ORF LO16880

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160052.1
Annotathon code: ORF_LO16880
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : eliju
Annotated on : 2008-03-19 18:52:37
  • ARBEILLE elise
  • MORERE julia

Synopsis

Genomic Sequence

>AACY01160052.1 ORF_LO16880 genomic DNA
TGCACACGCGCTCTCAATAGCTGGATAGCATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTCTGTCTTCTGCGGCACTGGAA
TGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGACAGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTG
CAGCCGGGCCATGACCAGCTGGCAACAGAACGCGGGCGTCAACAGCACCCAGCAAAAGATCTCGGCCGTGCTTGTCTCGTTTTCGCCGGACGGCCGCAAG
GCACGCCGCGCTCTCAACAGTTGGCTGAGCCTCAAGAGGCAACGTTCCGGCGTCGTGCGTGCAGTGACGGCTTGGACACGTTGGAGCGAGCGCCGCAGCT
TCAACGCGTGGACCGCGAGCATTGCGGCCCGTGCGCTTGCGCGCCTGGCGATGAAGCGCGGGGCCGTCTCGCTCTTCCACTACGGCCGCGAGACCCGCCG
GGCGCTCAATTCGTGGGTCGAGATGGCGCAGGAATGGTCGCTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTCTTCCCGAAGGGTCGGGCGAAG
CGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCTGAATGCCGTGACGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAG
CCCTCAACTCGTGGGCAGTCTTCTTGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCATCACGGCGAGCGTGCGGGTTTCAACGCGTG
GATCGCTGCCGCTAAGGAGCACGCGGGCGTGCAGCGGAAGATGCAGCGGGCGCTGAGTGTGC

Translation

[1 - 861/862]   direct strand


Phylogeny


Annotator commentaries

A partir de la sequence attribuée, nous avons d'abord effectué une recherche d'ORFs à l'aide de l'ORF finder de SMS. Le résultat a été de 8 ORFs, 4 dans le sens du brin direct ( dont le premier et le dernier possedent un nombre tres supêrieur à 60 codons), et 4 dans le sens du brin indirect (dont le 2eme et le 4eme possedent un nombre de codons supérieur à 60).

Notre choix s'est porté sur le premier ORF du sens direct s'étendant de la base 1 à la base 861, soit la presque integralité de la sequence genomique donnée (862 pdb). Nous avons donc réalisé un blastp vs nr à partir de la translation de cet ORF: seulement 10 blast hits ont été trouvés, tous ayant un score <40 et une E value > 0.27, ce qui signifie que peu de séquences similaires connues ont été trouvées et que cette similarité a de grande probabilités d'etre dues au hasard. (le seuil de E value devant etre < à environ 10-10 pour que cela ne soit pas du au hasard). Les alignements 2 à 2 ont confirmé peu d'acides aminés semblables entre les sequences. Ces résultats semblent donc montrer que cet Orf ne correspond pas à une sequence codante, ou correspond à une sequence codant pour une proteine encore inconnue car il n'a pas d'homologues connus et répertoriés.

Nous avons renouvellé ce blastp vs nr avec un 2eme ORF correspondant au cadre de lecture 3 dans le sens direct (base 21 à 749): aucun résultat n'a été trouvé.

En nous interessant au blastp vs nr d'un 3eme ORF (ORF2 du cadre de lecture 2 du sens indirect de la base 311 à 808) nous avons eu 15 hits ayant des propriétés de score et de E value semblables à celles du premier ORF étudié (score < à 33.5 et E value > à 3.0 ).

L'étude d'un 4eme ORF (ORF 2 du cadre de lecture 3 de la base 384 à 860) n'a révélé aucun résultats.

Nous concluons donc, d'apres l'etude de ces 4 ORf, que la sequence d'ADN génomique attribuée correspond à une sequence non codante ou à une sequence codant pour une proteine inconnue. Ces deux hypothèses expliqueraient pourquoi il n'est pas répertorié de séquences homologues, et donc les raisons pour lesquelles nous ne pouvons fournir aucun renseignement sur un domaine proteique et une fonction eventuels, ou encore sur une phylogenie.

A noter que nous avons effectué également un blastx de l'ADN genomique etudié, et ce, dans le but de vérifier les resultats du blastp, car il compare directement la sequence nucléotidique d'ADN génomique à différentes banques. Cela à confirmé notre conclusion car 59 hits ont été trouvés mais le score maximal est de 38.5 bits pour une E value de 0.41, ce qui n'est pas significatif.

Multiple Alignement


BLAST

blastp vs nr de "Translation of ORF number 1 in reading frame 1 on the direct strand":

                                                                    score    E
Sequences producing significant alignments:                        (Bits)  Value

gi|110751273|ref|XP_392215.3|  PREDICTED: similar to CG30069-PA [  38.9    0.27   Gene info
gi|67516265|ref|XP_658018.1|  hypothetical protein AN0414.2 [A...  36.6    1.3    Gene info
gi|28868897|ref|NP_791516.1|  sensor histidine kinase/response...  35.4    2.9    Gene info
gi|71734710|ref|YP_275861.1|  response regulator, sensor histi...  35.0    3.8    Gene info
gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococc  35.0    4.6  
gi|66046927|ref|YP_236768.1|  Response regulator receiver:ATP-...  34.7    5.7    Gene info
gi|1346440|sp|P48027|GACS_PSESY  Sensor protein gacS >gi|15132...  34.7    5.7  
gi|281611|pir||B41863  two-component regulatory protein lemA - Ps  34.7    6.0  
gi|81252692|ref|ZP_00877271.1|  COG3321: Polyketide synthase m...  33.9    9.9  
gi|76782427|ref|ZP_00769632.1|  COG3321: Polyketide synthase m...  33.9    9.9  


alignement 2 à 2 correspondant:

>gi|110751273|ref|XP_392215.3| Gene info PREDICTED: similar to CG30069-PA [Apis mellifera]
Length=4664

 Score = 38.9 bits (89),  Expect = 0.27, Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 92/230 (40%), Gaps = 34/230 (14%)

