                                        

Ddesulfur       NLN---VVSLAGISFAVGMLVDNAIVVLENIDRHRSMGKSPYKAAYEGTREVWGAVLAST
Cstuttgar       NLN---VISLAGISFAVGMLVDNAIVVLENIDRHRKSGKTAFLAAYEGTKEVWGAILAST
Wsuccinog       TLN---VVSMAGISFAVGMLVDSAIVVLENIDRHKRLGKGIFAASYEGTKEVVGALVASV
Dacetoxi        NLN---VVSLAGISFAIGMLVDSAIVVLENIDRHRQMGKKAFDAALDGASEVFGAVLAST
Sbaltica        TIN---VISLAGVAFAIGMTVDNSIVVLESIEQARRRGLDRLEAAINGIYDVWPAVLAST
Sputrefac       TIN---VISLAGVAFAIGMTVDNSIVVLESIEQARRRGRDRIEAAISGIYDVWPAVLAST
Csalexi         TLN---VISLAGIAFAIGMTIDNTIVVLESIETQRRRGLARFQAALAGVKQVWSAVLAST
Bburgdorf       SLN---IMSLAGLALGIGMVVDCSIVVIDNIYKYRQKGAKLISSSILGAQEMMLPITSST
Bafzelii        SLN---IMSLAGLALGIGMVVDCSIVVIDNIYKYRQKGAKLISSSILGAQEMMMPITSST
Bgarinii        SIN---IMSLAGLALGIGMVVDCSIVVIDNIYKYRQKGAKLISSSILGAQEMMLPITSST
Rdenitri        TLN---VISLAGIAFAVGMIVDAAIVVLENIYRLREEGKSRREAAYLGAKQVWGAILVSA
orf             ------------------------------------------------------------
Bmarina         TMN---IISLAGMAFAVGMVVDNAIVVIENIFRHLEMGKSSKQAAIDGTQEVASAVLAST
Leptospira      SLN---MMSLGGLALGIGMLFDTSNVVFSSIERNLTKRKSILESSIEGTSEVAGSILSAT
Spombe          SAANAAILSHKNYSPPVQPTRDDEVSQEDARVKEIVRGMKLPLTSSSLSAAAYRPMEKQD
                                                                            

Ddesulfur       LTTVAVFLPVVFIEQEA---GQLFKDIAIAVTCAIILSLFVSISVIPMLANLFFSFAR--
Cstuttgar       LTTIAVFLPIVFVQEEA---GQLFRDIAIAVTCAVGLSFFVSVFVIPMFSEQLFRRLK--
Wsuccinog       LTTVAIFIPIINMEEEA---GQLFRDIALTASSAVLFSMVVSILIIPMFSYQLLKLFG--
Dacetoxi        ATTVAVFLPVIFIEQEA---GQLFRDIAIAITFAILLSMIVSLVVIPCLANLVYGRRP--
Sbaltica        LTTVLVFVPILFIKQEA---GQLYSDIAIAIASSIVASMLVAVFIVPAAIARFGFG----
Sputrefac       LTTVLVFVPILFIKQEA---GQLYSDIAIAIASSIIASMLVAMLIVPAAIARFGFG----
Csalexi         LTTILVFVPIFFIEQEA---GQLYSDIAVAIATSILISMVVAITVIPTLGAHIDFRGR--
Bburgdorf       FTSICVFGPFLIFKSELGVYGDFFKDFTFTIVISLGVSLLVAIFLVPVLSSHYVGLYTS-
Bafzelii        FTSICVFGPFLIFKSELGVYGDFFKDFSFTIVISLGVSLLVAIFLVPVLSSHYVGLYTS-
Bgarinii        FTSICVFGPFLIFKSELGVYGDFFKDFSFTIVISLGVSLLVAIFLVPVLSSHYVGLYTS-
Rdenitri        LTTVLVFVPILIMQLEA---GQLFRDIAVAISVSVLLSLVVAVTVIPALSSKLLSKGD--
orf             ------------------------------------------------------------
Bmarina         LTTLVVFFPILLIEEQAG---QLFRDIALSIMAAVGVSYIVSTTVIPAAAGQWLSIKIKP
Leptospira      LTTIIVFLPIIFIKSFIG---ILFSEMAIAIILSISISLFASVTIIPTLYVLFENTNFDS
Spombe          PATVERHHIQAEATQRVRDMKLDLTKLESKTNDEIRSYRPRNVVIKPYAAATPPKNIPST
                                                                            

Ddesulfur       ------------KKGP-RKGIAAVNAAGRGFSAVMMGIVRLALSNALTKSVTILLLTTLS
Cstuttgar       ------------VKTKSFAGPGVLLKAGAFFQKIIMALVAFAIKEGKTRIATILILTAFS
Wsuccinog       ------------VEKP--HPKSTLEGVGARIIDTVVAWVKGCTASVGSRLATIFFFTFLS
Dacetoxi        ------------VIKQ---KTDRIGRFGQRFVDGIMRFSDLSLKSVATRIMTVTLLTLTA
Sbaltica        ------------KMRSACTNQSEPPKA-----SRILSLVSQLVLSAKRRTAVIVLSLVST
Sputrefac       ------------KINQKSNLDNNNQSS-----SRILALVNQTILSPKRRYTVIVLSLIAT
Csalexi         ------------GGDNRNGNTTRPRWM-----SACLWVVNGMIQSAGRRLAAIVLGVLGG
Bburgdorf       ---------FQKNIKNAFIRKIDAFFASIYYFLEFLYINLLNIVLNHKLIFGLIVFFSFI
Bafzelii        ---------FQKNIKSTFIRKIDAFFASIYYFLEFLYINLLNIVLNHKLIFGLIVFFSFI
Bgarinii        ---------FQKNIKNAFIRKIDTFFARIYYFLEFLYINLLNIVLNHKLIFGLIVFFSFI
Rdenitri        ---------------QKKVNIWGLDHLARGFHGMVMSYVRLTVRFRALGLFMVALIAGGA
orf             ------------------------------------------------------------
Bmarina         KTEEPLAEKTPVKRKGWLGRGFALVQAATNLPAIVGGLVYRLTGTWMSRLAVIGVFAAVT
Leptospira      ---------------KLIDHPIFAKSADLYQTALITYEKKLIEYLERPKKLFSILLTGIF
Spombe          YR---------APQAPSVLSPVVTASEGDFELDGITPERQQTMTRSTYQESSQRPFHEDP
                                                                            

Ddesulfur       VGSAVLFFPKMEYLPQGNRNLVLSILIPPPGLSMEERQDIGQYIYAQAQPHVQQDTGG--
Cstuttgar       FIATILLLPKMEYLPQGNRNLVMSILVPPPGLSYKERMDIGRHIANQLGPYMQKDHNG--
Wsuccinog       LAISYALFPKMEYLPEGNQNFVTTVLNPPPGLSYEERQNIGKEVFRLNESYFVQKGYEKN
Dacetoxi        ALLVWILLPKSEYLPQGNRNLIMNILIPPPGLSVEKRESIGQYVYKQVEPYVKEDWKDG-
Sbaltica        IGLAAWLMPPAEYLPEGEEPKAFTSMVAPPGYNLSEMAKIAEELTTQLSARVNAEAASFE
Sputrefac       LGLAMRLMPPAEYLPEGEEPKAFTSMVAPPGYNLSEMANIAKELTLTLSSRVDAHPLSFD
Csalexi         VAIFVWLTPPAEYLPEGEEAKTFASMNAPASYNLATMDEIARTLQRELEPHVGAEPTAFE
Bburgdorf       GSLLLGLLLDVTTFTRGKENSITINLNFPHKTNLEYAKFYSNRFLEIVKSEAKGYKSIIA
Bafzelii        GSLFLGLLLDVTTFDRGKENSIVINLNFPHKTSLEYAKFYSNRFLEIVKSEAKGYKSIIS
Bgarinii        GSLFLGLLLDVTTFARGKENSIVINLNFPNKTNLEYAKFYSNKFLEIVKSEAKGYKSIIS
Rdenitri        AVATITFLPRLEYLPEGNRNLVFGLIIPPPGYNLDTTQTIAERIETVAQPLWEAAPETQT
orf             ------------------------------------------------------------
Bmarina         AVGTWMLIPPLDYLPLGNRNIVFGMLIPPPGYNVDQLSELGDRLESVIKPAWEAAGDKFG
Leptospira      FSSIFLFILPREFMPTVDNGEFTINIENVPNSTLNSTTGIAEVIEKILLSNKDIKSVISK
Spombe          FRTHPGLLQAVARNHRNSLANIDERIMRQNQAATANTNTVSETDIEALERRLSKAYRMEA
                                                                            

Ddesulfur       -----------------------------IPAIDNLFYVGAPDFMMFGATSMYEQRAGEL
Cstuttgar       -----------------------------FPGISDVFYIGADTRMVFGAKCMHEERAGEL
Wsuccinog       E-KGE------------------------MPPIRHMFFLGSENFMYFGTRGAIEDRAGEM
Dacetoxi        -----------------------------IPQIKTTFFVATPDLNIMGSLSTHETEARGM
Sbaltica        SGEQK------------------------IPPLKYYTLSVGVGSIWVMSEPVRSQDMDAM
Sputrefac       RGEQK------------------------IPPLKYYTLSVGVGSIWVMSEPTRHQDMDAM
Csalexi         RGDTD------------------------VPPIRTMGIQAEPQSVRIIAETIDPNHIEAL
Bburgdorf       TLRAD------------------------RITFNVLFPLKEESRDNLTQSVDYDSIKYKI
Bafzelii        TLDAD------------------------RITFNVLFPLKEESKDELIKSIDYDAIKYKI
Bgarinii        TLNAD------------------------RITFNILFPLKEESRGKLIQSIDYDAIKYKI
Rdenitri        EDG--------------------------TPTIDNFFFVARPGASFVGASAVDGTQAGAL
orf             ------------------------------------------------------------
Bmarina         AEAAERGGEWSGEDQRTAYPMYGSDEKIMPPPLDHYFLVAWDGRVFQVGISQDKKRVVDA
Leptospira      IGSDN--------------------DDFIAKVNGNSGTNIAKIRVILVSNPKHTTTEIIE
Spombe          QEEAYAIN------------IGGGRVISPEELEEIARRNVDPMVSELSERAAQERERKEQ
                                                                            

Ddesulfur       VPLFSRIMNSIPGMFGVSLQAGIFQTSLGKGRTIEVDLRAADLDQLVAGAGALFGTLMAE
Cstuttgar       VPLFMQTIQSIPGMYGVSMQAGIFETGIGEGRTIEVDISGSDIHQIVQVSGTMFGMIKKE
Wsuccinog       IPQFLKTIESLPGMTGVSMQPGIFERGMGKGRTIDVDISGVEIESLIQTASAMQRLIKQR
Dacetoxi        MPLMTRVMNSIPDMIGVSLQAGIFESNIGEGRAVEVNITGTELPTLVNAGRTLYGAISQA
Sbaltica        MSSLTALFEQYPGMRAYSSRGSIISSNDGGTRAVALDISGPNQASLYRAAEAAYQAAEKV
Sputrefac       MRSLTALFEHYPGMRAYSSRGSIISSNDGGTRAVALDISGPNQASLYRTAEAAYQAAERV
Csalexi         MDALTERYEAYPDMRAFAARGSIISSNDGGTRSITLDIAGNDLETLYATANRIYQRAEAA
Bburgdorf       MNRIGNLYP------EFNIEPSISGNALGGGDSIKIKISANDFEYIKDYGKILVSMLKKE
Bafzelii        MDRIGNLYP------EFNIEPSSG-NALGGGDSIKIKISGNDFEYMKDYGKILVSMLKKE
Bgarinii        MNRIGNLYP------EFNIEPSSG-NALGGGDAIKIKISGNDFEYIKDYGKILVSMFKKE
Rdenitri        IPVLSQPIFAEPGTFGFMTQPSLFGRGVGGGRTIELNISGQDLNDILAVAGRAAGTISQL
orf             ------------------------------------------------------------
Bmarina         LPLLNAAASNAPDVINFAFQLPLFRVGGTTGSAIKIDLVGDDLDKVSAAAGALFGNLAQS
Leptospira      EVRRRISFTEDIRINFDANGDIIGKILDPNGSRLNLEIHGEDLKTLSTIGKNLIDKLKKE
Spombe          AKEAKRLKKLAKEEKRLKKKEEKARKAEEKRLQKERAKYAKQMSRESAHADQAIANTGPV
                                                                            

Ddesulfur       IPG---AQIRPLPSLELLFPEVRLIPDRERLRAAGMSAEDLGIAVDVLMDGRKISEFKEE
Cstuttgar       LPD---AQIRPIPSLEILFPELKIVPSRDRLMAAGMNTYELGIALDILMDGRKIGYYKQE
Wsuccinog       LPQG--TQVRPLPSLELIYPEINLYPDSDKLKAAGLNPSTFGVALDVLMDGRAIAEYKEE
Dacetoxi        IPQ---SQIRPVPSLEISYPEVSIVPDKKKLVANGLTETELGEYVDVLMDGRQIGDYMPD
Sbaltica        FAEP--QLYSDPSTLSLDQPLWQISPRWQRLVEQDFSGSEFGYAVSALSDGAYVDEFFLN
Sputrefac       FAEP--QLYSDPSTLSLDQPLWQITPRWHRLVEQNFSGSEFGYAVSALSDGAYVDEFFID
Csalexi         FDNP--RIQSRPSALDLGQPLIEVYPDWERAAELGFDTDALGTAIAVLTNGAYLDDFYLD
Bburgdorf       IPE----LVNPRLSISDFQLQIGVEIDRALVYNYGIDMNTILNELKANINGVVAGQYVEK
Bafzelii        IPE----LVNPRLSINDAQLQIGVEIDRALVYNYGIDMNTILNELKANVNGVIAGQYVEN
Bgarinii        IPE----LVNPRLSINDLQLQIGVEIDRALAYNYGIDMNTILSELKANVNGVVAGQYVEN
Rdenitri        LPRSEGHQFRPLPGLELGAPEVRLVPDRLRLADAGLTSSDLALTVDAFNDGLRVAEITVG
orf             ------------------------------------------------------------
Bmarina         YGP--MAVTPVPANFSLPTPELRITPNRERLQDVGMGQDDLGLAISANGDGIMIVRAFDV
Leptospira      QVAT-----DLRNSLETKKNEYVIEFDPIKASSLKLTNDYISQYVKVASYGSNISKIKYQ
Spombe          APPYFEHETEPSHYEEEEEEEPEERREESSHFSESSGNNEFEETEQEYTHGYGNDVLVQR
                                                                            