Query  18    QLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAM------  71
             + RR    L V  G  M    ++  A       L    R VVGR  H+  S A+      
Sbjct  4247  ETRRHEDNLKVSTGHAMESKTTTRDAFSPKKEDLGGGRREVVGRKHHMESSIALGDDLVS  4306

Query  72    --TSWQQNAGV--NSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAVTAWTR  127
               T+ Q+N       T ++++A +     DG  +RR++ S  +++   + VV+  T+  R
Sbjct  4307  STTTSQRNYNTFTKRTAKEVAAKMSGMELDGSASRRSVES-RTVENGTTSVVKRTTSSQR  4365

Query  128   --WSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRL  185
                +E R              A ++++ GAV      R+ +R          E++++Q+ 
Sbjct  4366  VITTEHRD-------------ASISIEGGAVESSKCSRDHQRHERDSSRGGAEYNVEQKH  4412

Query  186   LQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKAL  235
              +        +  +KR  VN+    S+QR E      S  A     R+A+
Sbjct  4413  HR--------QETSKRDYVNAQHAESRQRQETSRCYNSSQASSAEFRQAI  4454


>gi|67516265|ref|XP_658018.1| Gene info hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
 gi|40747357|gb|EAA66513.1| Gene info hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
Length=981

 Score = 36.6 bits (83),  Expect = 1.3, Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query  17   LQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQ  76
            L+ RRLR+ L      GM+R F         S  LRA L +V GRI+ LA + A ++ + 
Sbjct  457  LKERRLRQDL------GMKRKFIDIWVQTYDSNALRAALEAVTGRIIPLAKANASSTHKS  510

Query  77   NAGVNSTQQKISAVLVSF  94
              G +  ++ ++  L  F
Sbjct  511  ANGASPHEKALTKKLAKF  528


>gi|28868897|ref|NP_791516.1| Gene info sensor histidine kinase/response regulator GacS [Pseudomonas 
syringae pv. tomato str. DC3000]
 gi|28852136|gb|AAO55211.1| Gene info sensor histidine kinase/response regulator GacS [Pseudomonas 
syringae pv. tomato str. DC3000]
Length=917

 Score = 35.4 bits (80),  Expect = 2.9, Method: Composition-based stats.
 Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 20/156 (12%)

Query  20   RRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRA-CLRS------VVGRILHLACSRAMT  72
            R+L+K LS        RA  + +A   SSR  R  C+        +V  +L    +  M 
Sbjct  639  RKLQKALSELIAP---RAIRADIAPPLSSRAPRVLCVDDNPANLLLVQTLLEDMGAEVMA  695

Query  73   SWQQNAGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRW  128
                 A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    
Sbjct  696  VEGGYAAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERGQSSLPIVALTAHAMA  755

Query  129  SERRSF------NAWTASIAARALARLAMKRGAVSL  158
            +E+RS       +  T  I+ R LA++ +K   ++L
Sbjct  756  NEKRSLLQSGMDDYLTKPISERQLAQVVLKWSGLAL  791


>gi|71734710|ref|YP_275861.1| Gene info response regulator, sensor histidine kinase component GacS [Pseudomonas 
syringae pv. phaseolicola 1448A]
 gi|71555263|gb|AAZ34474.1| Gene info response regulator, sensor histidine kinase component GacS [Pseudomonas 
syringae pv. phaseolicola 1448A]
Length=917

 Score = 35.0 bits (79),  Expect = 3.8, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  78   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  133
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  701  AAVNAVQQEAFDLVLMDMQMPGMDGRQATEAIRTWEAERNQSSLPIVALTAHAMANEKRS  760

Query  134  F------NAWTASIAARALARLAMKRGAVSL  158
                   +  T  I+ R LA++ +K   ++L
Sbjct  761  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  791


>gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococcus tauri]
Length=340

 Score = 35.0 bits (79),  Expect = 4.6, Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 82/208 (39%), Gaps = 32/208 (15%)

Query  3    RALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRI  62
            R+ N W  Y      +   L K  S    T +  AF+ W      S   +  LR +V R+
Sbjct  132  RSWNKWGEYVVNEKRRNNVLGKVYSRIRNTELANAFTRWREFAEESYDAKMQLRKIVSRM  191

Query  63   LHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAV  122
            L L  S+A+  W++N  + S +Q                 RAL + ++ + +   V +  
Sbjct  192  LRLRLSQALGRWRENT-IESQRQ-----------------RALLARVATRIRNRCVAQCF  233

Query  123  TAWTRWSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQEWSLK  182
             AW          A  ++   R +  L ++    +L       R A   W  + +E  + 
Sbjct  234  NAWCDTVNDNKIEAQASAYRQRLVNNLCLRINRATL-------REAFKKWWRVVEEREMH  286

Query  183  QRLLQRGLTTLFPKGRAKRRAVNSWLLW  210
            + ++++ L       RAKR A+N ++ W
Sbjct  287  REMIRKVL-------RAKRVAMNFFMTW  307


>gi|66046927|ref|YP_236768.1| Gene info Response regulator receiver:ATP-binding region, ATPase-like:Histidine 
kinase, HAMP region:Histidine kinase A, N-terminal:Hpt 
[Pseudomonas syringae pv. syringae B728a]
 gi|63257634|gb|AAY38730.1| Gene info Response regulator receiver:ATP-binding region, ATPase-like:Histidine 
kinase, HAMP region:Histidine kinase A, N-terminal:Hpt 
[Pseudomonas syringae pv. syringae B728a]
Length=917

 Score = 34.7 bits (78),  Expect = 5.7, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  78   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  133
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  701  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  760

Query  134  F------NAWTASIAARALARLAMKRGAVSL  158
                   +  T  I+ R LA++ +K   ++L
Sbjct  761  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  791


>gi|1346440|sp|P48027|GACS_PSESY  Sensor protein gacS
 gi|151329|gb|AAA25877.1|  regulatory protein
Length=907

 Score = 34.7 bits (78),  Expect = 5.7, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  78   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  133
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  691  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  750

Query  134  F------NAWTASIAARALARLAMKRGAVSL  158
                   +  T  I+ R LA++ +K   ++L
Sbjct  751  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  781


>gi|281611|pir||B41863  two-component regulatory protein lemA - Pseudomonas syringae
Length=929

 Score = 34.7 bits (78),  Expect = 6.0, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  78   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  133
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  713  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  772

Query  134  F------NAWTASIAARALARLAMKRGAVSL  158
                   +  T  I+ R LA++ +K   ++L
Sbjct  773  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  803


>gi|81252692|ref|ZP_00877271.1|  COG3321: Polyketide synthase modules and related proteins [Mycobacterium 
tuberculosis C]
Length=2095

 Score = 33.9 bits (76),  Expect = 9.9, Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query  88    SAVLVSFSPDGRKARRALNSWL---SLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAAR  144
             SA  ++ SP G+ A  A NSWL   +  RQ  G+     AW  WS+      W+AS  AR
Sbjct  1875  SAAALTGSP-GQSAYSAANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSAS-PAR  1932

Query  145   ALA  147
             A A
Sbjct  1933  ASA  1935


>gi|76782427|ref|ZP_00769632.1|  COG3321: Polyketide synthase modules and related proteins [Mycobacterium 
tuberculosis F11]
Length=2095

 Score = 33.9 bits (76),  Expect = 9.9, Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query  88    SAVLVSFSPDGRKARRALNSWL---SLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAAR  144
             SA  ++ SP G+ A  A NSWL   +  RQ  G+     AW  WS+      W+AS  AR
Sbjct  1875  SAAALTGSP-GQSAYSAANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSAS-PAR  1932

Query  145   ALA  147
             A A
Sbjct  1933  ASA  1935






 blastp vs nr de "Translation of ORF number 1 in reading frame 3 on the direct strand":


Query=  Translation of ORF number 1 in reading frame 3 on the 



No significant similarity found.




blastp vs nr de "Translation of ORF number 2 in reading frame 2 on the reverse strand":
                                                                   score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|90407275|ref|ZP_01215461.1|  putative galactoside ABC trans...  33.5    3.0  
gi|9837589|gb|AAG00614.1|AF293849_1  beta-glucosidase [Secale cer  33.5    3.3  
gi|89339746|ref|ZP_01192344.1|  Enoyl-CoA hydratase/isomerase ...  33.5    3.5  
gi|54644901|gb|EAL33641.1|  GA11470-PA [Drosophila pseudoobscura]  33.5    3.8  
gi|73956822|ref|XP_850317.1|  PREDICTED: similar to Period cir...  33.1    4.2    UniGene infoGene info
gi|46156321|ref|ZP_00133014.2|  COG1879: ABC-type sugar transp...  33.1    4.2  
gi|90203202|ref|ZP_01205848.1|  Enoyl-CoA hydratase/isomerase ...  33.1    4.6  
gi|15641337|ref|NP_230969.1|  galactoside ABC transporter, per...  33.1    5.0    Gene info
gi|116216023|ref|ZP_01481923.1|  hypothetical protein VchoR_02002  33.1    5.0  
gi|75816940|ref|ZP_00747397.1|  COG1879: ABC-type sugar transp...  33.1    5.0  
gi|116130892|gb|EAA06516.4|  ENSANGP00000004748 [Anopheles gambia  32.7    5.5  
gi|15602903|ref|NP_245975.1|  MglB [Pasteurella multocida subs...  32.7    6.2    Gene info
gi|118067950|ref|ZP_01536204.1|  periplasmic binding protein/L...  32.7    6.2  
gi|25294130|gb|AAN74809.1|  Wdr1p [Gibberella moniliformis]        32.0    9.1  
gi|26419739|gb|AAN78225.1|  class 4 metalloprotease [Chromobacter  32.0    9.7  

alignement 2 à 2 correspondant: 

>gi|90407275|ref|ZP_01215461.1|  putative galactoside ABC transporter, periplasmicD-galactose/D-glucose-binding 
protein [Psychromonas sp. CNPT3]
 gi|90311558|gb|EAS39657.1|  putative galactoside ABC transporter, periplasmicD-galactose/D-glucose-binding 
protein [Psychromonas sp. CNPT3]
Length=326

 Score = 33.5 bits (75),  Expect = 3.0, Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 0/35 (0%)

Query  115  GPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  149
            G  AG V + ADN A+A  +L+R  A  +PA EGT
Sbjct  269  GQMAGTVLNDADNQAKATFELARNLAKGRPATEGT  303


>gi|9837589|gb|AAG00614.1|AF293849_1  beta-glucosidase [Secale cereale]
Length=568

 Score = 33.5 bits (75),  Expect = 3.3, Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query  31   PALHRQARKRTGRNARGPRVEAAALAPTCPSRHC--THDAGTLPLEAQPTVESAACLAAV  88
            P  H   R R GRN+    + +AA + T   R C  T  AGT    ++P       L   
Sbjct  11   PTTHLSLRSRAGRNSENVWLRSAASSQTSKGRFCNLTVRAGTPSKPSEPIGPVFTKLKPW  70

Query  89   R-RKRDKHGRDLLLGA  103
            +  KRD   +D L GA
Sbjct  71   QIPKRDWFSKDFLFGA  86


>gi|89339746|ref|ZP_01192344.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium flavescens PYR-GCK]
 gi|89320236|gb|EAS11726.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium flavescens PYR-GCK]
Length=254

 Score = 33.5 bits (75),  Expect = 3.5, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query  87   AVRRKRDKHGRDLLLGAVDARV-LLPAGHGPAAG  119
            A+R+K  KHGRDL++G V  R+ ++ A +GPA G
Sbjct  80   ALRQKTIKHGRDLVIGMVRCRIPVIAAVNGPAVG  113