Ddesulfur       GKKKIDLVLKTDDTALS--TPEAVYKALVATPAGGTVPVSSLALLERTYGITQIRHLERQ
Cstuttgar       GQKKIDLIVKASDETIH--TPEILYNSLISLPNRSVVPVYSLSQLQRTTGITQIRHLERD
Wsuccinog       GREKIDLVLKANKGELK--TPEEIYNALIYTPSAGILPLSSLSEIKREYGITEIRHFERK
Dacetoxi        GTRKVDLVVKASDAEVR--SPEDILNSTIVNRYGELIRVGDIARAEYEQGMTQIDHYERR
Sbaltica        -DNKVDIFLFSLAGNQQ--SLSQLALAPIVTPKGNVLPLQALADISEQMDSDSLRRVDGR
Sputrefac       -DNKVDIFLFSQAGNQQ--SLAQLALAPIVTPTGNVLPLQALADISEQMDSNSLRRVDGR
Csalexi         -DEKIDLYGYGPNAGDI--DLDQLANLPLHTPTGSNVPLNDVADIEETVGTATIRRVDGR
Bburgdorf       -GLNYDIVLKLDRMDVK--NLKDLEKIFITNSSGVKIPFSSIATFEKTNKAESIYRENQA
Bafzelii        -GLNYDIVLKLDRMDVK--NLKDLEKIFIINSSGVKIPFSSIATFEKTNKAESIYRENQA
Bgarinii        -GLNYDIVLKLDRMDVK--NLKDLGKIFITSPSGVKIPFSSIATFEKTNKAESIYRENQA
Rdenitri        -AERVNLMLKGDPGLQVGQRTQDIGNYPVVTPSGQIIPVSALADVVVTAGPTEIRHRDRL
orf             ------------------------------------------------------------
Bmarina         GGELKDLKIITQDALLG-DPIYALHNSPVATPEGRVVDFQSLATIERVEAADQIKHADRQ
Leptospira      EDDLNIRLLIKKDSIDN---LNKLQNLNIKTPTGEFIKLSQLANIQENTSSSSIKRSGNS
Spombe          TDVVNNFGESSHAHDNAVNEKRDLGRNGFGDVDEQDATEVYRHSIERIVPGDYLHDEKTR
                                                                            

Ddesulfur       RTVTLQVTPPKDVPLQQAMEQIENDIIPKLEK--GPLAGIKSSISGAADKLTQTRNALQW
Cstuttgar       RTITLQVTPPETIPLQEAMEIIDGTVLQTLKEQ-DMLQGVTIRLSGAADKLTTTRKALQW
Wsuccinog       RTVTLQVTPPKNMPLEEAMEKIQGEFVEELQKQ-GLIGSNELRLSGTADKLTQTRLALQG
Dacetoxi        RNITLQVTPSADIPLQQATETIEG-LVAQLRKG-GKLDGTQIFIGGNADKLVETREALQW
Sbaltica        RTVTLYIIPPRAIALETAVAKVREELVPILYQQGAVGKDVSLDISGAADQLEATKAALSS
Sputrefac       RTVTLYIIPPRNIALETAVTKVREELVPLLYQQGAVAKDVSLDISGAADQLEATRAALSS
Csalexi         RSVTLDVIPPRSVALEAGIARMQREVLEPMRDTGELPGNIDVTVTGAGDQLDATRQALTS
Bburgdorf       LTIYLNAG----ISPDDNLTQVTAKVVDFINNKVPHKEGITLKVEGEYNEFSNIMNQFKI
Bafzelii        LTIYLNAG----ISPNDNLTQVTAKVVDFINNKVPHKEGTVLKVEGEYNEFSNIMNQFKI
Bgarinii        LTIYLNAS----ISPNDNLTQVTAKVIDFINNKVPHKEGTVLKVEGEYDEFSNIMNQFKI
Rdenitri        RTVTLEVRPSDALALEEAVELLQEEVIDVLEES-GLPNGVRMSVSGTADQLSQTWDAIQI
orf             ------------------------------------------------------------
Bmarina         RAVTLQLTPPAGLPLQEAIDQVDQMVASMRELG-VIPPEVDVNLAGSAGQLAQIKNALMG
Leptospira      RINVVQGN------------LNSNKSIDSIIQNMKLPLGYRIKIGGESENMEKSFKELLF
Spombe          DTLTRESPAFRSEEAVVEVADEDHPHASEAERAHSYSNRKQASSESSPESQSTHYNDYEG
                                                                            

Ddesulfur       N----------FLLALVITYLLMAALFGNFVYPLLIMFTVPLAAAGGIIGLRLEN-----
Cstuttgar       N----------FALAVVITYLLMSALFGNFIYPLIIMFTIPLAAAGGFIGLRLVN-----
Wsuccinog       G----------FVLAVVIIYLLMAALYENFIYPLIIIFTVPLAVAGGVIGLKLVN-----
Dacetoxi        N----------LLLALVITYLLMAVLFENFFYPLIIMFSVPLAAAGGFIGLKAVN-----
Sbaltica        N----------FLVAVLIIYLLLVAIFNHWGYPLFVLITIPLGLAGGLVGLQALNYTGSL
Sputrefac       N----------FIVAVLIIYLLLVAIFNHWGYPLFVLVTIPLGLAGGLVGLETLNAVGYL
Csalexi         N----------GLIALAIVYLLLVAIFTHWGYPLLILATIPLGAAGGIVGLWLMNTVGAV
Bburgdorf       I----------IMMAIIVVFGIMASQFESFLKPFIIIFTIPLTAIGVVLIHFLAG-----
Bafzelii        I----------IMMAIVVVFGIMASQFESFLKPFIIIFTIPLTAIGVVLIHFLAG-----
Bgarinii        I----------ITMAVIVVFGIMASQFESFLKPFIIIFTIPLTAIGVVLIHFLAG-----
Rdenitri        N----------LAVALVIVFLVMAILFESFVLPLVIMISVPVAAAGGVGGLALLN-----
orf             ------------------------------------------------------------
Bmarina         DGSLVGTLSSSLFLALLIVYLLMVVLFQSWAYPVVIMVSVPLALLGGFAGLALVHHWS--
Leptospira      A----------FALASILIYMLLSSQFQSLKLSAIMICTIPLMFIGIFPALFLFG-----
Spombe          TEDNIVRQTTTVDEDGHQEQTTSTTKVAHPIPVSNGLSSPPRERLDDNAKEILSRSSPKS
                                                                            

Ddesulfur       ------------------LLVAPQPMDVLTMLGFIILIGVVVNNAILIVHQSLNNIREL-
Cstuttgar       ------------------ICIALQPFDILTMLGFVILIGVVVNNAILIVYQALNNVRFQ-
Wsuccinog       ------------------LFLANQPLDILTMLGFIILVGTVVNNAILIVYQAINNIREE-
Dacetoxi        ------------------LFVAPQGFDILTMLGFIILIGTVVNNAILIVHQSLNNVRFE-
Sbaltica        -------------FAYLGGQGWHQPFDMITMLGFLILLGTVVNNPILIVEQSRKNLQSG-
Sputrefac       -------------FQQLSGQGWHQPFDMITMLGFLILLGTVVNNPILIVEQSRKNLQSG-
Csalexi         -------------LPRVGLNAISQPFDMITMLGFLILMGTVVNNPILVVHQARENLRES-
Bburgdorf       -----------------------EKLSIFAAIGMLMLVGVVVNTGIVLVDYTGLLIKR--
Bafzelii        -----------------------EKLSIFAAIGMLMLVGVVVNTGIVLVDYTGLLIKR--
Bgarinii        -----------------------EKLSIFAAIGMLMLVGVVVNTGIVLIDYTGLLIKR--
Rdenitri        -------------------TFQTQPLDTLTLLGFIILVGIVVNNAILIVHQTLYHLRDE-
orf             ------------------------------------------------------------
Bmarina         ---------------VVDRYMPIQNMDVLTILGFVILAGVVVNNAILIVYQTINILQGRS
Leptospira      -----------------------KSFNISAFLGLVLLLGVVVDNASLYYEYLIISLNES-
Spombe          PVAWFKRKFKNRKDKAAVKRMLEEDSSKQLSSGRDVVAPTSVNHDVSHVGESTKPAVNNS
                                                                            

Ddesulfur       ------------GMDPQQAIRESVRTRLRPIFMSATTSLFGMLPLVVAPGPGSELYRGLG
Cstuttgar       ------------GMNHHDAVIESTRTRLRPIFMSAFTSIFGMLPLVIAPGPGSELYRGLG
Wsuccinog       ------------GMEAYEAVILSVRTRLRPIYMSTLTSLFGMLPLVLAPGPGSEVYRGLG
Dacetoxi        ------------GMKGIDAIRESVRTRIRPIFMSTTTSLFGLLPLVLSTGAGSELYRGIG
Sbaltica        ------------LFSVVDAVKSAVANRLRPILMSTATTLFGLLPLVLFPGAGSELYRGVG
Sputrefac       ------------HLSVIEAVKAAVENRLRPILMSTATTLFGLLPLVLFPGAGSELYRGVG
Csalexi         ------------SMNVRDAVFHAVESRLRPIAMTTLTTLCGLSPLVFLPGEGTELYRGVG
Bburgdorf       ------------GFGLREAIIESCRSRLRPILMSSLTSIIGLIPMAFSSGSGNELLKPIA
Bafzelii        ------------GFGLREAIVESCRSRFRPILMSSLTSIIGLIPMAFSSGSGNELLKPIA
Bgarinii        ------------GFGLRESIIESCRSRLRPILMSSLTSIIGLIPMAFSSGSGNELLKPIA
Rdenitri        ------------GMSPVDAIEEATRNRIRPIFMSTLTSVCGMLPLVVFPGEGSELYRGLG
orf             ------------------------------------------------------------
Bmarina         EEGEDTS-----HYTPREAIAKSVESRVRPIMMSTLTSVGGMLPLVLMPGSGSELYRGLG
Leptospira      -------------KELSKAIIESGKIVFRPILMNNLTTILGLIPVAFEFQKGAEFQSPMA
Spombe          TKPVAVTSKNGHSRNGSHAAHSNNVIGTQPHVNVSAVPNTGNLKDALEGSAVSKTDDVDN
                                                                            

Ddesulfur       AVVLGGLAISTLFTVFVVPALLSFFIGMEKTPPRYE------------------------
Cstuttgar       SVMLGGLAFSTIFTIFIIPAILMFAIRMEKTENTQS------------------------
Wsuccinog       AVILGGLTFSTLITVFVIPSLLLFVIQKERLKIDIEKAEKAGGIA---------------
Dacetoxi        SVLLGGLLVSTVFTLFVIPALLAFFIHRERAENAE-------------------------
Sbaltica        IVVLAGLIVATLLSLTFLPALLISVLSYTNRANLTASSAKVARHHD--------------
Sputrefac       IVVLSGLMVATLLSLTFLPAILISVLSFTHKADLLKGVDRYPD-----------------
Csalexi         AIVLFGLLGTAIVTVTFLPALTVAVLSWRLKHRQR-------------------------
Bburgdorf       FTFIGGMTASTFLTLFFIPMLFEIFPTCFKFQI---------------------------
Bafzelii        FTFIGGMTASTFLTLFFIPMLFEVFSNIVSSFKFKLKRVMSNVDVEKSFKINNSTKSSYN
Bgarinii        FTFIGGMTASTFLTLFFIPMLFEVFSNIVSSFKSRLKRVVPNLDVEKSFKINNSTKSSYD
Rdenitri        AVVVGGLSMSAFLTLLTVPPLLRLCVRAPIEDEEKLALRTPAQ-----------------
orf             ------------------------------------------------------------
Bmarina         AVVVGGLVVSTIFTMILVPVLLSVLFDLRPPVKAEETAAA--------------------
Leptospira      IVVIIGLLSSFAFSLFLLPILFFYILQKQKFKTIK-------------------------
Spombe          VVSGHSNVNGVSKSRPNIVERSEDYVISHLPEQSRAPIGAAFQEDL--------------
                                                                            

Ddesulfur       --------
Cstuttgar       --------
Wsuccinog       --------
Dacetoxi        --------
Sbaltica        --------
Sputrefac       --------
Csalexi         --------
Bburgdorf       --------
Bafzelii        NLFEEDGD
Bgarinii        NLFEEDGD
Rdenitri        --------
orf             --------
Bmarina         --------
Leptospira      --------
Spombe          --------

BLAST

                                                      

   blastp contre swissprot                   

                                                                 Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|2498437|sp|Q48815|HELA_LEGPN  Protein helA                      90.9    4e-18
gi|60390065|sp|Q7N3E2|MDTB_PHOLL  Multidrug resistance protein md  80.9    5e-15
gi|60389881|sp|P69340|MDTB_SHIFL  Multidrug resistance protein md  79.3    1e-14
gi|3025164|sp|P76398|MDTB_ECOLI  Multidrug resistance protein mdt  79.3    1e-14
gi|60390125|sp|Q8X7J4|MDTB_ECO57  Multidrug resistance protein md  79.3    1e-14
gi|59798414|sp|Q8FG04|MDTB_ECOL6  Multidrug resistance protein md  79.3    1e-14
gi|3913398|sp|P94177|CZCA_ALCSC  Cation efflux system protein czc  77.8    4e-14
gi|60390138|sp|Q8ZCW0|MDTB_YERPE  Multidrug resistance protein md  76.6    8e-14
gi|60389947|sp|Q668C6|MDTB_YERPS  Multidrug resistance protein md  76.6    8e-14
gi|110282954|sp|P13511|CZCA_RALME  Cobalt-zinc-cadmium resista...  76.3    1e-13
gi|60390133|sp|Q8Z5F7|MDTB_SALTI  Multidrug resistance protein md  75.9    2e-13
gi|60390145|sp|Q8ZNQ2|MDTB_SALTY  Multidrug resistance protein md  75.1    3e-13
gi|17380412|sp|P25197|NOLG_RHIME  Nodulation protein nolG precurs  74.7    3e-13
gi|2506614|sp|P38054|CUSA_ECOLI  Cation efflux system protein cus  74.3    4e-13
gi|48474860|sp|Q8FK36|CUSA_ECOL6  Cation efflux system protein cu  73.9    5e-13
gi|48474909|sp|Q8XBY1|CUSA_ECO57  Cation efflux system protein cu  72.8    1e-12
gi|60390064|sp|Q7N3E1|MDTC_PHOLL  Multidrug resistance protein md  72.4    1e-12
gi|60389971|sp|Q6D2B1|MDTB_ERWCT  Multidrug resistance protein md  67.8    4e-11
gi|52000763|sp|O31501|SWRC_BACSU  Swarming motility protein swrC   65.9    2e-10
gi|110282943|sp|P37972|CNRA_RALME  Nickel and cobalt resistance p  65.5    2e-10
gi|2833482|sp|Q57124|Y895_HAEIN  Hypothetical protein HI0895       65.1    3e-10
gi|60389970|sp|Q6D2B0|MDTC_ERWCT  Multidrug resistance protein md  65.1    3e-10
gi|71153757|sp|Q849R0|SEPB_PSEPU  Probable efflux pump membrane t  63.9    6e-10
gi|13633956|sp|Q9ZHC9|SILA_SALTY  Putative cation efflux system p  62.0    2e-09
gi|59798413|sp|Q8FG03|MDTC_ECOL6  Multidrug resistance protein md  60.5    7e-09
gi|2506970|sp|P24177|ACRD_ECOLI  Probable aminoglycoside efflu...  60.5    7e-09
gi|3914126|sp|Q44586|NCCA_ALCXX  Nickel-cobalt-cadmium resistance  60.5    7e-09
gi|60390058|sp|Q7ACM1|MDTC_ECO57  Multidrug resistance protein md  60.1    9e-09
gi|3025165|sp|P76399|MDTC_ECOLI  Multidrug resistance protein mdt  59.7    1e-08
gi|60390144|sp|Q8ZNQ1|MDTC_SALTY  Multidrug resistance protein md  59.7    1e-08
gi|60390132|sp|Q8Z5F6|MDTC_SALTI  Multidrug resistance protein md  59.7    1e-08
gi|60390089|sp|Q83KI4|MDTC_SHIFL  Multidrug resistance protein md  58.9    2e-08
gi|60389946|sp|Q668C5|MDTC_YERPS  Multidrug resistance protein md  58.2    4e-08
gi|60390137|sp|Q8ZCV9|MDTC_YERPE  Multidrug resistance protein md  57.8    4e-08
gi|71152256|sp|Q9KJC2|ARPB_PSEPU  Antibiotic efflux pump membrane  57.4    6e-08
gi|71153370|sp|O52248|TTGB_PSEPU  Toluene efflux pump membrane tr  57.4    6e-08
gi|71153369|sp|Q88N31|TTGB_PSEPK  Probable efflux pump membran...  57.4    6e-08 Gene info
gi|12230911|sp|P52002|MEXB_PSEAE  Multidrug resistance protein...  57.0    7e-08
gi|399429|sp|P24181|ACRF_ECOLI  Acriflavine resistance protein F   53.9    6e-07
gi|57012957|sp|Q8FCI8|MDTF_ECOL6  Multidrug resistance protein md  52.4    2e-06
gi|57012961|sp|Q8X3J5|MDTF_ECO57  Multidrug resistance protein md  52.4    2e-06
gi|586678|sp|P37637|MDTF_ECOLI  Multidrug resistance protein mdtF  52.4    2e-06
gi|22095520|sp|Q97FT3|CARB_CLOAB  Carbamoyl-phosphate synthase...  32.0    2.6  
gi|18202127|sp|O72896|V091_FOWPV  Protein FPV091                   31.6    3.5   Gene info
gi|97536283|sp|P19490|GRIA1_RAT  Glutamate receptor 1 precurso...  30.0    8.8  
gi|121430|sp|P23818|GRIA1_MOUSE  Glutamate receptor 1 precurso...  30.0    8.8   Gene info