>gi|54644901|gb|EAL33641.1|  GA11470-PA [Drosophila pseudoobscura]
Length=652

 Score = 33.5 bits (75),  Expect = 3.8, Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 44/112 (39%), Gaps = 16/112 (14%)

Query  62   RHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGR-DLLLGAVDARVLLPAGHGPAAGE  120
            RHC H+   L +E    V     +A VR   D++ R   L G VD R +L          
Sbjct  79   RHCLHNYAYLDIEVLVNVGELLAIAGVRLAADENYRAGSLPGVVDCRPVLAVVLRAVTSA  138

Query  121  VQDAADNAAQAR---------------SQLSRGRAHRQPAAEGTAHSSAAED  157
            ++D   + A+AR                + +  R  RQ   + +  SS+ ED
Sbjct  139  IRDHRFDGAEARESRIAEQTKPMGSEVQKKTMTREERQRIVDTSNSSSSGED  190


>gi|73956822|ref|XP_850317.1| UniGene infoGene info PREDICTED: similar to Period circadian protein 3 (hPER3) [Canis 
familiaris]
Length=1128

 Score = 33.1 bits (74),  Expect = 4.2, Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 41/98 (41%), Gaps = 12/98 (12%)

Query  36   QARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKH  95
            +A   + R + GPR EAA  APT   R C        L  Q  +ESAA      R  DKH
Sbjct  448  RASLASSRESGGPRGEAARRAPTALQRVCASVNKMKKLGGQLHIESAAA-----RSPDKH  502

Query  96   GRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARS  133
                 +G   AR   P G   A+  +Q   +N+    S
Sbjct  503  A----MGTHPAR---PGGEQKASSPLQTLKNNSVHMES  533


>gi|46156321|ref|ZP_00133014.2|  COG1879: ABC-type sugar transport system, periplasmic component 
[Haemophilus somnus 2336]
Length=328

 Score = 33.1 bits (74),  Expect = 4.2, Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query  95   HGRDLLLGAVDA--RVLLPAGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  149
            HG+ L +  VDA   VL     G  AG V +   N  +A  QL++  A  +PA EGT
Sbjct  246  HGKKLPIFGVDALPEVLQLIKKGEMAGTVLNDGVNQGKAVVQLAKNLAQGKPATEGT  302


>gi|90203202|ref|ZP_01205848.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]
 gi|90200081|gb|EAS26840.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]
Length=254

 Score = 33.1 bits (74),  Expect = 4.6, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query  87   AVRRKRDKHGRDLLLGAVDARV-LLPAGHGPAAG  119
            A+R+K  KHGRDL++G V  R+ ++ A +GPA G
Sbjct  80   ALRQKTIKHGRDLVIGMVRCRIPVVAAVNGPAVG  113


>gi|15641337|ref|NP_230969.1| Gene info galactoside ABC transporter, periplasmic D-galactose/D-glucose-binding 
protein [Vibrio cholerae O1 biovar eltor str. N16961]
 gi|9655815|gb|AAF94483.1| Gene info galactoside ABC transporter, periplasmic D-galactose/D-glucose-binding 
protein [Vibrio cholerae O1 biovar eltor str. N16961]
Length=324

 Score = 33.1 bits (74),  Expect = 5.0, Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 0/35 (0%)

Query  115  GPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  149
            G  AG V + A N A+A  +L+R  A+ +PAAEGT
Sbjct  268  GDMAGTVLNDAQNQAKATFELARNLANGKPAAEGT  302


>gi|116216023|ref|ZP_01481923.1|  hypothetical protein VchoR_02002167 [Vibrio cholerae RC385]
Length=316

 Score = 33.1 bits (74),  Expect = 5.0, Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 0/35 (0%)

Query  115  GPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  149
            G  AG V + A N A+A  +L+R  A+ +PAAEGT
Sbjct  260  GDMAGTVLNDAQNQAKATFELARNLANGKPAAEGT  294


>gi|75816940|ref|ZP_00747397.1|  COG1879: ABC-type sugar transport system, periplasmic component 
[Vibrio cholerae V52]
 gi|75826714|ref|ZP_00756149.1|  COG1879: ABC-type sugar transport system, periplasmic component 
[Vibrio cholerae O395]
 gi|116188580|ref|ZP_01478351.1|  hypothetical protein VchoM_02002531 [Vibrio cholerae MO10]
 gi|116221128|ref|ZP_01486542.1|  hypothetical protein VchoV5_02000859 [Vibrio cholerae V51]
Length=316

 Score = 33.1 bits (74),  Expect = 5.0, Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 0/35 (0%)

Query  115  GPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  149
            G  AG V + A N A+A  +L+R  A+ +PAAEGT
Sbjct  260  GDMAGTVLNDAQNQAKATFELARNLANGKPAAEGT  294


>gi|116130892|gb|EAA06516.4|  ENSANGP00000004748 [Anopheles gambiae str. PEST]
Length=2553

 Score = 32.7 bits (73),  Expect = 5.5, Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 41/113 (36%), Gaps = 0/113 (0%)

Query  50   VEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVL  109
            +++  L   CP  HC+     +        +       +++  DK    L     D    
Sbjct  333  MQSCLLGKNCPKTHCSSSRQIINHWKNCQRQDCPVCLPLQQHHDKQQDTLEPAKGDDASQ  392

Query  110  LPAGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGTAHSSAAEDRKALP  162
                 G A G+ QDA    A+ +     G +     A+GTA   AA D+K  P
Sbjct  393  AEQKEGKADGKSQDAGAGEAKDQQDKPSGESLDHKMADGTAEGKAALDKKQQP  445


>gi|15602903|ref|NP_245975.1| Gene info MglB [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12721371|gb|AAK03122.1| Gene info MglB [Pasteurella multocida subsp. multocida str. Pm70]
Length=330

 Score = 32.7 bits (73),  Expect = 6.2, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query  95   HGRDLLLGAVDA--RVLLPAGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  149
            HG+ L +  VDA   VL     G  AG V +   N  +A  QLS   A  +PA EGT
Sbjct  248  HGKKLPIFGVDALPEVLQLIKKGEIAGTVLNDGVNQGKAVVQLSNNLAKGKPATEGT  304


>gi|118067950|ref|ZP_01536204.1|  periplasmic binding protein/LacI transcriptional regulator [Serratia 
proteamaculans 568]
 gi|118017636|gb|EAV31554.1|  periplasmic binding protein/LacI transcriptional regulator [Serratia 
proteamaculans 568]
Length=330

 Score = 32.7 bits (73),  Expect = 6.2, Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query  82   AACLAAVRRKRDKHGRDLLLGAVDA--RVLLPAGHGPAAGEVQDAADNAAQARSQLSRGR  139
            A  + AV   +  +   + +  VDA    L     G  AG V + ADN A+A  +L++  
Sbjct  235  AMAMGAVEALKAHNKSSIPVFGVDALPEALAMVKSGAMAGTVLNDADNQAKATFELAKNL  294

Query  140  AHRQPAAEGTAH  151
            A  +PAA+GT +
Sbjct  295  AAGKPAADGTQY  306


>gi|25294130|gb|AAN74809.1|  Wdr1p [Gibberella moniliformis]
Length=856

 Score = 32.0 bits (71),  Expect = 9.1, Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 43/104 (41%), Gaps = 12/104 (11%)

Query  7    FLRHLDPRIERPAGLAAVVEERDGPALHRQARKRTG-RNARGPRVEAAALAPTCPSRHCT  65
            FL  LD   + P  +   + E   P      RKRTG     G R+E  A+AP+   +H  
Sbjct  694  FLLMLDLAQDLPKPVDGEIAESTAPGKQGLKRKRTGPSTGAGGRMEVGAIAPSQIRKHTA  753

Query  66   HDAGTLPLEAQPTVESAAC----------LAAVRRKRDKHGRDL  99
                 + +E  P  E A            LA +R +R+  G+DL
Sbjct  754  GQWDDIDMEDAPRPEDANSDDEADQPEGELAQLRNRREV-GKDL  796


>gi|26419739|gb|AAN78225.1|  class 4 metalloprotease [Chromobacterium violaceum]
Length=489

 Score = 32.0 bits (71),  Expect = 9.7, Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 0/76 (0%)

Query  18   PAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQP  77
            P    AVVEE+   A+ + + K +G+   G + + A+  PT  S      A +L     P
Sbjct  78   PVWGEAVVEEKQAGAVAKTSGKLSGQYIAGIQSDLASAKPTLSSAQALSQAKSLKANGNP  137

Query  78   TVESAACLAAVRRKRD  93
            T    A L     +R+
Sbjct  138  TYNEKADLVVRLNERN  153





blastp vs nr de "Translation of ORF number 2 in reading frame 3 on the reverse strand":

Query=  Translation of ORF number 2 in reading frame 3 on the reverse 
Length=159


No significant similarity found.




pour vérification, blastx vs nr de la sequence d'ADN genomique "_LO16880"                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|111019055|ref|YP_702027.1|  hypothetical protein RHA1_ro020...  38.5    0.41   Gene info
gi|116055714|emb|CAL57799.1|  unnamed protein product [Ostreococc  38.1    0.53 
gi|74025540|ref|XP_829336.1|  hypothetical protein Tb11.01.459...  37.7    0.69   Gene info
gi|73956822|ref|XP_850317.1|  PREDICTED: similar to Period cir...  37.4    0.90   UniGene infoGene info
gi|69284641|ref|ZP_00616439.1|  hypothetical protein KradDRAFT...  37.0    1.2  
gi|67516265|ref|XP_658018.1|  hypothetical protein AN0414.2 [A...  36.6    1.5    Gene info
gi|118175189|gb|ABK76085.1|  secreted protein [Mycobacterium smeg  36.2    2.0  
gi|115605783|gb|ABJ15868.1|  gamete-specific protein minus 1 [Chl  36.2    2.0  
gi|51894119|ref|YP_076810.1|  hypothetical protein, proline-ri...  36.2    2.0    Gene info
gi|116670139|ref|YP_831072.1|  DivIVA family protein [Arthroba...  36.2    2.0    Gene info
gi|86156673|ref|YP_463458.1|  LigA [Anaeromyxobacter dehalogen...  35.8    2.6    Gene info
gi|67546299|ref|ZP_00424214.1|  Cobalamin (vitamin B12) biosyn...  35.8    2.6  
gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococc  35.4    3.4  
gi|115377591|ref|ZP_01464788.1|  hypothetical protein STIAU_45...  35.4    3.4  
gi|109093898|ref|XP_001111018.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093900|ref|XP_001111086.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093896|ref|XP_001111056.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093892|ref|XP_001111206.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093894|ref|XP_001110984.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093890|ref|XP_001111164.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|67548232|ref|ZP_00426124.1|  Oxidoreductase, molybdopterin ...  35.4    3.4  
gi|92911148|ref|ZP_01279922.1|  hypothetical protein MjlsDRAFT...  35.0    4.5  



 alignement 2 à 2 correspondant:  


>gi|111019055|ref|YP_702027.1| Gene info hypothetical protein RHA1_ro02062 [Rhodococcus sp. RHA1]
 gi|110818585|gb|ABG93869.1| Gene info conserved hypothetical protein [Rhodococcus sp. RHA1]
Length=497

 Score = 38.5 bits (88),  Expect = 0.41
 Identities = 49/162 (30%), Positives = 62/162 (38%), Gaps = 33/162 (20%)
 Frame = -2

Query  519  DPRIERPAGLAAVVEERDG----PALHRQARKRTGR---NARGPRVEAAALAPTC----P  373
            DP   RP+   AV   R G    PAL R+ R+R GR     R PR   A + P      P
Sbjct  72   DPPARRPSRRLAVRGARRGHRATPALPRRRRRRRGRVPAGTRSPRQARAGVRPAVRRGRP  131