>gi|2498437|sp|Q48815|HELA_LEGPN  Protein helA
Length=1052

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 68/291 (23%), Positives = 135/291 (46%), Gaps = 7/291 (2%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            G SP E+E+ I    E  +  L  L+   S+S  G   +T+      N+  +   ++  L
Sbjct  55   GYSPFEVEQRITFPIELAMSGLPSLDYTRSLSRYGLSQVTVVFKDGTNIYFARQLINERL  114

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILKSK-----NQKKDIFKYKNFVEENIKTQFE  115
             +VKD        T+  +S+    I  + + +K     +Q  +  + +   +  IK Q  
Sbjct  115  QEVKDKLPPGVETTLGPISTGLGEIFMYTVTNKPNVPISQHYNPTELRTIQDWIIKPQLR  174

Query  116  RIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKY  175
             ++GV E    GG  K+ HI  D +++    LSL ++   L+ +N ++ +G+IE    + 
Sbjct  175  NVEGVAEVNTIGGYEKQFHITPDPSKLVRYRLSLNDVVEALERNNANVGAGYIETNGEQN  234

Query  176  LARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIK  235
            L R  G+  ++ ++E++VI       +R+  ++++AL  E          ++ +   +  
Sbjct  235  LIRVPGQVQNMADIENIVIASFEGTPVRIRDVAEVALGKELRTGAATENSKEVVLGTVFI  294

Query  236  ESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVRN  286
              G N+  V + +   M+ +N ++   EG+    VY  TT +N +I+ V+N
Sbjct  295  LMGENSRTVSERVAAKMKDINKTL--PEGVEAITVYNRTTLVNATINTVKN  343


>gi|60390065|sp|Q7N3E2|MDTB_PHOLL  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1048

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 73/294 (24%), Positives = 130/294 (44%), Gaps = 20/294 (6%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   +    E +L  + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVMTSAVTAPLERQLGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKS-VSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKT  112
               SNLL      P D   P I S V+    PI   +L   +    + + ++ VE  I  
Sbjct  122  NAASNLL------PNDLPYPPIYSKVNPADPPI--LMLAVTSDAMPMTQIQDMVETRIAQ  173

Query  113  QFERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGK  172
            +  ++ GVG   + GG+   + + ++   +A  GL    I   + N+NV+ + G ++   
Sbjct  174  KISQVNGVGLVTLAGGQRPAVRVKLNAQAVAAQGLDSETIRTAINNANVNSAKGSLDGPT  233

Query  173  RKYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALN  232
            R        +  S+ +  +L+I  +  + +RL  ++ I    E++          AI +N
Sbjct  234  RSVTLSANDQMKSVNDYRNLIIAYKNGSPVRLQDVATIEQGAENTKLGAWSNNTQAIVIN  293

Query  233  IIKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTD-TTYINNSISVVR  285
            + ++ GAN IE    +   + +L +S+ K   +    + TD TT I  S+  V+
Sbjct  294  VQRQPGANVIETTDNIRQMLPELISSLPKSVDM---KILTDRTTTIRASVKDVQ  344


>gi|60389881|sp|P69340|MDTB_SHIFL  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1039

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 70/288 (24%), Positives = 124/288 (43%), Gaps = 16/288 (5%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   +    E +   + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLNVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQ  113
               +NLL    D+P   + P    V+    PI    L   +    + + ++ VE  +  +
Sbjct  122  NAATNLLPS--DLP---NPPVYSKVNPADPPI--MTLAVTSTAMPMTQVEDMVETRVAQK  174

Query  114  FERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKR  173
              +I GVG   + GG+   + + ++   IA  GL+   +   +  +NV+ + G ++   R
Sbjct  175  ISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSR  234

Query  174  KYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNI  233
                    +  S +E   L+I  Q    IRLG ++ +    E+S        E AI +N+
Sbjct  235  AVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNV  294

Query  234  IKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSI  281
             ++ GAN I     +   + +L  S+ K   + +T +   TT I  S+
Sbjct  295  QRQPGANIISTADSIRQMLPQLTESLPKS--VKVTVLSDRTTNIRASV  340


>gi|3025164|sp|P76398|MDTB_ECOLI  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1040

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 70/288 (24%), Positives = 124/288 (43%), Gaps = 16/288 (5%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   +    E +   + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQ  113
               +NLL    D+P   + P    V+    PI    L   +    + + ++ VE  +  +
Sbjct  122  NAATNLLPS--DLP---NPPVYSKVNPADPPI--MTLAVTSTAMPMTQVEDMVETRVAQK  174

Query  114  FERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKR  173
              +I GVG   + GG+   + + ++   IA  GL+   +   +  +NV+ + G ++   R
Sbjct  175  ISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSR  234

Query  174  KYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNI  233
                    +  S +E   L+I  Q    IRLG ++ +    E+S        E AI +N+
Sbjct  235  AVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNV  294

Query  234  IKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSI  281
             ++ GAN I     +   + +L  S+ K   + +T +   TT I  S+
Sbjct  295  QRQPGANIISTADSIRQMLPQLTESLPKS--VKVTVLSDRTTNIRASV  340


>gi|60390125|sp|Q8X7J4|MDTB_ECO57  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1040

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 70/288 (24%), Positives = 124/288 (43%), Gaps = 16/288 (5%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   +    E +   + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQ  113
               +NLL    D+P   + P    V+    PI    L   +    + + ++ VE  +  +
Sbjct  122  NAATNLLPS--DLP---NPPVYSKVNPADPPI--MTLAVTSTAMPMTQVEDMVETRVAQK  174

Query  114  FERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKR  173
              +I GVG   + GG+   + + ++   IA  GL+   +   +  +NV+ + G ++   R
Sbjct  175  ISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSR  234

Query  174  KYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNI  233
                    +  S +E   L+I  Q    IRLG ++ +    E+S        E AI +N+
Sbjct  235  AVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNV  294

Query  234  IKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSI  281
             ++ GAN I     +   + +L  S+ K   + +T +   TT I  S+
Sbjct  295  QRQPGANIISTADSIRQMLPQLTESLPKS--VKVTVLSDRTTNIRASV  340


>gi|59798414|sp|Q8FG04|MDTB_ECOL6  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1040

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 70/288 (24%), Positives = 124/288 (43%), Gaps = 16/288 (5%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   +    E +   + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVMTSAVTAPLERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQ  113
               +NLL    D+P   + P    V+    PI    L   +    + + ++ VE  +  +
Sbjct  122  NAATNLLPS--DLP---NPPVYSKVNPADPPI--MTLAVTSTAMPMTQVEDMVETRVAQK  174

Query  114  FERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKR  173
              +I GVG   + GG+   + + ++   IA  GL+   +   +  +NV+ + G ++   R
Sbjct  175  ISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSR  234

Query  174  KYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNI  233
                    +  S +E   L+I  Q    IRLG ++ +    E+S        E AI +N+
Sbjct  235  AVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNV  294

Query  234  IKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSI  281
             ++ GAN I     +   + +L  S+ K   + +T +   TT I  S+
Sbjct  295  QRQPGANIISTADSIRQMLPQLTESLPKS--VKVTVLSDRTTNIRASV  340


>gi|3913398|sp|P94177|CZCA_ALCSC  Cation efflux system protein czcA
Length=1063

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 65/295 (22%), Positives = 131/295 (44%), Gaps = 15/295 (5%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            G SP E E+ +    E  +  L GLE   S+S  G   +T+      +V  +   V+  +
Sbjct  55   GYSPLETEQRVTYPIEVVMAGLPGLEQTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRI  114

Query  61   DQVKDIPVDADRPTIKSVSSERSPI-AWFILKSKNQKK---------DIFKYKNFVEENI  110
             + KD   +   P +  +S+    I  W +   +  +K         D+ + +++V   +
Sbjct  115  QEAKDNLPEGVVPAMGPISTGLGEIYLWTVEAEEGARKADGTAYTPTDLREIQDWV---V  171

Query  111  KTQFERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEE  170
            + Q   + GV E    GG +K+  +     R+A  GL+L ++ N L  +N ++ +G+IE 
Sbjct  172  RPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTLTDVVNALNKNNDNVGAGYIER  231

Query  171  GKRKYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIA  230
               +YL R  G+  S  ++ ++++       IR+  I  + +  E         G++ + 
Sbjct  232  RGEQYLVRAPGQVASEDDIRNIIVGTAQGQPIRIRDIGDVEIGKELRTGAATENGKEVVL  291

Query  231  LNIIKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVR  285
              +    G N+  V K +   +  +N ++   EG+ +  VY  T  ++ +I+ V+
Sbjct  292  GTVFMLIGENSRAVSKAVDEKVASINRTM--PEGVKIVTVYDRTRLVDKAIATVK  344


>gi|60390138|sp|Q8ZCW0|MDTB_YERPE  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1052

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 74/293 (25%), Positives = 124/293 (42%), Gaps = 18/293 (6%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   I    E +   + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVVTSSITAPLERQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQ  113
               +NLL    D+P     P    V+    PI    L        + + ++ VE  I  +
Sbjct  122  NAATNLLPS--DLPYP---PIYNKVNPADPPI--LTLAVTATAIPMTQVEDMVETRIAQK  174

Query  114  FERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKR  173
              ++ GVG   + GG+   + + ++   +A  GL    I   + N+NV+ + G ++   R
Sbjct  175  ISQVTGVGLVTLSGGQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGPTR  234

Query  174  KYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNI  233
                    +  S +E  DL+I  Q    IRL  ++ I    E++        + AI LNI
Sbjct  235  SVTLSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNI  294

Query  234  IKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTD-TTYINNSISVVR  285
             ++ G N I     +   + +L  S+ K   +    V TD T+ I  S++ V+
Sbjct  295  QRQPGVNVIATADSIREMLPELIKSLPKSVDV---KVLTDRTSTIRASVNDVQ  344


>gi|60389947|sp|Q668C6|MDTB_YERPS  Multidrug resistance protein mdtB (Multidrug transporter mdtB)
Length=1052

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 74/293 (25%), Positives = 124/293 (42%), Gaps = 18/293 (6%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELN-------PKQNVSTSI  53
            GASP+ +   I    E +   + GL+ M S S  G   ITL+          +Q V  +I
Sbjct  62   GASPDVVTSSITAPLERQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAI  121

Query  54   IQVSNLLDQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQ  113
               +NLL    D+P     P    V+    PI    L        + + ++ VE  I  +
Sbjct  122  NAATNLLPS--DLPYP---PIYNKVNPADPPI--LTLAVTATAIPMTQVEDMVETRIAQK  174

Query  114  FERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKR  173
              ++ GVG   + GG+   + + ++   +A  GL    I   + N+NV+ + G ++   R
Sbjct  175  ISQVTGVGLVTLSGGQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGPTR  234

Query  174  KYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNI  233
                    +  S +E  DL+I  Q    IRL  ++ I    E++        + AI LNI
Sbjct  235  SVTLSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNI  294

Query  234  IKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTD-TTYINNSISVVR  285
             ++ G N I     +   + +L  S+ K   +    V TD T+ I  S++ V+
Sbjct  295  QRQPGVNVIATADSIREMLPELIKSLPKSVDV---KVLTDRTSTIRASVNDVQ  344


>gi|110282954|sp|P13511|CZCA_RALME  Cobalt-zinc-cadmium resistance protein czcA (Cation efflux system 
protein czcA)
Length=1063

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 65/295 (22%), Positives = 130/295 (44%), Gaps = 15/295 (5%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            G SP E E+      E  +  L GLE   S+S  G   +T+      +V  +   V+  +
Sbjct  55   GYSPLETEQRATYPIEVVMAGLPGLEQTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRI  114

Query  61   DQVKDIPVDADRPTIKSVSSERSPI-AWFILKSKNQKK---------DIFKYKNFVEENI  110
             + KD   +   P +  +S+    I  W +   +  +K         D+ + +++V   +
Sbjct  115  QEAKDNLPEGVVPAMGPISTGLGEIYLWTVEAEEGARKADGTAYTPTDLREIQDWV---V  171

Query  111  KTQFERIKGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEE  170
            + Q   + GV E    GG +K+  +     R+A  GL+L ++ N L  +N ++ +G+IE 
Sbjct  172  RPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTLTDVVNALNKNNDNVGAGYIER  231

Query  171  GKRKYLARTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIA  230
               +YL R  G+  S  ++ ++++       IR+  I  + +  E         G++ + 
Sbjct  232  RGEQYLVRAPGQVASEDDIRNIIVGTAQGQPIRIRDIGDVEIGKELRTGAATENGKEVVL  291

Query  231  LNIIKESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVR  285
              +    G N+  V K +   +  +N ++   EG+ +  VY  T  ++ +I+ V+
Sbjct  292  GTVFMLIGENSRAVSKAVDEKVASINRTM--PEGVKIVTVYDRTRLVDKAIATVK  344