Query  372  SRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKH---------GRDLLLGAVDARVLLP  220
            +R C   A                 A  R +RD+H         GRD L GA    +   
Sbjct  132  ARTCARGARRGRHPDDRGAARRLRSARARDRRDRHRAHAHRIGRGRDPLRGARHRHL---  188

Query  219  AGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGTAHSS  94
                  AG+ +D     A AR+   R  A  +P   G+A SS
Sbjct  189  -----RAGDRRD-----APARTPGRRAEAPPEPRRTGSAVSS  220


>gi|116055714|emb|CAL57799.1|  unnamed protein product [Ostreococcus tauri]
Length=1315

 Score = 38.1 bits (87),  Expect = 0.53
 Identities = 66/311 (21%), Positives = 109/311 (35%), Gaps = 45/311 (14%)
 Frame = +1

Query  4    TRALNSWIAYNKEAA---LQLRRLRKGLSVFCGTG----MRRAFSSWLAMRASSRQLRAC  162
            +R+ N+W A   EA    + LR++ K +++         +RR F  W    ASS   R  
Sbjct  624  SRSFNAWRAATGEAINAKINLRKMEKIINLQAKYAAKERLRRVFVIWRDHAASSCHQRQM  683

Query  163  LRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQ  342
                +  + +   + A   W+++      QQ+     ++        R A ++W      
Sbjct  684  AAKTIASMRNRVLTSAFERWRESTK-EYAQQRRMLTHIAQKMQRNSLRLAFDTW------  736

Query  343  RSGVVRAVTAWTRWSERRSFNAWTASIaaralarlaMKRGAVSLFHYGRETRRALNSWVE  522
               VV             +FN W   +  +      + R         R  R   ++WV 
Sbjct  737  --AVVAHDAXXXXXXXFTAFNTWHEQVCTKKRYHAIIARFYERF--RDRSLRGTFSTWVA  792

Query  523  MAQEWSLK-------QRLLQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNA--VTSMS  675
            + +E           ++L +  L  L   G A RR +    +  + R+    A  V  + 
Sbjct  793  VTREAKEHRLAIINGEKLRENKLAQLI--GSASRRTMGYAFMEWRDRVRENKAIKVNEIK  850

Query  676  AEGRAVRKALNS-------WAVFLRQRFVQVKSLRALVHHGER----AGFNAWIAAAKEH  822
            A+   VR  + S       W  F+  R   V+  R  V   ER    A F  W+   K  
Sbjct  851  ADRMVVRSRMRSLSRTFDQWLSFVHLRRRTVEMARIFVKRAERAHLAAAFGGWLDVVK--  908

Query  823  AGVQRKMQRAL  855
                RK  RAL
Sbjct  909  ---VRKRNRAL  916


>gi|74025540|ref|XP_829336.1| Gene info hypothetical protein Tb11.01.4590 [Trypanosoma brucei TREU927]
 gi|70834722|gb|EAN80224.1| Gene info hypothetical protein, conserved [Trypanosoma brucei]
Length=349

 Score = 37.7 bits (86),  Expect = 0.69
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 11/103 (10%)
 Frame = +1

Query  100  MRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVS  279
            +RR  SS      S R+ RA  RS+ G+   +   R++       G +S  ++  AV+ S
Sbjct  130  LRRLQSSASGKSVSRRRSRAT-RSLAGKEEDIGDDRSLV------GFDSVPRRYDAVVPS  182

Query  280  FS-PDGRKARRALNSW---LSLKRQRSGVVRAVTAWTRWSERR  396
             + PD   A  A  SW   L     RSG +R VTAW    ER+
Sbjct  183  GNVPDAVSAAAASKSWKMNLVANLTRSGTLRGVTAWNERCERQ  225


>gi|73956822|ref|XP_850317.1| UniGene infoGene info PREDICTED: similar to Period circadian protein 3 (hPER3) [Canis 
familiaris]
Length=1128

 Score = 37.4 bits (85),  Expect = 0.90
 Identities = 33/104 (31%), Positives = 43/104 (41%), Gaps = 12/104 (11%)
 Frame = -2

Query  465  GPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVR  286
            G +   +A   + R + GPR EAA  APT   R C        L  Q  +ESAA      
Sbjct  442  GDSQEPRASLASSRESGGPRGEAARRAPTALQRVCASVNKMKKLGGQLHIESAAA-----  496

Query  285  RKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARS  154
            R  DKH     +G   AR   P G   A+  +Q   +N+    S
Sbjct  497  RSPDKHA----MGTHPAR---PGGEQKASSPLQTLKNNSVHMES  533


>gi|69284641|ref|ZP_00616439.1|  hypothetical protein KradDRAFT_2999 [Kineococcus radiotolerans 
SRS30216]
 gi|67988088|gb|EAM75871.1|  hypothetical protein KradDRAFT_2999 [Kineococcus radiotolerans 
SRS30216]
Length=301

 Score = 37.0 bits (84),  Expect = 1.2
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 5/99 (5%)
 Frame = +2

Query  209  P*PAGNRTRASTAPSKRSRPCLS--RFRRTAARHAALSTVG*ASRGNVPASCVQ*RLGHV  382
            P PA    R  T+PSKR+    S   +RR A+R  ++  V   S G+ PA          
Sbjct  15   PGPAATWRRVQTSPSKRASTAASMPSWRRAASRSRSMRRV---SSGSPPAPSAPSAPNAT  71

Query  383  GASAAASTRGPRALRPVRLRAWR*SAGPSRSSTTAARPA  499
            G S+     G R         W  +A  +R++ +A+R A
Sbjct  72   GGSSRGPAGGVRGCAAAARARWARAARSTRAAASASRQA  110


>gi|67516265|ref|XP_658018.1| Gene info hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
 gi|40747357|gb|EAA66513.1| Gene info hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
Length=981

 Score = 36.6 bits (83),  Expect = 1.5
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)
 Frame = +1

Query  49   LQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQ  228
            L+ RRLR+ L      GM+R F         S  LRA L +V GRI+ LA + A ++ + 
Sbjct  457  LKERRLRQDL------GMKRKFIDIWVQTYDSNALRAALEAVTGRIIPLAKANASSTHKS  510