  Blastp contre nr    
                                                             Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|78357424|ref|YP_388873.1|  acriflavin resistance protein D ...   204    6e-51 
gi|110678662|ref|YP_681669.1|  acriflavin resistance protein D...   199    2e-49 
gi|91200521|emb|CAJ73570.1|  similar to acriflavine resistance...   190    5e-47
gi|34556841|ref|NP_906656.1|  ACRIFLAVIN RESISTANCE PROTEIN D ...   181    4e-44 
gi|95931214|ref|ZP_01313935.1|  acriflavin resistance protein ...   171    4e-41
gi|85712912|ref|ZP_01043953.1|  RND family efflux transporter ...   159    1e-37
gi|92114523|ref|YP_574451.1|  acriflavin resistance protein [C...   158    2e-37 
gi|56460403|ref|YP_155684.1|  RND family efflux transporter [I...   157    4e-37 
gi|113949340|ref|ZP_01434990.1|  acriflavin resistance protein...   157    6e-37
gi|68541076|ref|ZP_00580823.1|  Acriflavin resistance protein ...   157    6e-37
gi|77814358|ref|ZP_00813618.1|  Acriflavin resistance protein ...   157    6e-37
gi|114797722|ref|YP_760886.1|  AcrB/AcrD/AcrF family protein [...   152    2e-35 
gi|88858736|ref|ZP_01133377.1|  RND family efflux transporter ...   145    2e-33
gi|87310010|ref|ZP_01092143.1|  acriflavin resistance protein ...   137    5e-31
gi|114570025|ref|YP_756705.1|  acriflavin resistance protein [...   132    2e-29 
gi|24216437|ref|NP_713918.1|  Cobalt-zinc-cadmium resistance p...   132    3e-29 
gi|87309417|ref|ZP_01091552.1|  acriflavin resistance protein ...   131    3e-29
gi|45656389|ref|YP_000475.1|  acriflavin resistance [Leptospir...   131    3e-29 
gi|83591185|ref|YP_431194.1|  Acriflavin resistance protein [M...   128    3e-28 
gi|114319813|ref|YP_741496.1|  acriflavin resistance protein [...   127    7e-28 
gi|108761482|ref|YP_632083.1|  efflux transporter, AcrB/AcrD/A...   127    8e-28 
gi|88948518|ref|ZP_01151281.1|  RND family efflux transporter ...   126    1e-27
gi|53803797|ref|YP_114557.1|  AcrB/AcrD/AcrF family protein [M...   124    6e-27 
gi|84683694|ref|ZP_01011597.1|  hypothetical protein RB2654_20...   123    1e-26
gi|90588274|ref|ZP_01243926.1|  Acriflavin resistance protein ...   122    2e-26
gi|115380500|ref|ZP_01467473.1|  acriflavin resistance protein...   122    2e-26
gi|71278940|ref|YP_269381.1|  AcrB/AcrD/AcrF family protein [C...   121    3e-26 
gi|91793546|ref|YP_563197.1|  acriflavin resistance protein [S...   121    4e-26 
gi|88948652|ref|ZP_01151415.1|  AcrB family membrane transport...   121    4e-26
gi|114563552|ref|YP_751065.1|  acriflavin resistance protein [...   120    6e-26 
gi|110835607|ref|YP_694466.1|  AcrB/AcrD/AcrF family protein [...   120    6e-26 
gi|88946242|ref|ZP_01149327.1|  acriflavine resistance protein...   120    7e-26
gi|114320343|ref|YP_742026.1|  acriflavin resistance protein [...   120    7e-26 
gi|91794777|ref|YP_564428.1|  acriflavin resistance protein [S...   120    7e-26 
gi|67918787|ref|ZP_00512380.1|  Acriflavin resistance protein ...   120    1e-25
gi|114776412|ref|ZP_01451457.1|  Acriflavin resistance protein...   120    1e-25
gi|117925812|ref|YP_866429.1|  acriflavin resistance protein [...   119    1e-25 
gi|77816499|ref|ZP_00815682.1|  Acriflavin resistance protein ...   119    1e-25
gi|77955581|ref|ZP_00819940.1|  AcrB/AcrD/AcrF family protein ...   119    1e-25
gi|42523286|ref|NP_968666.1|  NolG efflux transporter [Bdellov...   118    3e-25 
gi|113950652|ref|ZP_01436271.1|  acriflavin resistance protein...   118    3e-25
gi|84502249|ref|ZP_01000397.1|  hypothetical protein OB2597_19...   118    3e-25
gi|71281393|ref|YP_268691.1|  AcrB/AcrD/AcrF family protein [C...   118    3e-25 
gi|67459501|ref|YP_247125.1|  Hydrophobe/amphiphile efflux-1 H...   118    4e-25 
gi|42523244|ref|NP_968624.1|  NolG efflux transporter [Bdellov...   117    4e-25 
gi|77361196|ref|YP_340771.1|  acrB/acrD/acrF acriflavin resist...   117    4e-25 
gi|68542102|ref|ZP_00581838.1|  Acriflavin resistance protein ...   117    5e-25
gi|34580835|ref|ZP_00142315.1|  acriflavin resistance protein ...   117    5e-25
gi|15892134|ref|NP_359848.1|  acriflavin resistance protein D ...   117    6e-25 
gi|24373488|ref|NP_717531.1|  AcrB/AcrD/AcrF family protein [S...   117    6e-25 
gi|68546930|ref|ZP_00586473.1|  Acriflavin resistance protein ...   117    7e-25
gi|109898547|ref|YP_661802.1|  acriflavin resistance protein [...   117    9e-25 
gi|68546931|ref|ZP_00586474.1|  Acriflavin resistance protein ...   116    1e-24
gi|88858562|ref|ZP_01133204.1|  putative acrB/acrD/acrF acrifl...   116    1e-24
gi|114047203|ref|YP_737753.1|  acriflavin resistance protein [...   116    1e-24 
gi|113969968|ref|YP_733761.1|  acriflavin resistance protein [...   116    1e-24 
gi|21232598|ref|NP_638515.1|  acriflavin resistance protein [X...   116    1e-24 
gi|89092654|ref|ZP_01165607.1|  cation/multidrug efflux pump p...   116    2e-24
gi|117920150|ref|YP_869342.1|  acriflavin resistance protein [...   115    2e-24 
gi|83815756|ref|YP_445307.1|  acriflavine resistance protein (...   115    3e-24 
gi|78368222|ref|ZP_00838466.1|  Acriflavin resistance protein ...   114    5e-24
gi|53731871|ref|ZP_00153272.2|  COG0841: Cation/multidrug efflux    114    6e-24
gi|71281350|ref|YP_270584.1|  AcrB/AcrD/AcrF family protein [C...   114    7e-24 
gi|82745604|ref|ZP_00908115.1|  putative acriflavin resistance...   113    1e-23
gi|68549537|ref|ZP_00589000.1|  Acriflavin resistance protein ...   113    1e-23
gi|85711868|ref|ZP_01042923.1|  RND family efflux transporter ...   113    1e-23
gi|78188939|ref|YP_379277.1|  NolG efflux transporter [Chlorob...   112    1e-23 
gi|89896105|ref|YP_519592.1|  hypothetical protein DSY3359 [De...   112    1e-23 
gi|102191487|ref|ZP_01347299.1|  hypothetical protein RcanM_01...   112    1e-23
gi|33603251|ref|NP_890811.1|  probable membrane protein [Borde...   112    2e-23 
gi|33598341|ref|NP_885984.1|  probable membrane protein [Borde...   112    2e-23 
gi|51245974|ref|YP_065858.1|  similar to multidrug-efflux tran...   112    2e-23 
gi|109648304|ref|ZP_01372207.1|  acriflavin resistance protein...   112    2e-23
gi|42524450|ref|NP_969830.1|  efflux transporter [Bdellovibrio...   112    2e-23 
gi|86157901|ref|YP_464686.1|  Acriflavin resistance protein [A...   112    3e-23 
gi|108756809|ref|YP_628935.1|  efflux transporter, AcrB/AcrD/A...   111    3e-23 
gi|82748494|ref|ZP_00910977.1|  outer membrane efflux protein ...   111    5e-23
gi|21231585|ref|NP_637502.1|  transport protein [Xanthomonas c...   110    5e-23 
gi|115423989|emb|CAJ50542.1|  multidrug efflux system transmem...   110    6e-23
gi|118072969|ref|ZP_01541154.1|  acriflavin resistance protein...   110    6e-23
gi|118060151|ref|ZP_01528603.1|  acriflavin resistance protein...   110    6e-23
gi|88948762|ref|ZP_01151525.1|  acriflavin resistance protein ...   110    7e-23
gi|56461404|ref|YP_156685.1|  RND family efflux transporter [I...   110    7e-23 
gi|88858545|ref|ZP_01133187.1|  AcrB/AcrD/AcrF family protein ...   110    8e-23
gi|113474694|ref|YP_720755.1|  transporter, hydrophobe/amphiph...   110    8e-23 
gi|15594485|ref|NP_212274.1|  acriflavine resistance protein (...   110    9e-23 
gi|88946239|ref|ZP_01149324.1|  outer membrane efflux protein ...   110    1e-22
gi|56479464|ref|YP_161053.1|  cation/multidrug efflux pump pro...   110    1e-22 
gi|118439735|gb|EAV46366.1|  transporter, AcrB/AcrD/AcrF famil...   109    1e-22
gi|78366830|ref|ZP_00837107.1|  Acriflavin resistance protein ...   109    1e-22
gi|117617974|ref|YP_855886.1|  AcrB/AcrD/AcrF family protein [...   109    2e-22 
gi|109897362|ref|YP_660617.1|  acriflavin resistance protein [...   109    2e-22 
gi|24216545|ref|NP_714026.1|  hypothetical protein LA3846 [Lep...   109    2e-22 
gi|21242805|ref|NP_642387.1|  transport protein [Xanthomonas a...   109    2e-22 
gi|118075227|ref|ZP_01543364.1|  AcrB/AcrD/AcrF family protein...   109    2e-22
gi|21244051|ref|NP_643633.1|  acriflavin resistance protein [X...   109    2e-22 
gi|116621483|ref|YP_823639.1|  acriflavin resistance protein [...   109    2e-22 
gi|111114963|ref|YP_709581.1|  acriflavine resistance protein ...   109    2e-22 
gi|13473284|ref|NP_104851.1|  multidrug resistance protein [Me...   109    2e-22 
gi|45658900|ref|YP_002986.1|  acriflavin resistance [Leptospir...   109    2e-22 
gi|106895026|ref|ZP_01362135.1|  Acriflavin resistance protein...   109    2e-22
gi|78048999|ref|YP_365174.1|  RND superfamily protein [Xanthom...   108    2e-22 
gi|78047788|ref|YP_363963.1|  RND superfamily protein [Xanthom...   108    2e-22 
gi|94500097|ref|ZP_01306631.1|  AcrB/AcrD/AcrF family protein ...   108    3e-22
gi|88796591|ref|ZP_01112254.1|  RND family efflux transporter ...   108    4e-22
gi|58582263|ref|YP_201279.1|  transport protein [Xanthomonas o...   107    5e-22 
gi|110639043|ref|YP_679252.1|  multidrug efflux membrane fusio...   107    6e-22 
gi|87121823|ref|ZP_01077709.1|  AcrB/AcrD/AcrF family protein ...   107    6e-22
gi|94499695|ref|ZP_01306232.1|  cation/multidrug efflux pump p...   107    6e-22
gi|78486339|ref|YP_392264.1|  Acriflavin resistance protein [T...   107    6e-22 
gi|15889664|ref|NP_355345.1|  hypothetical protein AGR_C_4340 ...   107    7e-22 
gi|69934177|ref|ZP_00629313.1|  Acriflavin resistance protein ...   106    1e-21
gi|90418348|ref|ZP_01226260.1|  multidrug efflux protein, AcrB...   106    1e-21
gi|39997758|ref|NP_953709.1|  outer membrane efflux protein [G...   106    1e-21 
gi|23100395|ref|NP_693862.1|  acriflavine resistance protein [...   106    1e-21 
gi|88800488|ref|ZP_01116052.1|  acriflavin resistance plasma m...   106    1e-21
gi|117576571|emb|CAL65040.1|  AcrB/AcrD/AcrF family membrane t...   106    1e-21
gi|77684794|ref|ZP_00800214.1|  Acriflavin resistance protein ...   106    2e-21
gi|91774567|ref|YP_544323.1|  acriflavin resistance protein [M...   105    2e-21 
gi|77813754|ref|ZP_00813027.1|  Acriflavin resistance protein ...   105    2e-21
gi|117920789|ref|YP_869981.1|  acriflavin resistance protein [...   105    2e-21 
gi|59712739|ref|YP_205515.1|  acriflavin resistance plasma mem...   105    2e-21 
gi|91228323|ref|ZP_01262252.1|  putative multidrug resistance ...   105    3e-21
gi|85708219|ref|ZP_01039285.1|  putative acriflavin resistance...   105    4e-21
gi|82748607|ref|ZP_00911088.1|  outer membrane efflux protein ...   104    4e-21
gi|109728119|ref|ZP_01379530.1|  hypothetical protein RbelO_01...   104    4e-21
gi|91205965|ref|YP_538320.1|  Hydrophobe/amphiphile efflux-1 (...   104    4e-21 
gi|28899246|ref|NP_798851.1|  putative multidrug resistance pr...   104    4e-21 
gi|51598403|ref|YP_072591.1|  acriflavine resistance protein [...   104    5e-21 
gi|114563553|ref|YP_751066.1|  acriflavin resistance protein [...   104    5e-21 
gi|116183152|ref|ZP_01473215.1|  hypothetical protein VEx2w_02004   104    5e-21
gi|113934110|ref|ZP_01420011.1|  Acriflavin resistance protein...   103    7e-21
gi|84624852|ref|YP_452224.1|  acriflavin resistance protein [X...   103    7e-21 
gi|114705248|ref|ZP_01438156.1|  AcrB/AcrD/AcrF multidrug effl...   103    8e-21
gi|58583017|ref|YP_202033.1|  acriflavin resistance protein [X...   103    8e-21 
gi|15604045|ref|NP_220560.1|  ACRIFLAVIN RESISTANCE PROTEIN D ...   103    9e-21 
gi|24216625|ref|NP_714106.1|  transmembrane efflux pump protei...   103    1e-20 
gi|113875633|ref|ZP_01415758.1|  putative transport transmembr...   103    1e-20
gi|83750986|ref|ZP_00947400.1|  COG0841: Cation/multidrug effl...   103    1e-20
gi|114320043|ref|YP_741726.1|  acriflavin resistance protein [...   103    1e-20 
gi|45658956|ref|YP_003042.1|  acriflavin resistance [Leptospir...   102    2e-20 
gi|29347662|ref|NP_811165.1|  multidrug efflux membrane fusion...   102    2e-20 
gi|118057828|ref|ZP_01526291.1|  acriflavin resistance protein...   102    2e-20
gi|87198065|ref|YP_495322.1|  acriflavin resistance protein [N...   102    2e-20 
gi|21231586|ref|NP_637503.1|  transport protein [Xanthomonas c...   102    2e-20 
gi|51894410|ref|YP_077101.1|  AcrB family membrane transport p...   102    2e-20 
gi|114565745|ref|YP_752899.1|  acriflavin resistance protein [...   102    2e-20 
gi|24373487|ref|NP_717530.1|  AcrB/AcrD/AcrF family protein [S...   102    2e-20 
gi|16331156|ref|NP_441884.1|  cation or drug efflux system pro...   102    3e-20 
gi|24215139|ref|NP_712620.1|  acriflavine resistance protein h...   102    3e-20 
gi|88795147|ref|ZP_01110848.1|  AcrB/AcrD/AcrF family protein ...   101    4e-20
gi|114571169|ref|YP_757849.1|  acriflavin resistance protein [...   101    4e-20 
gi|42522459|ref|NP_967839.1|  acriflavin resistance protein [B...   101    4e-20 
gi|68545393|ref|ZP_00584944.1|  Acriflavin resistance protein ...   101    4e-20
gi|53711972|ref|YP_097964.1|  multidrug efflux membrane fusion...   101    4e-20 
gi|113874274|ref|ZP_01414402.1|  putative transport transmembr...   101    4e-20
gi|98661642|dbj|GAA01350.1|  unnamed protein product [Pelotomacul   101    5e-20
gi|58582265|ref|YP_201281.1|  transport protein [Xanthomonas oryz   101    5e-20 
gi|84624152|ref|YP_451524.1|  transport protein [Xanthomonas o...   101    5e-20 
gi|116330035|ref|YP_799753.1|  Efflux pump, AcrB family [Lepto...   101    5e-20 
gi|42522562|ref|NP_967942.1|  acriflavin resistance protein [B...   101    5e-20 
gi|78694643|ref|ZP_00859156.1|  Acr family transport protein [...   100    6e-20
gi|118051862|ref|ZP_01520410.1|  transporter, hydrophobe/amphi...   100    6e-20
gi|116329363|ref|YP_799083.1|  Efflux pump, AcrB family [Lepto...   100    6e-20 
gi|108757162|ref|YP_631176.1|  RND transporter, hydrophobe/amp...   100    6e-20 
gi|83943500|ref|ZP_00955959.1|  AcrB/AcrD/AcrF family protein ...   100    6e-20
gi|94497228|ref|ZP_01303800.1|  RND superfamily protein [Sphin...   100    6e-20
gi|115251459|emb|CAJ69292.1|  putative multidrug efflux pump, ...   100    7e-20
gi|16127427|ref|NP_421991.1|  AcrB/AcrD/AcrF family protein [C...   100    7e-20 
gi|85716797|ref|ZP_01047764.1|  Acriflavin resistance protein ...   100    8e-20
gi|21242804|ref|NP_642386.1|  transport protein [Xanthomonas a...   100    8e-20 
gi|78047787|ref|YP_363962.1|  RND superfamily protein [Xanthom...   100    8e-20 
gi|45657384|ref|YP_001470.1|  heavy metal efflux pump [Leptosp...   100    9e-20 
gi|15640649|ref|NP_230278.1|  multidrug resistance protein, pu...   100    9e-20 
gi|116220321|ref|ZP_01485759.1|  hypothetical protein VchoV5_0200   100    1e-19
gi|89889500|ref|ZP_01201011.1|  cation efflux system (AcrB/Acr...   100    1e-19
gi|75816105|ref|ZP_00746586.1|  COG0841: Cation/multidrug effl...   100    1e-19
gi|116748209|ref|YP_844896.1|  acriflavin resistance protein [...   100    1e-19 
gi|94263502|ref|ZP_01287314.1|  Acriflavin resistance protein ...  99.8    1e-19
gi|90574007|ref|ZP_01230514.1|  hypothetical protein CdifQ_020...  99.8    1e-19
gi|82701178|ref|YP_410744.1|  Hydrophobe/amphiphile efflux-1 H...  99.8    1e-19 
gi|56697191|ref|YP_167555.1|  transporter, AcrB/AcrD/AcrF fami...  99.8    1e-19 
gi|116331634|ref|YP_801352.1|  Cation/multidrug efflux pump [L...  99.8    1e-19 
gi|110600493|ref|ZP_01388712.1|  Acriflavin resistance protein...  99.8    1e-19
gi|88705518|ref|ZP_01103228.1|  multidrug efflux RND transport...  99.8    1e-19
gi|118075135|ref|ZP_01543277.1|  acriflavin resistance protein...  99.8    2e-19
gi|113969967|ref|YP_733760.1|  acriflavin resistance protein [...  99.8    2e-19 
gi|42522687|ref|NP_968067.1|  acriflavin resistance protein [B...  99.4    2e-19 
gi|49473804|ref|YP_031846.1|  Acriflavin resistance protein d ...  99.4    2e-19 
gi|99080828|ref|YP_612982.1|  acriflavin resistance protein [S...  99.4    2e-19 
gi|78368221|ref|ZP_00838465.1|  Acriflavin resistance protein ...  99.0    2e-19
gi|89358807|ref|ZP_01196629.1|  Acr family transport protein [...  99.0    3e-19
gi|114762906|ref|ZP_01442338.1|  transporter, AcrB/AcrD/AcrF f...  98.6    3e-19
gi|75677212|ref|YP_319633.1|  Acriflavin resistance protein [N...  98.6    3e-19 
gi|15965893|ref|NP_386246.1|  PUTATIVE TRANSPORT TRANSMEMBRANE...  98.6    3e-19 
gi|114797729|ref|YP_758944.1|  AcrB/AcrD/AcrF family protein [...  98.6    3e-19 
gi|83593429|ref|YP_427181.1|  Acriflavin resistance protein [R...  98.6    3e-19 
gi|77359515|ref|YP_339090.1|  multidrug resistance protein(Acr...  98.6    3e-19 
gi|85702820|ref|ZP_01033924.1|  hypothetical protein ROS217_18...  98.2    3e-19
gi|15966215|ref|NP_386568.1|  PUTATIVE TRANSPORT TRANSMEMBRANE...  98.2    4e-19 
gi|90418403|ref|ZP_01226315.1|  AcrB/AcrD/AcrF family protein ...  98.2    4e-19
gi|49474952|ref|YP_032993.1|  Acriflavin resistance protein d ...  98.2    4e-19 
gi|84500079|ref|ZP_00998345.1|  AcrB/AcrD/AcrF multidrug efflu...  98.2    4e-19
gi|19703809|ref|NP_603371.1|  Acriflavin resistance protein B ...  97.8    5e-19 
gi|114047202|ref|YP_737752.1|  acriflavin resistance protein [...  97.4    6e-19 
gi|27375467|ref|NP_766996.1|  Acr family transport protein [Br...  97.4    6e-19 
gi|67936907|ref|ZP_00529898.1|  Acriflavin resistance protein ...  97.4    6e-19
gi|83859337|ref|ZP_00952858.1|  RND family efflux transporter ...  97.4    7e-19
gi|92119069|ref|YP_578798.1|  acriflavin resistance protein [N...  97.4    7e-19 
gi|114046652|ref|YP_737202.1|  transporter, hydrophobe/amphiph...  97.4    7e-19 
gi|117919527|ref|YP_868719.1|  transporter, hydrophobe/amphiph...  97.4    7e-19 
gi|110639190|ref|YP_679399.1|  cation efflux protein [Cytophag...  97.1    8e-19 
gi|116253012|ref|YP_768850.1|  putative AcrB/AcrD/AcrF RND fam...  97.1    8e-19 
gi|116327707|ref|YP_797427.1|  Cation/multidrug efflux pump [L...  97.1    8e-19 
gi|86135144|ref|ZP_01053726.1|  RND family efflux transporter ...  97.1    8e-19
gi|113969418|ref|YP_733211.1|  transporter, hydrophobe/amphiph...  97.1    8e-19 
gi|88934794|ref|ZP_01140434.1|  outer membrane efflux protein ...  97.1    9e-19
gi|83855813|ref|ZP_00949342.1|  multidrug resistance protein, ...  97.1    1e-18
gi|83815443|ref|YP_444618.1|  multidrug efflux transporter, Ac...  96.7    1e-18 
gi|22298702|ref|NP_681949.1|  AcrB/AcrD/AcrF family protein [T...  96.7    1e-18 
gi|85703431|ref|ZP_01034535.1|  transporter, AcrB/AcrD/AcrF fa...  96.3    1e-18
gi|68547786|ref|ZP_00587315.1|  Acriflavin resistance protein ...  96.3    1e-18
gi|91217063|ref|ZP_01254025.1|  transporter, AcrB/D/F family p...  96.3    1e-18
gi|54298312|ref|YP_124681.1|  HelA protein [Legionella pneumop...  96.3    1e-18 
gi|77815523|ref|ZP_00814752.1|  Hydrophobe/amphiphile efflux-1...  96.3    1e-18
gi|52841242|ref|YP_095041.1|  cobalt/zinc/cadmium efflux RND t...  96.3    1e-18 
gi|114771860|ref|ZP_01449253.1|  transporter, AcrB/AcrD/AcrF f...  96.3    1e-18
gi|86148142|ref|ZP_01066441.1|  Cation/multidrug efflux pump [...  96.3    2e-18
gi|114772863|ref|ZP_01450175.1|  RND family efflux transporter...  96.3    2e-18
gi|83646482|ref|YP_434917.1|  Cation/multidrug efflux pump [Ha...  96.3    2e-18 
gi|91793547|ref|YP_563198.1|  acriflavin resistance protein [S...  96.3    2e-18 
gi|51473370|ref|YP_067127.1|  acriflavin resistance protein D ...  95.9    2e-18 
gi|92115354|ref|YP_575282.1|  Hydrophobe/amphiphile efflux-1 H...  95.9    2e-18 
gi|116217356|ref|ZP_01483160.1|  hypothetical protein VchoR_02000  95.9    2e-18
gi|114568818|ref|YP_755498.1|  acriflavin resistance protein [...  95.5    2e-18 
gi|27365042|ref|NP_760570.1|  Cation/multidrug efflux pump [Vi...  95.5    2e-18 
gi|56459711|ref|YP_154992.1|  RND family efflux transporter [I...  95.5    2e-18 
gi|71279757|ref|YP_267054.1|  AcrB/AcrD/AcrF family protein [C...  95.5    2e-18 
gi|113970672|ref|YP_734465.1|  acriflavin resistance protein [...  95.5    3e-18 
gi|114047901|ref|YP_738451.1|  acriflavin resistance protein [...  95.5    3e-18 
gi|117920106|ref|YP_869298.1|  acriflavin resistance protein [...  95.5    3e-18 
gi|77814717|ref|ZP_00813973.1|  Acriflavin resistance protein ...  95.5    3e-18
gi|84393808|ref|ZP_00992554.1|  Cation/multidrug efflux pump [...  95.5    3e-18
gi|83644314|ref|YP_432749.1|  Cation/multidrug efflux pump [Ha...  95.5    3e-18 
gi|15890354|ref|NP_356026.1|  hypothetical protein AGR_L_494 [...  95.1    3e-18 
gi|85711138|ref|ZP_01042198.1|  RND family efflux transporter ...  95.1    3e-18
gi|91975486|ref|YP_568145.1|  acriflavin resistance protein [R...  95.1    3e-18 
gi|110635660|ref|YP_675868.1|  acriflavin resistance protein [...  95.1    3e-18 
gi|94498083|ref|ZP_01304646.1|  acriflavin resistance protein ...  95.1    4e-18
gi|85711431|ref|ZP_01042490.1|  RND family efflux transporter ...  95.1    4e-18
gi|77816500|ref|ZP_00815683.1|  Acriflavin resistance protein ...  95.1    4e-18
gi|90419831|ref|ZP_01227740.1|  putative transporter, AcrB/Acr...  94.7    4e-18
gi|86748020|ref|YP_484516.1|  Acriflavin resistance protein [R...  94.7    5e-18 
gi|82744323|ref|ZP_00906894.1|  RND multidrug efflux transport...  94.4    5e-18
gi|82523768|emb|CAI78512.1|  heavy metal efflux pump [uncultured   94.4    5e-18
gi|88705754|ref|ZP_01103463.1|  AcrB/AcrD/AcrF family protein ...  94.4    6e-18
gi|86358415|ref|YP_470307.1|  probable acriflavin resistance (...  94.4    6e-18 
gi|83369818|ref|ZP_00914668.1|  AcrB/AcrD/AcrF multidrug efflu...  94.4    6e-18
gi|24374998|ref|NP_719041.1|  RND multidrug efflux transporter...  94.0    7e-18 
gi|117925192|ref|YP_865809.1|  acriflavin resistance protein [...  94.0    7e-18 
gi|110635129|ref|YP_675337.1|  acriflavin resistance protein [...  94.0    7e-18 
gi|24373447|ref|NP_717490.1|  AcrB/AcrD/AcrF family protein [S...  94.0    8e-18 
gi|52426142|ref|YP_089279.1|  AcrB protein [Mannheimia succini...  94.0    8e-18 
gi|54293987|ref|YP_126402.1|  HelA protein [Legionella pneumop...  94.0    8e-18 
gi|83592222|ref|YP_425974.1|  Hydrophobe/amphiphile efflux-1 H...  94.0    8e-18 
gi|84715605|ref|ZP_01022634.1|  probable transporter transmemb...  93.6    8e-18
gi|114800248|ref|YP_759542.1|  AcrB/AcrD/AcrF family protein [...  93.6    1e-17 
gi|114048725|ref|YP_739275.1|  acriflavin resistance protein [...  93.6    1e-17 
gi|83369072|ref|ZP_00913930.1|  putative transport transmembra...  93.2    1e-17
gi|91793094|ref|YP_562745.1|  acriflavin resistance protein [S...  93.2    1e-17 
gi|113950461|ref|ZP_01436086.1|  acriflavin resistance protein...  93.2    1e-17
gi|115522930|ref|YP_779841.1|  acriflavin resistance protein [...  93.2    1e-17 
gi|59710905|ref|YP_203681.1|  acriflavin resistance plasma mem...  93.2    1e-17 
gi|68543337|ref|ZP_00583046.1|  Hydrophobe/amphiphile efflux-1...  93.2    1e-17
gi|113948608|ref|ZP_01434266.1|  Hydrophobe/amphiphile efflux-...  93.2    1e-17
gi|86608203|ref|YP_476965.1|  transporter, hydrophobe/amphiphi...  93.2    1e-17 
gi|68543901|ref|ZP_00583586.1|  Acriflavin resistance protein ...  92.8    2e-17
gi|90021914|ref|YP_527741.1|  RND family efflux transporter [S...  92.8    2e-17 
gi|85710952|ref|ZP_01042013.1|  RND multidrug efflux transport...  92.8    2e-17
gi|88858259|ref|ZP_01132901.1|  AcrB/AcrD/AcrF family protein ...  92.8    2e-17
gi|84503435|ref|ZP_01001495.1|  transporter, AcrB/AcrD/AcrF fa...  92.8    2e-17
gi|30248183|ref|NP_840253.1|  probable transmembrane multidrug...  92.4    2e-17 
gi|76258647|ref|ZP_00766301.1|  Acriflavin resistance protein ...  92.4    2e-17
gi|114706397|ref|ZP_01439299.1|  Cation/multidrug efflux pump ...  92.4    2e-17
gi|113969132|ref|YP_732925.1|  acriflavin resistance protein [...  92.4    2e-17 
gi|27382130|ref|NP_773659.1|  AcrB/AcrD/AcrF family protein [B...  92.4    2e-17 
gi|93007223|ref|YP_581660.1|  acriflavin resistance protein [P...  92.4    2e-17 
gi|118037959|ref|ZP_01509364.1|  acriflavin resistance protein...  92.4    2e-17
gi|88758888|emb|CAJ77866.1|  Putative RND family drug transpor...  92.0    3e-17
gi|37522408|ref|NP_925785.1|  RND multidrug efflux transporter...  92.0    3e-17 
gi|86138479|ref|ZP_01057053.1|  transporter, AcrB/AcrD/AcrF fa...  92.0    3e-17
gi|83374238|ref|ZP_00919012.1|  putative transport transmembra...  91.7    3e-17
gi|92113636|ref|YP_573564.1|  acriflavin resistance protein [C...  91.7    4e-17 
gi|117921776|ref|YP_870968.1|  acriflavin resistance protein [...  91.7    4e-17 
gi|86358898|ref|YP_470790.1|  probable acriflavin resistance p...  91.7    4e-17 
gi|77463352|ref|YP_352856.1|  Cation/multidrug efflux pump, RN...  91.7    4e-17 
gi|84515859|ref|ZP_01003220.1|  AcrB/AcrD/AcrF family protein ...  91.7    4e-17
gi|94986215|ref|YP_605579.1|  acriflavin resistance protein [D...  91.7    4e-17 
gi|78223717|ref|YP_385464.1|  Acriflavin resistance protein [G...  91.7    4e-17 
gi|77686955|ref|ZP_00802263.1|  Acriflavin resistance protein ...  91.3    4e-17
gi|118047202|ref|ZP_01515842.1|  acriflavin resistance protein...  91.3    4e-17
gi|88795146|ref|ZP_01110847.1|  AcrB/AcrD/AcrF family protein ...  91.3    4e-17
gi|82740529|ref|ZP_00903268.1|  AcrB/AcrD/AcrF family protein ...  91.3    4e-17
gi|67939583|ref|ZP_00532079.1|  Acriflavin resistance protein ...  91.3    4e-17
gi|39937738|ref|NP_950014.1|  putative efflux transporter [Rho...  91.3    5e-17 
gi|77813087|ref|ZP_00812368.1|  Acriflavin resistance protein ...  91.3    5e-17
gi|88758826|emb|CAJ77856.1|  cation/multidrug efflux pump [Acinet  91.3    5e-17
gi|90422404|ref|YP_530774.1|  acriflavin resistance protein [R...  91.3    5e-17 
gi|117926467|ref|YP_867084.1|  acriflavin resistance protein [...  91.3    5e-17 
gi|88705778|ref|ZP_01103487.1|  acriflavin resistance plasma m...  91.3    5e-17
gi|71281775|ref|YP_271295.1|  AcrB/AcrD/AcrF family protein [C...  91.3    5e-17 
gi|117920149|ref|YP_869341.1|  acriflavin resistance protein [...  91.3    5e-17 
gi|115376308|ref|ZP_01463547.1|  RND transporter, Hydrophobe/A...  91.3    5e-17
gi|2498437|sp|Q48815|HELA_LEGPN  Protein helA >gi|1234832|gb|AAB0  90.9    6e-17
gi|24372532|ref|NP_716574.1|  AcrB/AcrD/AcrF family protein [S...  90.9    6e-17 
gi|78697699|ref|ZP_00862205.1|  AcrB/AcrD/AcrF family protein ...  90.9    7e-17
gi|86360100|ref|YP_471989.1|  probable efflux cation transport...  90.9    7e-17 
gi|56460784|ref|YP_156065.1|  RND family efflux transporter [I...  90.5    7e-17 
gi|71838440|ref|ZP_00678199.1|  Acriflavin resistance protein ...  90.5    7e-17
gi|88804989|ref|ZP_01120509.1|  RND family efflux transporter ...  90.5    7e-17
gi|88608540|ref|YP_506087.1|  transporter, AcrB/AcrD/AcrF fami...  90.5    8e-17 
gi|114772465|ref|ZP_01449838.1|  RND family efflux transporter...  90.5    8e-17
gi|87310277|ref|ZP_01092408.1|  putative multidrug resistance ...  90.5    9e-17
gi|91770702|ref|ZP_01272525.1|  Acriflavin resistance protein ...  90.5    9e-17
gi|118051719|ref|ZP_01520267.1|  heavy metal efflux pump, CzcA...  90.1    1e-16
gi|83646737|ref|YP_435172.1|  Cation/multidrug efflux pump [Ha...  90.1    1e-16 
gi|83594259|ref|YP_428011.1|  Acriflavin resistance protein [R...  90.1    1e-16 
gi|75908758|ref|YP_323054.1|  Acriflavin resistance protein [A...  90.1    1e-16 
gi|109900423|ref|YP_663678.1|  transporter, hydrophobe/amphiph...  90.1    1e-16 
gi|17987928|ref|NP_540562.1|  ACRIFLAVIN RESISTANCE PROTEIN B ...  90.1    1e-16 
gi|62289274|ref|YP_221067.1|  AcrB/AcrD/AcrF multidrug efflux ...  90.1    1e-16 
gi|23501184|ref|NP_697311.1|  AcrB/AcrD/AcrF multidrug efflux ...  90.1    1e-16 
gi|108763556|ref|YP_629244.1|  heavy metal efflux pump, CzcA f...  90.1    1e-16 