Query  229  NAGVNSTQQKISAVLVSF  282
              G +  ++ ++  L  F
Sbjct  511  ANGASPHEKALTKKLAKF  528


>gi|118175189|gb|ABK76085.1|  secreted protein [Mycobacterium smegmatis str. MC2 155]
Length=433

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 29/78 (37%), Positives = 36/78 (46%), Gaps = 12/78 (15%)
 Frame = -2

Query  465  GPALHRQARKRTGRNARGPRVEAAALAP---------TCPSRHCTHDAGTLPLEA-QPTV  316
            G A  + AR R GR  R P V AAALAP         + P  H + DA   PL A QP +
Sbjct  5    GGAAIQAARHRAGRFMRTPMVGAAALAPLILAGAVGASAPPHHGSSDAAVTPLAAVQPQI  64

Query  315  --ESAACLAAVRRKRDKH  268
              +  A +AA +     H
Sbjct  65   DHDGPAVVAAAKAPTKFH  82


>gi|115605783|gb|ABJ15868.1|  gamete-specific protein minus 1 [Chlamydomonas incerta]
Length=892

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 37/112 (33%), Positives = 46/112 (41%), Gaps = 5/112 (4%)
 Frame = -2

Query  489  AAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHD---AGTLPLEAQPT  319
            AAVV   +G A      KR GR A GP   AAAL+    S +   D   A  + + A  +
Sbjct  588  AAVVAVGEGKAAAAATAKRGGRGATGPEAAAAALSALGGSGNSELDEAMATYVRVAAVYS  647

Query  318  VESAACLAAVRRKRDKHGRDLLLG--AVDARVLLPAGHGPAAGEVQDAADNA  169
             E+AA +A            L LG  A    V  PA +G   G V   A  A
Sbjct  648  DEAAAAVAECESLMQDFDDKLQLGNLATTFAVATPAANGRPRGGVNGGATRA  699


>gi|51894119|ref|YP_076810.1| Gene info hypothetical protein, proline-rich [Symbiobacterium thermophilum 
IAM 14863]
 gi|51857808|dbj|BAD41966.1| Gene info hypothetical protein, proline-rich [Symbiobacterium thermophilum 
IAM 14863]
Length=247

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 45/146 (30%), Positives = 56/146 (38%), Gaps = 9/146 (6%)
 Frame = -2

Query  522  LDPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGT  343
            +D R+ R   LAA +E R    +  +AR R      G + +A A     P      DAG 
Sbjct  56   IDQRMARLNDLAAQLEIRAVAEVQAKARSRA---KSGTQPQADAPPDGRPPAPAPPDAGD  112

Query  342  LPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQ  163
                 QP  E A  + A ++K  K GR    GA    V      GPAAG  Q      A 
Sbjct  113  QEAP-QPQPERAPEVEAAQQK-PKRGRRSRAGAGSTAV----PSGPAAGSQQAGGSRQAA  166

Query  162  ARSQLSRGRAHRQPAAEGTAHSSAAE  85
               Q +      QPA    A  S AE
Sbjct  167  DSGQFASPGQPSQPAEAPPAEPSPAE  192


>gi|116670139|ref|YP_831072.1| Gene info DivIVA family protein [Arthrobacter sp. FB24]
 gi|116610248|gb|ABK02972.1| Gene info DivIVA family protein [Arthrobacter sp. FB24]
Length=232

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 33/123 (26%), Positives = 46/123 (37%), Gaps = 4/123 (3%)
 Frame = -2

Query  498  AGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPT  319
            A  A VVE+   P    +   R    A     EA   AP   +      A   P    PT
Sbjct  64   AAAAPVVEKVPAPVKAEKDESRAKAEAEAKAAEAKKKAPEPATALAPVPAAAAPAAVNPT  123

Query  318  VESAA-CLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARSQLSR  142
             ESAA  LA  ++  DKH  D   G      ++      A+  V DA + + +    L +
Sbjct  124  AESAAGLLAMAQQMHDKHVAD---GQQQKDKIIAEAQIEASSLVNDAQEKSRKILGALEQ  180

Query  141  GRA  133
             R+
Sbjct  181  QRS  183


>gi|86156673|ref|YP_463458.1| Gene info LigA [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773184|gb|ABC80021.1| Gene info LigA [Anaeromyxobacter dehalogenans 2CP-C]
Length=808

 Score = 35.8 bits (81),  Expect = 2.6
 Identities = 50/163 (30%), Positives = 60/163 (36%), Gaps = 26/163 (15%)
 Frame = -2

Query  528  RHLDPRIERPAGLAAVVEERDGPALH-RQARKRTGRNARGPRVEAAA--LAPTCPSRHCT  358
            R   P   RP G A       G A   R  R+R GR  RGP   A    + P    R   
Sbjct  210  RRARPARARPRGRARPRRRARGAAGRGRPGRRRAGRAPRGPPAPAGGERVHPPLALRGAE  269

Query  357  HDAGTLPLEAQPTVESAACLAAVRRK-------RDKHGRDLLLGAVDARVLLPAGHGPAA  199
             D      +A   V  A    A RR+       R + GR    G   AR    AGHG   
Sbjct  270  RD------DAAAGVRRAGDRGADRRRRGGARAARGRAGR----GGGGAR----AGHGRGG  315

Query  198  GEVQDAADNAAQARSQLSRGRAH-RQPAAEGTAHSSAAEDRKA  73
            G  +  A  A   R++  RGR   R  A  G A + A   R+A
Sbjct  316  GRPRRRARRAG-GRARAGRGRRRARAGAGRGRARAGAGRGRRA  357


>gi|67546299|ref|ZP_00424214.1|  Cobalamin (vitamin B12) biosynthesis CbiD protein [Burkholderia 
vietnamiensis G4]
 gi|67532447|gb|EAM29233.1|  Cobalamin (vitamin B12) biosynthesis CbiD protein [Burkholderia 
vietnamiensis G4]
Length=673