gi|88804300|ref|ZP_01119820.1|  AcrB/AcrD/AcrF family protein ...  90.1    1e-16
gi|17232786|ref|NP_489334.1|  hypothetical protein alr5294 [No...  89.7    1e-16 
gi|21244877|ref|NP_644459.1|  cation efflux system protein [Xa...  89.7    1e-16 
gi|89068269|ref|ZP_01155679.1|  transporter, AcrB/AcrD/AcrF fa...  89.7    1e-16
gi|71066637|ref|YP_265364.1|  RND superfamily multidrug efflux...  89.7    1e-16 
gi|94492114|ref|ZP_01299323.1|  hypothetical protein CburD_010...  89.7    1e-16
gi|88713430|ref|ZP_01107513.1|  RND family efflux transporter ...  89.7    1e-16
gi|53804016|ref|YP_114368.1|  AcrB/AcrD/AcrF family protein [M...  89.7    1e-16 
gi|89902862|ref|YP_525333.1|  acriflavin resistance protein [R...  89.7    1e-16 
gi|106891452|ref|ZP_01358638.1|  Acriflavin resistance protein...  89.7    1e-16
gi|15889340|ref|NP_355021.1|  hypothetical protein AGR_C_3721 ...  89.7    1e-16 
gi|29348095|ref|NP_811598.1|  putative cation efflux transport...  89.7    2e-16 
gi|83858616|ref|ZP_00952138.1|  putative acrB/acrD/acrF acrifl...  89.4    2e-16
gi|89211568|ref|ZP_01189926.1|  AcrB family membrane transport...  89.4    2e-16
gi|91762681|ref|ZP_01264646.1|  AcrB/AcrD/AcrF family protein ...  89.4    2e-16
gi|30249976|ref|NP_842046.1|  Acriflavin resistance protein [N...  89.4    2e-16 
gi|117579484|emb|CAL67953.1|  AcrB/AcrD/AcrF family membrane t...  89.4    2e-16
gi|83951074|ref|ZP_00959807.1|  RND family efflux transporter ...  89.4    2e-16
gi|84354647|ref|ZP_00979549.1|  COG0841: Cation/multidrug effl...  89.4    2e-16
gi|107026105|ref|YP_623616.1|  acriflavin resistance protein [...  89.4    2e-16 
gi|68545537|ref|ZP_00585087.1|  Acriflavin resistance protein ...  89.4    2e-16
gi|83855740|ref|ZP_00949269.1|  RND family efflux transporter ...  89.4    2e-16
gi|94968726|ref|YP_590774.1|  acriflavin resistance protein [A...  89.4    2e-16 
gi|113934795|ref|ZP_01420695.1|  Acriflavin resistance protein...  89.4    2e-16
gi|88796185|ref|ZP_01111865.1|  RND family efflux transporter ...  89.0    2e-16
gi|78356012|ref|YP_387461.1|  AcrB/AcrD/AcrF family protein [D...  89.0    2e-16 
gi|113947351|ref|ZP_01433017.1|  acriflavin resistance protein...  89.0    2e-16
gi|118062913|ref|ZP_01531257.1|  acriflavin resistance protein...  89.0    3e-16
gi|83814731|ref|YP_446090.1|  transporter, AcrB/D/F family [Sa...  89.0    3e-16 
gi|68541396|ref|ZP_00581140.1|  Acriflavin resistance protein ...  89.0    3e-16
gi|94499710|ref|ZP_01306247.1|  heavy metal efflux pump, CzcA ...  88.6    3e-16
gi|86131586|ref|ZP_01050184.1|  RND family efflux transporter ...  88.6    3e-16
gi|110597507|ref|ZP_01385793.1|  Acriflavin resistance protein...  88.6    3e-16
gi|45170565|gb|AAO18187.2|  putative resistance-nodulation cel...  88.6    3e-16
gi|86148110|ref|ZP_01066410.1|  hypothetical protein MED222_17...  88.6    3e-16
gi|113871466|ref|ZP_01411595.1|  probable multidrug-efflux sys...  88.6    3e-16
gi|27367691|ref|NP_763218.1|  Cation/multidrug efflux pump [Vi...  88.6    3e-16 
gi|37675816|ref|NP_936212.1|  hypothetical protein VVA0157 [Vi...  88.6    3e-16 
gi|91976784|ref|YP_569443.1|  Hydrophobe/amphiphile efflux-1 H...  88.6    3e-16 
gi|88860294|ref|ZP_01134932.1|  putative multidrug resistance ...  88.6    3e-16
gi|45658844|ref|YP_002930.1|  acriflavine resistance [Leptospi...  88.2    4e-16 
gi|118069455|ref|ZP_01537700.1|  transporter, hydrophobe/amphi...  88.2    4e-16
gi|24213250|ref|NP_710731.1|  NolG efflux transporter [Leptosp...  88.2    4e-16 
gi|55980698|ref|YP_143995.1|  probable efflux transporter, Acr...  88.2    4e-16 
gi|116626605|ref|YP_828761.1|  acriflavin resistance protein [...  88.2    4e-16 
gi|74317764|ref|YP_315504.1|  heavy metal efflux pump CzcA [Th...  88.2    4e-16 
gi|78356606|ref|YP_388055.1|  Cation/multidrug efflux pump-lik...  88.2    4e-16 
gi|90416904|ref|ZP_01224833.1|  RND family efflux transporter ...  88.2    5e-16
gi|83814320|ref|YP_445058.1|  multidrug resistance protein, pu...  88.2    5e-16 
gi|77462776|ref|YP_352280.1|  AcrB/AcrD/AcrF multidrug efflux ...  87.8    5e-16 
gi|89891808|ref|ZP_01203310.1|  AcrB, cation/multidrug efflux ...  87.8    5e-16
gi|88705197|ref|ZP_01102908.1|  AcrB/AcrD/AcrF family protein ...  87.8    5e-16
gi|113971732|ref|YP_735525.1|  acriflavin resistance protein [...  87.8    5e-16 
gi|114046060|ref|YP_736610.1|  acriflavin resistance protein [...  87.8    5e-16 
gi|86605153|ref|YP_473916.1|  transporter, hydrophobe/amphiphi...  87.8    5e-16 
gi|23130379|ref|ZP_00112196.1|  COG0841: Cation/multidrug effl...  87.8    5e-16
gi|83373852|ref|ZP_00918629.1|  AcrB/AcrD/AcrF multidrug efflu...  87.8    5e-16
gi|68542101|ref|ZP_00581837.1|  Acriflavin resistance protein ...  87.8    5e-16
gi|71082896|ref|YP_265615.1|  AcrB/AcrD/AcrF family protein (A...  87.8    5e-16 
gi|53715424|ref|YP_101416.1|  putative cation efflux transport...  87.8    6e-16 
gi|84517350|ref|ZP_01004704.1|  transporter, AcrB/AcrD/AcrF fa...  87.8    6e-16
gi|84393682|ref|ZP_00992432.1|  hypothetical protein V12B01_10...  87.8    6e-16
gi|113950651|ref|ZP_01436270.1|  acriflavin resistance protein...  87.8    6e-16
gi|118039488|ref|ZP_01510888.1|  acriflavin resistance protein...  87.8    6e-16
gi|34497431|ref|NP_901646.1|  NolG efflux transporter [Chromob...  87.8    6e-16 
gi|91781484|ref|YP_556690.1|  cation/multidrug efflux pump, Ac...  87.4    6e-16 
gi|118032149|ref|ZP_01503600.1|  transporter, hydrophobe/amphi...  87.4    6e-16
gi|46446267|ref|YP_007632.1|  putative acriflavin resistance p...  87.4    6e-16 
gi|114330990|ref|YP_747212.1|  acriflavin resistance protein [...  87.4    6e-16 
gi|114565136|ref|YP_752650.1|  transporter, hydrophobe/amphiph...  87.4    7e-16 
gi|118070996|ref|ZP_01539193.1|  acriflavin resistance protein...  87.4    7e-16
gi|90592234|ref|ZP_01247869.1|  Acriflavin resistance protein ...  87.4    7e-16
gi|108762117|ref|YP_635353.1|  efflux transporter, HAE1 family...  87.4    7e-16 
gi|86361014|ref|YP_472901.1|  probable efflux transporter prot...  87.4    7e-16 
gi|15606161|ref|NP_213538.1|  cation efflux (AcrB/AcrD/AcrF fa...  87.4    7e-16 
gi|103485965|ref|YP_615526.1|  acriflavin resistance protein [...  87.4    7e-16 
gi|21233458|ref|NP_639375.1|  cation efflux system protein [Xa...  87.0    8e-16 
gi|84352367|ref|ZP_00977331.1|  COG0841: Cation/multidrug effl...  87.0    8e-16
gi|116692839|ref|YP_838372.1|  transporter, hydrophobe/amphiph...  87.0    8e-16 
gi|116249361|ref|YP_765202.1|  putative ACR family transporter...  87.0    8e-16 
gi|91214625|ref|ZP_01251598.1|  putative AcrB/AcrD family RND ...  87.0    9e-16
gi|116329367|ref|YP_799087.1|  Efflux pump, AcrB family [Lepto...  87.0    1e-15 
gi|54298815|ref|YP_125184.1|  hypothetical protein lpp2880 [Le...  87.0    1e-15 
gi|15891155|ref|NP_356827.1|  hypothetical protein AGR_L_2075 ...  87.0    1e-15 
gi|32473162|ref|NP_866156.1|  cation efflux system protein czc...  87.0    1e-15 
gi|15805766|ref|NP_294463.1|  drug transport protein, putative...  86.7    1e-15 
gi|108759274|ref|YP_631858.1|  heavy metal efflux pump, CzcA f...  86.7    1e-15 
gi|85709723|ref|ZP_01040788.1|  hypothetical protein NAP1_1259...  86.7    1e-15
gi|78061855|ref|YP_371763.1|  Hydrophobe/amphiphile efflux pum...  86.7    1e-15 
gi|88711400|ref|ZP_01105488.1|  AcrB/AcrD/AcrF family protein ...  86.7    1e-15
gi|110638900|ref|YP_679109.1|  cation/multidrug efflux pump [C...  86.7    1e-15 
gi|50083998|ref|YP_045508.1|  nodulation protein precursor [Ac...  86.7    1e-15 
gi|73538164|ref|YP_298531.1|  Hydrophobe/amphiphile efflux-1 H...  86.3    1e-15 
gi|87311636|ref|ZP_01093753.1|  cation/multidrug efflux pump [...  86.3    1e-15
gi|116254728|ref|YP_770564.1|  putative ACR/RND family transme...  86.3    1e-15 
gi|85704670|ref|ZP_01035772.1|  hypothetical protein ROS217_06...  86.3    2e-15
gi|47575259|ref|ZP_00245294.1|  COG0841: Cation/multidrug effl...  86.3    2e-15
gi|78365730|ref|ZP_00836015.1|  Acriflavin resistance protein ...  86.3    2e-15
gi|84705225|ref|ZP_01018648.1|  AcrB/AcrD/AcrF family protein ...  86.3    2e-15
gi|83815598|ref|YP_444476.1|  cation/multidrug efflux pump [Sa...  86.3    2e-15 
gi|111614770|ref|ZP_01401843.1|  cation/multidrug efflux pump ...  85.9    2e-15
gi|117922008|ref|YP_871200.1|  acriflavin resistance protein [...  85.9    2e-15 
gi|91216859|ref|ZP_01253823.1|  RND family efflux transporter ...  85.9    2e-15
gi|83749744|ref|ZP_00946721.1|  Acriflavin resistance plasma m...  85.9    2e-15
gi|88796132|ref|ZP_01111814.1|  RND family efflux transporter ...  85.9    2e-15
gi|86130735|ref|ZP_01049334.1|  multidrug resistance protein, ...  85.9    2e-15
gi|95931049|ref|ZP_01313777.1|  acriflavin resistance protein ...  85.5    2e-15
gi|114777801|ref|ZP_01452732.1|  hypothetical protein SPV1_000...  85.5    2e-15
gi|115358461|ref|YP_775599.1|  acriflavin resistance protein [...  85.5    2e-15 
gi|109898548|ref|YP_661803.1|  acriflavin resistance protein [...  85.5    2e-15 
gi|117926528|ref|YP_867145.1|  acriflavin resistance protein [...  85.5    3e-15 
gi|46198685|ref|YP_004352.1|  acriflavin resistance protein B ...  85.5    3e-15 
gi|92113563|ref|YP_573491.1|  acriflavin resistance protein [C...  85.5    3e-15 
gi|77816305|ref|ZP_00815502.1|  Acriflavin resistance protein ...  85.5    3e-15
gi|82741646|ref|ZP_00904363.1|  conserved hypothetical transpo...  85.5    3e-15
gi|118567491|gb|ABL02296.1|  acriflavin resistance protein [Ca...  85.5    3e-15
gi|78049815|ref|YP_365990.1|  RND superfamily protein [Xanthom...  85.5    3e-15 
gi|116623244|ref|YP_825400.1|  acriflavin resistance protein [...  85.5    3e-15 
gi|114799636|ref|YP_760808.1|  transporter, hydrophobe/amphiph...  85.5    3e-15 
gi|37520445|ref|NP_923822.1|  probable multidrug efflux pump, ...  85.5    3e-15 
gi|86134744|ref|ZP_01053326.1|  multidrug resistance protein [...  85.5    3e-15
gi|91779246|ref|YP_554454.1|  hydrophobe/amphiphile efflux pum...  85.5    3e-15 
gi|23127247|ref|ZP_00109121.1|  COG0841: Cation/multidrug effl...  85.5    3e-15
gi|71908230|ref|YP_285817.1|  Heavy metal efflux pump CzcA [De...  85.1    3e-15 
gi|73537801|ref|YP_298168.1|  Heavy metal efflux pump CzcA [Ra...  85.1    3e-15 
gi|33152561|ref|NP_873914.1|  acriflavine resistance protein [...  85.1    3e-15 
gi|89891754|ref|ZP_01203257.1|  cation efflux system (AcrB/Acr...  85.1    4e-15
gi|116253465|ref|YP_769303.1|  putative RND family transmembra...  85.1    4e-15 
gi|89359320|ref|ZP_01197141.1|  Hydrophobe/amphiphile efflux-1...  84.7    4e-15
gi|84359563|ref|ZP_00984300.1|  COG0841: Cation/multidrug effl...  84.7    4e-15
gi|71281470|ref|YP_271267.1|  AcrB/AcrD/AcrF family protein [C...  84.7    4e-15 
gi|33599425|ref|NP_886985.1|  putative multidrug-efflux system...  84.7    4e-15 
gi|110594854|ref|ZP_01383195.1|  Acriflavin resistance protein...  84.7    4e-15
gi|118060340|ref|ZP_01528790.1|  transporter, hydrophobe/amphi...  84.7    4e-15
gi|114562613|ref|YP_750126.1|  acriflavin resistance protein [...  84.7    4e-15 
gi|89899193|ref|YP_521664.1|  acriflavin resistance protein [R...  84.7    4e-15 
gi|90023408|ref|YP_529235.1|  Co/Zn/Cd efflux system membrane ...  84.7    5e-15 
gi|83310974|ref|YP_421238.1|  Cation/multidrug efflux pump [Ma...  84.7    5e-15 
gi|70729926|ref|YP_259665.1|  AcrB/AcrD/AcrF family protein, p...  84.3    5e-15 
gi|83952353|ref|ZP_00961084.1|  transporter, AcrB/AcrD/AcrF fa...  84.3    5e-15
gi|19704610|ref|NP_604172.1|  Acriflavin resistance protein B ...  84.3    5e-15 
gi|17230635|ref|NP_487183.1|  RND multidrug efflux transporter...  84.3    5e-15 
gi|83649216|ref|YP_437651.1|  Cation/multidrug efflux pump [Ha...  84.3    6e-15 
gi|91788152|ref|YP_549104.1|  acriflavin resistance protein [P...  84.3    6e-15 
gi|71736728|ref|YP_274481.1|  multidrug efflux RND transporter...  84.3    6e-15 
gi|85375525|ref|YP_459587.1|  hypothetical protein ELI_13490 [...  84.3    6e-15 
gi|118037474|ref|ZP_01508880.1|  transporter, hydrophobe/amphi...  84.3    6e-15
gi|110679076|ref|YP_682083.1|  AcrB/AcrD/AcrF family protein, ...  84.3    6e-15 
gi|60681957|ref|YP_212101.1|  putative drug resistance transpo...  84.3    6e-15 
gi|94969580|ref|YP_591628.1|  acriflavin resistance protein [A...  84.0    7e-15 
gi|107025373|ref|YP_622884.1|  Hydrophobe/amphiphile efflux-1 ...  84.0    7e-15 
gi|110601961|ref|ZP_01390118.1|  Acriflavin resistance protein...  84.0    7e-15
gi|118071448|ref|ZP_01539643.1|  acriflavin resistance protein...  84.0    7e-15
gi|83859101|ref|ZP_00952622.1|  cobalt-zinc-cadmium resistance...  84.0    7e-15
gi|89095180|ref|ZP_01168104.1|  Acriflavin resistance protein ...  84.0    7e-15
gi|75910042|ref|YP_324338.1|  Hydrophobe/amphiphile efflux-1 H...  84.0    7e-15 
gi|77814503|ref|ZP_00813762.1|  Heavy metal efflux pump CzcA [...  84.0    7e-15
gi|86358946|ref|YP_470838.1|  multidrug-efflux system, acrifla...  84.0    8e-15 
gi|95930201|ref|ZP_01312939.1|  Heavy metal efflux pump CzcA [...  84.0    8e-15
gi|66046199|ref|YP_236040.1|  Hydrophobe/amphiphile efflux-1 H...  84.0    8e-15 
gi|82740379|ref|ZP_00903120.1|  Heavy metal efflux pump CzcA [...  84.0    8e-15
gi|91776901|ref|YP_546657.1|  Heavy metal efflux pump CzcA [Me...  84.0    8e-15 
gi|32265673|ref|NP_859705.1|  hypothetical protein HH0174 [Hel...  84.0    8e-15 
gi|84352992|ref|ZP_00977934.1|  COG0841: Cation/multidrug effl...  84.0    8e-15
gi|113947126|ref|ZP_01432792.1|  acriflavin resistance protein...  84.0    8e-15
gi|15889751|ref|NP_355432.1|  hypothetical protein AGR_C_4508 ...  84.0    8e-15 
gi|67542126|ref|ZP_00420063.1|  Hydrophobe/amphiphile efflux-1...  84.0    8e-15

>gi|78357424|ref|YP_388873.1|  acriflavin resistance protein D [Desulfovibrio desulfuricans 
G20]
 gi|78219829|gb|ABB39178.1|  acriflavin resistance protein D [Desulfovibrio desulfuricans 
G20]
Length=1092

 Score =  204 bits (518),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 167/286 (58%), Gaps = 1/286 (0%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P E+ER+++  QE  LK L GL  MES +  G+G ITL      N+  ++++VSN L
Sbjct  109  GATPYEVERDVLEEQEKALKGLTGLLVMESTASNGRGEITLRFAVGTNLDDAVLRVSNKL  168

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILKS-KNQKKDIFKYKNFVEENIKTQFERIKG  119
            D+V   P + DRP I +  +  SPI W +LK+  +  + +  Y+ F E+ ++   ER+KG
Sbjct  169  DEVPSYPDNVDRPVISATGASSSPIVWMVLKALPDNPRSVETYRTFFEDEVRQDLERVKG  228

Query  120  VGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLART  179
            V E  V GG  +E+ ++ID +R+A  GL++ ++   L+  NV+IS+G ++ G+R Y  RT
Sbjct  229  VAELMVYGGTEREMQVMIDPSRLAAHGLTINDLRRVLEAENVNISAGNLDVGRRAYRIRT  288

Query  180  TGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKESGA  239
             G  +S  ++E +VI+  G N IR+G +++++  Y      ++H G+  I   I  E GA
Sbjct  289  VGNFSSPDDIEQVVIQSTGQNRIRVGDVARVSFGYAKRTVSIQHNGDAGIVCGIKAEPGA  348

Query  240  NTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVR  285
            N ++V  +    +  LN+ ILKE GL+         YIN +I +V+
Sbjct  349  NVLDVTNDTEAVVNALNDGILKENGLFFEWSSDQRPYINGAIDLVK  394


>gi|110678662|ref|YP_681669.1|  acriflavin resistance protein D [Roseobacter denitrificans OCh 
114]
 gi|109454778|gb|ABG30983.1|  acriflavin  resistance protein D [Roseobacter denitrificans OCh 
114]
Length=1054

 Score =  199 bits (505),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 102/289 (35%), Positives = 178/289 (61%), Gaps = 5/289 (1%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P EIEREI+  QE+ L+ LEGL+ M S S  G+  ITLE     ++  S++ VSN L
Sbjct  53   GAAPSEIEREIVNPQEEALRGLEGLDIMTSRSRTGEAEITLEFGVGTDMVQSLLLVSNRL  112

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILKSKN-QKKDIFKYKNFVEENIKTQFERIKG  119
            D+V D P +A  PT+ +  ++ SPIAW +L ++    +++  Y +FVE+ I+ + ERI+G
Sbjct  113  DRVGDYPDEASEPTLDTSGADDSPIAWILLTAQEGNTREMATYGDFVEDVIQDRIERIEG  172

Query  120  VGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLART  179
            V    V GG ++E+ +V+D  R++   L++ E+   L++ N+ +S+G +EEGKR+Y+ R 
Sbjct  173  VSAVNVFGGVTRELQVVVDPRRLSRFDLTVPEVVRVLRDENISLSAGDVEEGKRRYVVRA  232

Query  180  TGETTSLKELEDLVIKKQ----GNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIK  235
             G   +++ ++ +V++      G+  +R+  ++ ++  +E++N  +R  GE  +A NI++
Sbjct  233  EGNLNTVEAIKSVVLRSDIGTGGSGRVRVADVADVSFSFEEANSRLRFRGEPGLAFNIVR  292

Query  236  ESGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVV  284
            E GAN IE   E+   + +L+   + E GL +   Y +T YIN +I +V
Sbjct  293  EPGANVIETMAEVKEVLAELSAGPVAEVGLNMRQAYDETVYINGAIDLV  341


>gi|91200521|emb|CAJ73570.1|  similar to acriflavine resistance protein F [Candidatus Kuenenia 
stuttgartiensis]
Length=1038

 Score =  190 bits (483),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 175/287 (60%), Gaps = 1/287 (0%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P  IEREII  QE  LK + GL  MES S +G G+ITL+   +  +  ++++VSN L
Sbjct  53   GATPYNIEREIIEEQEKVLKGIPGLVEMESESFDGMGSITLKFTIETRIDDALLRVSNKL  112

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILK-SKNQKKDIFKYKNFVEENIKTQFERIKG  119
            ++V + P + D+P I    S  SP+ W IL  +++  + I+ Y+ + E+ ++   +R+KG
Sbjct  113  NEVPEYPENVDKPIINPTGSAASPVIWIILHATEDNPRSIYSYRTYFEDEVRQYLDRVKG  172

Query  120  VGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLART  179
            V +  + GG  KE+HI+I+  ++A  G+++ E+ + L+  NV+ISSG +   +R Y  RT
Sbjct  173  VADLAIHGGTDKEMHIIINPQKMAAYGVTITELVSLLKAENVNISSGIMGIERRDYRIRT  232

Query  180  TGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKESGA  239
             GE  S KE+E+++IK  G   I L  ++K++  YE  + ++ H GE+AIA+ +  ESG 
Sbjct  233  IGEFNSAKEIENIIIKSDGQQRIVLSDLAKVSFGYEKLSNVMLHNGEEAIAIGVKPESGV  292

Query  240  NTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVRN  286
            N +E+   +   ++ LN   L EE +YL  VY    YIN +I +V+N
Sbjct  293  NVLELTNTIYEVVDWLNKEKLAEEKVYLKWVYDQRPYINGAIRLVKN  339


>gi|34556841|ref|NP_906656.1|  ACRIFLAVIN RESISTANCE PROTEIN D [Wolinella succinogenes DSM 1740]
 gi|34482556|emb|CAE09556.1|  ACRIFLAVIN RESISTANCE PROTEIN D [Wolinella succinogenes]
Length=1050

 Score =  181 bits (458),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 160/286 (55%), Gaps = 1/286 (0%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P E+EREII RQE  LK ++ L SMES S  G+  ITLE     +++ ++++VSN L
Sbjct  51   GATPYEMEREIIERQEKVLKGIDNLISMESRSRNGRADITLEFKIGTSLTEAMLKVSNKL  110

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILKS-KNQKKDIFKYKNFVEENIKTQFERIKG  119
            D+VK  P   D+P I +     SP+ W +LK+ K   + I +Y+ F  E++   FERI G
Sbjct  111  DEVKKYPDGIDKPIITATGESTSPVVWMVLKTQKENPRHINEYRTFFNESVIQYFERIDG  170

Query  120  VGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLART  179
            V E     G  +E+H+VID N++A   L+L ++ + L   N ++S+G ++ G+R Y  R+
Sbjct  171  VAEVFFPSGTDREMHVVIDHNKLASYQLTLQDLISVLDLENANVSAGTMDYGRRSYRVRS  230

Query  180  TGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKESGA  239
              E  S +++E  V+   G   +R+  +  +   Y      V H  E    + I    G 
Sbjct  231  VAEYKSPEQIEQTVVWSDGQRRVRIADLGYVKEGYARPTAYVEHNFESGAVVGIKPTPGT  290

Query  240  NTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVR  285
            N +E+  E+     +LN  +L +EGLYL  +Y   +YIN +IS+VR
Sbjct  291  NILELSDEVERVFFRLNEGVLAKEGLYLDWMYDQRSYINGAISLVR  336


>gi|95931214|ref|ZP_01313935.1|  acriflavin resistance protein [Desulfuromonas acetoxidans DSM 
684]
 gi|95132733|gb|EAT14411.1|  acriflavin resistance protein [Desulfuromonas acetoxidans DSM 
684]
Length=1034

 Score =  171 bits (433),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 96/286 (33%), Positives = 165/286 (57%), Gaps = 1/286 (0%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P +IE+EII  QED LK L+ L S+ES S    GTI+L      ++  ++++V+N L
Sbjct  53   GATPYDIEQEIIEDQEDALKGLQNLISLESSSYNNYGTISLVFKVGVDIDNALLRVANKL  112

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILKSKN-QKKDIFKYKNFVEENIKTQFERIKG  119
            D+V D P + D+P I++  +  SP+ W +LK+K   +  I +Y+ F +  ++   ERI G
Sbjct  113  DEVGDYPENVDKPIIEAAGANSSPVIWLLLKTKQGNETPIDQYRTFYDNEVEQHLERIDG  172

Query  120  VGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLART  179
            VG   V GG  KE+ +V+D  ++A   +++ ++ ++LQ +N + S+G +  GK+ Y  RT
Sbjct  173  VGSLFVGGGTEKELQVVVDREKMARHNITISQVTHSLQQANENTSAGNLSIGKKDYRIRT  232

Query  180  TGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKESGA  239
                 +  +  D+V+   G   + L  ++     +E   + V++ G+  I + I KE GA
Sbjct  233  VSRFQNETDPLDVVLVDDGIKRVYLRDVATTQEGFEKRTFAVQNNGKPCIVVGIRKEKGA  292

Query  240  NTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVR  285
            N I++ +    T+++LN  +L + GL    VY  T YIN +IS+V+
Sbjct  293  NVIDLVQRAHETIDELNAGLLADNGLTFDWVYDQTPYINTAISIVK  338


>gi|85712912|ref|ZP_01043953.1|  RND family efflux transporter [Idiomarina baltica OS145]
 gi|85693292|gb|EAQ31249.1|  RND family efflux transporter [Idiomarina baltica OS145]
Length=1030

 Score =  159 bits (403),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 84/287 (29%), Positives = 163/287 (56%), Gaps = 3/287 (1%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P++IE+EI+I QE+ L+++  L+ MES +  G+ TI L+     N++ ++I V+N L
Sbjct  51   GATPQDIEKEILIEQEEFLRTIPNLQRMESTASTGQATIELDFPYSVNIAETLILVNNAL  110

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWF---ILKSKNQKKDIFKYKNFVEENIKTQFERI  117
             QV + P + D P I + S   +   +F    ++   Q+ D+   ++++E+N++ +   +
Sbjct  111  TQVPNYPENVDEPKIFAASFSSNAFMYFRVAPIEGNPQQLDMIMMRDYIEDNVRPRMSSV  170

Query  118  KGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLA  177
             GV +  V GG  +++ I +D   +    +S+ ++   L+  N D S+G +E+GKR YL 
Sbjct  171  AGVSQVEVSGGAERQVRIQLDDAALVQHNVSVADVQRVLRARNQDTSAGDLEQGKRLYLL  230

Query  178  RTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKES  237
            RTTG   +L+++ D +I++ G   +RL  ++ I L + +            ++L + +ES
Sbjct  231  RTTGRYDALEDIGDTIIRRDGQQLLRLSDVASITLSHFELRSESWFKDNQVLSLQVQRES  290

Query  238  GANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVV  284
            G+N I+++  +L  +E++N  +L+  G+ +     D  Y+  SIS V
Sbjct  291  GSNVIDIKYAMLDEVERINQELLRPAGMEIILNSDDVRYVEQSISNV  337


>gi|92114523|ref|YP_574451.1|  acriflavin resistance protein [Chromohalobacter salexigens DSM 
3043]
 gi|91797613|gb|ABE59752.1|  acriflavin resistance protein [Chromohalobacter salexigens DSM 
3043]
Length=1051

 Score =  158 bits (400),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 91/288 (31%), Positives = 174/288 (60%), Gaps = 4/288 (1%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P++IE++I+I QE+ L+++  L+ MES +  G   I LE     +++ ++I+V+N L
Sbjct  51   GANPQDIEKDILIEQEEYLRNVPNLQRMESTASSGSAEIELEFPFGVDLTETLIRVNNAL  110

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFILKSKN---QKKDIFKYKNFVEENIKTQFERI  117
             QV   P + D+P I + S   +   +F +  +    ++ D+   ++++E+N++ + E +
Sbjct  111  SQVPSYPTNVDQPRIVANSFSANAFMYFNVGPREGNPRQLDMPAMRDYLEDNVRPRMESV  170

Query  118  KGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLA  177
             GV E  V GG  +++ +++D + +A   LS+ +I   L+  N D+S G +E GKR+YL 
Sbjct  171  SGVSEVSVSGGAERQMQLLLDPDALAARDLSISDIQAALEARNQDVSGGNLESGKRRYLL  230

Query  178  RTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEY-EDSNYIVRHLGEDAIALNIIKE  236
            RT G    +K LE L++++QG+  +RLG ++++   Y E ++      GE  +++ + +E
Sbjct  231  RTVGRFDDVKSLEALILRRQGDELVRLGDVAEVQQSYAELTSRSYNAAGEPVLSVQVRRE  290

Query  237  SGANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVV  284
             GAN I++++E+L  +E LN+ +L E+G+ +T    D  Y+  SI+ V
Sbjct  291  PGANVIDIKREMLEEVEALNDGLLAEQGMQITLSNDDVRYVEASIANV  338


>gi|56460403|ref|YP_155684.1|  RND family efflux transporter [Idiomarina loihiensis L2TR]
 gi|56179413|gb|AAV82135.1|  RND family efflux transporter [Idiomarina loihiensis L2TR]
Length=1041

 Score =  157 bits (398),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 81/287 (28%), Positives = 169/287 (58%), Gaps = 3/287 (1%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P++IE+EI+I QE+ L+++  L+ MES +  G+ +I L+     +V+ ++I V+N L
Sbjct  51   GATPQDIEKEILIEQEEFLRTVPNLQRMESSASNGEASIELDFPFGVDVTETLILVNNAL  110

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWF---ILKSKNQKKDIFKYKNFVEENIKTQFERI  117
             QV D P + D P I S S   +   +F    ++   +  ++   ++++E+N++ +   +
Sbjct  111  SQVPDYPENVDEPRIFSASFSSNAFMYFRVAPIEDNPKNINMIMMRDYIEDNVRPRMSSV  170

Query  118  KGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLA  177
             GV +  V GG  +++ I++D + +    +S+ ++  ++   N D S+G +E+GKR++L 
Sbjct  171  AGVSQVNVSGGAQRQVRILMDKDALIQYNVSVADVRTSISGRNRDTSAGELEQGKRRFLL  230

Query  178  RTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKES  237
            RT G   SL+E+E+ +I++ G++ +RL  ++ I   + + N      G+  ++L + +E 
Sbjct  231  RTVGRFDSLEEIENTIIRRTGDSLVRLKDVADIDFNHFELNSESWFKGQQVLSLQVQREL  290

Query  238  GANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVV  284
            G+N I+++  +L  +E++N  +L+  G+ +T    D  Y+ +S+  V
Sbjct  291  GSNVIDIKYAMLDEVERINEELLRPAGMEITLNSDDVRYVESSVQNV  337


>gi|113949340|ref|ZP_01434990.1|  acriflavin resistance protein [Shewanella baltica OS195]
 gi|113908320|gb|EAU26975.1|  acriflavin resistance protein [Shewanella baltica OS195]
Length=1059

 Score =  157 bits (397),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 84/287 (29%), Positives = 160/287 (55%), Gaps = 3/287 (1%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P+++E+EI++ QE  L++L  L+ M S +  G   I LE      +S ++I+VSN L
Sbjct  51   GATPQDVEKEILLEQERYLRTLPNLQRMTSWADTGSAWIELEFPQSTEISDALIRVSNAL  110

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFIL---KSKNQKKDIFKYKNFVEENIKTQFERI  117
             QV   P + D+P + S S   +   +F L          DI   ++F  + I+ Q ER+
Sbjct  111  SQVSSYPENVDQPRLYSSSYSDNAFMYFRLVPVAGNPLNLDIDMMRDFANDFIRPQMERV  170

Query  118  KGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLA  177
            KGV    ++GG  ++I I++D  ++A  G+S++++   +++ N D S+G I+ GK++YL 
Sbjct  171  KGVSSVTIQGGAERQIQILLDPAKLAQRGISIMDVRQAIRDRNKDTSAGDIDSGKKRYLL  230

Query  178  RTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKES  237
            R  G    L +L+ L++K+QGN  I L  +++I L++ +   +     E  ++L + ++ 
Sbjct  231  RVIGRFEDLNQLKQLILKRQGNTNILLQDVAEIKLDHAEIRELSFAEQERTLSLAVKRDV  290

Query  238  GANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVV  284
            G+N I ++  ++  + ++N + L +  + L     D  Y+ +S+  V
Sbjct  291  GSNVIAIKAAMMPVVAQINQNQLAQHAMQLELFSDDVRYVQDSVENV  337


>gi|68541076|ref|ZP_00580823.1|  Acriflavin resistance protein [Shewanella baltica OS155]
 gi|68521221|gb|EAN44716.1|  Acriflavin resistance protein [Shewanella baltica OS155]
Length=1059

 Score =  157 bits (397),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 83/287 (28%), Positives = 161/287 (56%), Gaps = 3/287 (1%)

Query  1    GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL  60
            GA+P+++E+EI++ QE  L++L  L+ M S +  G   + LE      +S ++I+VSN L
Sbjct  51   GATPQDVEKEILLEQERYLRTLPNLQRMTSWADTGSAWVELEFPQSTEISDALIRVSNAL  110

Query  61   DQVKDIPVDADRPTIKSVSSERSPIAWFIL---KSKNQKKDIFKYKNFVEENIKTQFERI  117
             QV   P + D+P + S S   +   +F L          DI   ++F  + I+ Q ER+
Sbjct  111  SQVSSYPENVDQPRLYSSSYSDNAFMYFRLVPVAGNPLNLDIDMMRDFANDFIRPQMERV  170

Query  118  KGVGESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLA  177
            KGV    ++GG  ++I I++D  ++A  G+S++++   +++ N D S+G I+ GK++YL 
Sbjct  171  KGVSSVTIQGGAERQIQILLDPAKLAQRGISIMDVRQAIRDRNKDTSAGDIDSGKKRYLL  230

Query  178  RTTGETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKES  237
            R  G    L +L+ L++K+QGN  I L  +++I L++ +   +     E  ++L + ++ 
Sbjct  231  RVIGRFEDLNQLKQLILKRQGNTNILLQDVAEIKLDHAEIRELSFAEQERTLSLAVKRDV  290

Query  238  GANTIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVV  284
            G+N I ++  ++  + ++N + L +  + L     D  Y+ +S++ V
Sbjct  291  GSNVIAIKAAMMPVVAQINQNQLAQHAMQLELFSDDVRYVQDSVANV  337

ORF finding

sms;anycodon; sens direct; code universel

>ORF number 1 in reading frame 1 on the direct strand extends from base 118 to base 225.
TTCTTTTTGAACTTCAATAGTATTTGCACCCGACTCTTTAATTATATTAAGTGCTATTGC
ATCTTCACCAAGATGTCTCACTATATAATTAGAATCCTCATACTCTAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
FFLNFNSICTRLFNYIKCYCIFTKMSHYIIRILIL*

>ORF number 2 in reading frame 1 on the direct strand extends from base 493 to base 585.
TTCACCAACACCTTTTATTCTCTCAAACTGGGTTTTAATATTCTCCTCTACAAAGTTCTT
ATATTTGAAAATATCTTTTTTTTGATTTTTTGA

>Translation of ORF number 2 in reading frame 1 on the direct strand.
FTNTFYSLKLGFNILLYKVLIFENIFFLIF*

>ORF number 1 in reading frame 2 on the direct strand extends from base 245 to base 391.
CCAAGTCTTATAAAATTATTTCCCTGTTTTTTTATTACTAAATCTTCCAGTTCTTTCAAA
GAAGTCGTTTCACCTGTTGTTCTTGCTAAATATTTTCTCTTACCTTCTTCAATAAAACCG
GAACTAATATCAACATTACTATTTTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
PSLIKLFPCFFITKSSSSFKEVVSPVVLAKYFLLPSSIKPELISTLLF*

>ORF number 2 in reading frame 2 on the direct strand extends from base 461 to base 577.
ATTTCTTTAGATCTTCCACCTCTTACACCTGATTCACCAACACCTTTTATTCTCTCAAAC
TGGGTTTTAATATTCTCCTCTACAAAGTTCTTATATTTGAAAATATCTTTTTTTTGA

>Translation of ORF number 2 in reading frame 2 on the direct strand.
ISLDLPPLTPDSPTPFILSNWVLIFSSTKFLYLKISFF*

>ORF number 3 in reading frame 2 on the direct strand extends from base 578 to base 676.
TTTTTTGATTTTAATATGAACCATGCAATCGGGGATCTCTCTGATGAAACAGATTTAATC
GTGGGTCGGTCAGCATCAACAGGTATATCTTTCACTTGA

>Translation of ORF number 3 in reading frame 2 on the direct strand.
FFDFNMNHAIGDLSDETDLIVGRSASTGISFT*

>ORF number 4 in reading frame 2 on the direct strand extends from base 677 to base 859.
TCTAATAGATTGGAAACTTGTATGATCGATGTTGAGACATTTTGCTTTGGATTAAGTTCT
AATGTGATGGTTCCTTTACCTTCAATTGAGACACTCTCCATCGATTCTAAGCCCTCTAAT
GATTTTAATTTATCTTCTTGTCTTATGATTATTTCTCTTTCGATTTCCTCAGGACTTGCA
CCT

>Translation of ORF number 4 in reading frame 2 on the direct strand.
SNRLETCMIDVETFCFGLSSNVMVPLPSIETLSIDSKPSNDFNLSSCLMIISLSISSGLA
P

>ORF number 1 in reading frame 3 on the direct strand extends from base 258 to base 359.
AATTATTTCCCTGTTTTTTTATTACTAAATCTTCCAGTTCTTTCAAAGAAGTCGTTTCAC
CTGTTGTTCTTGCTAAATATTTTCTCTTACCTTCTTCAATAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
NYFPVFLLLNLPVLSKKSFHLLFLLNIFSYLLQ*

>ORF number 2 in reading frame 3 on the direct strand extends from base 372 to base 470.
TATCAACATTACTATTTTGAAGAGTATTCGCGATTTCAATTAGGCTTAATCCTGCGAGAG
CAATCCGGTTTGTATCAATTACGATATGAATTTCTTTAG

>Translation of ORF number 2 in reading frame 3 on the direct strand.
YQHYYFEEYSRFQLGLILREQSGLYQLRYEFL*


sms; anycodon; reverse sens; code universel

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 731 to base 838.
AGTTCAAAAAGAACTATTAATCACAATGGAAAAACTCAACAATTCTATTTTAAAAGAGGA
AGGCCTTTATTTAACCAATGTTTATACAGATACTACATACATAAATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
SSKRTINHNGKTQQFYFKRGRPLFNQCLYRYYIHK*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 860.
GGTGCAAGTCCTGAGGAAATCGAAAGAGAAATAATCATAAGACAAGAAGATAAATTAAAA
TCATTAGAGGGCTTAGAATCGATGGAGAGTGTCTCAATTGAAGGTAAAGGAACCATCACA
TTAGAACTTAATCCAAAGCAAAATGTCTCAACATCGATCATACAAGTTTCCAATCTATTA
GATCAAGTGAAAGATATACCTGTTGATGCTGACCGACCCACGATTAAATCTGTTTCATCA
GAGAGATCCCCGATTGCATGGTTCATATTAAAATCAAAAAATCAAAAAAAAGATATTTTC
AAATATAAGAACTTTGTAGAGGAGAATATTAAAACCCAGTTTGAGAGAATAAAAGGTGTT
GGTGAATCAGGTGTAAGAGGTGGAAGATCTAAAGAAATTCATATCGTAATTGATACAAAC
CGGATTGCTCTCGCAGGATTAAGCCTAATTGAAATCGCGAATACTCTTCAAAATAGTAAT
GTTGATATTAGTTCCGGTTTTATTGAAGAAGGTAAGAGAAAATATTTAGCAAGAACAACA
GGTGAAACGACTTCTTTGAAAGAACTGGAAGATTTAGTAATAAAAAAACAGGGAAATAAT
TTTATAAGACTTGGTCAAATAAGCAAAATTGCCTTAGAGTATGAGGATTCTAATTATATA
GTGAGACATCTTGGTGAAGATGCAATAGCACTTAATATAATTAAAGAGTCGGGTGCAAAT
ACTATTGAAGTTCAAAAAGAACTATTAATCACAATGGAAAAACTCAACAATTCTATTTTA
AAAGAGGAAGGCCTTTATTTAACCAATGTTTATACAGATACTACATACATAAATAATTCG
ATATCAGTTGTCAGAAAC

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
GASPEEIEREIIIRQEDKLKSLEGLESMESVSIEGKGTITLELNPKQNVSTSIIQVSNLL
DQVKDIPVDADRPTIKSVSSERSPIAWFILKSKNQKKDIFKYKNFVEENIKTQFERIKGV
GESGVRGGRSKEIHIVIDTNRIALAGLSLIEIANTLQNSNVDISSGFIEEGKRKYLARTT
GETTSLKELEDLVIKKQGNNFIRLGQISKIALEYEDSNYIVRHLGEDAIALNIIKESGAN
TIEVQKELLITMEKLNNSILKEEGLYLTNVYTDTTYINNSISVVRN
Personal tools