 Score = 35.8 bits (81),  Expect = 2.6
 Identities = 43/148 (29%), Positives = 59/148 (39%), Gaps = 11/148 (7%)
 Frame = -2

Query  504  RPAGLA------AVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGT  343
            RPAG A       + + R+  A  R+AR R  R    PR  A       P+R   H A  
Sbjct  82   RPAGAAHRRPRARLADRRNRGAQSRRARLRGRRRCAAPRAHAGPARRRIPARRPAHQARH  141

Query  342  LPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQ  163
               +A+ +  + A  AAV R R   G+ L    +DA   + + H         AA +  Q
Sbjct  142  ARADARAS-RARAGRAAVGRGR---GQRLDRHRMDAGASVVSRHRDRVAR-GTAALHRTQ  196

Query  162  ARSQLSRGRAHRQPAAEGTAHSSAAEDR  79
             R     G A R+ A    AH + A  R
Sbjct  197  PRRARRAGPATRRRARARCAHGAGAARR  224


>gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococcus tauri]
Length=340

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 41/184 (22%), Positives = 75/184 (40%), Gaps = 17/184 (9%)
 Frame = +1

Query  106  RAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFS  285
            R+++ W     + ++    L  V  RI +   + A T W++ A   S   K+    +   
Sbjct  132  RSWNKWGEYVVNEKRRNNVLGKVYSRIRNTELANAFTRWREFA-EESYDAKMQLRKIVSR  190

Query  286  PDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAW--TASIaaralarl  447
                +  +AL  W    +  +RQR+ + R  T        + FNAW  T +         
Sbjct  191  MLRLRLSQALGRWRENTIESQRQRALLARVATRIRNRCVAQCFNAWCDTVNDNKIEAQAS  250

Query  448  aMKRGAVS--LFHYGRET-RRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNS  618
            A ++  V+       R T R A   W  + +E  + + ++++ L       RAKR A+N 
Sbjct  251  AYRQRLVNNLCLRINRATLREAFKKWWRVVEEREMHREMIRKVL-------RAKRVAMNF  303

Query  619  WLLW  630
            ++ W
Sbjct  304  FMTW  307


>gi|115377591|ref|ZP_01464788.1|  hypothetical protein STIAU_4522 [Stigmatella aurantiaca DW4/3-1]
 gi|115365392|gb|EAU64430.1|  hypothetical protein STIAU_4522 [Stigmatella aurantiaca DW4/3-1]
Length=371

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 36/105 (34%), Positives = 45/105 (42%), Gaps = 17/105 (16%)
 Frame = -2

Query  393  ALAPTCPSRHCTHDAGTLPLEAQ-PTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPA  217
            ALA    +RH + D  TL L+ Q P       LA +  +    G++ L  AV       A
Sbjct  199  ALADEAGARHASIDLQTLALQGQLPVGLGQIRLARLAPRPHAGGQEQLQRAVQ------A  252

Query  216  GHGPAAGEVQDAADNAAQARSQLSRGRAHRQ----PAAEGTAHSS  94
             H   AGEV + A    Q R       AH Q    PAA+G AH S
Sbjct  253  AHHVQAGEVLEVALGGIQPR------EAHLQPPLRPAADGAAHRS  291


>gi|109093898|ref|XP_001111018.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 2 [Macaca mulatta]
Length=1100

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  103  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  282
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  378  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  437

Query  283  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  450
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  438  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  469

Query  451  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  630
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  470  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  519

Query  631  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  774
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  520  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  570


>gi|109093900|ref|XP_001111086.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 4 [Macaca mulatta]
Length=934

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  103  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  282
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  212  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  271

Query  283  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  450
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  272  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  303

Query  451  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  630
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  304  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  353

Query  631  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  774
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  354  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  404


>gi|109093896|ref|XP_001111056.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 3 [Macaca mulatta]
Length=1137

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  103  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  282
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  415  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  474

Query  283  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  450
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  475  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  506

Query  451  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  630
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  507  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  556

Query  631  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  774
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  557  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  607


>gi|109093892|ref|XP_001111206.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform b isoform 6 [Macaca mulatta]
Length=1188

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  103  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  282
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  466  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  525

Query  283  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  450
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  526  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  557

Query  451  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  630
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  558  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  607

Query  631  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  774
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  608  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  658


>gi|109093894|ref|XP_001110984.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 1 [Macaca mulatta]
Length=1158

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  103  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  282
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  436  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  495

Query  283  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  450
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  496  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  527

Query  451  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  630
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  528  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  577

Query  631  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  774
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  578  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  628


>gi|109093890|ref|XP_001111164.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 5 [Macaca mulatta]
Length=1219

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  103  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  282
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  497  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  556

Query  283  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  450
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  557  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  588

Query  451  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  630
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  589  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  638

Query  631  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  774
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  639  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  689


>gi|67548232|ref|ZP_00426124.1|  Oxidoreductase, molybdopterin binding [Burkholderia vietnamiensis 
G4]
 gi|67530427|gb|EAM27268.1|  Oxidoreductase, molybdopterin binding [Burkholderia vietnamiensis 
G4]
Length=651

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 41/158 (25%), Positives = 54/158 (34%), Gaps = 17/158 (10%)
 Frame = -2

Query  498  AGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPT  319
            AG    VE RDGP    + R   GR+ +  R EA      C  +      G + L  QP 
Sbjct  66   AGRVVDVEGRDGPRCDEEGRHEEGRDEKARRDEAGCDVARCDGQGVGRQDGAVEL-TQPY  124

Query  318  VESAACLAAVRRKRDKHGRDLLLGAVDARVL---------------LPAGHGPAAGEVQD  184
               AA  AA R    +    +       RV+                P+ H P  G    
Sbjct  125  GRVAAACAARRPVARRAALRVSWRGASCRVVPVRIDADAIRSVHHANPSRHRPRGGPAPR  184

Query  183  AADNAA-QARSQLSRGRAHRQPAAEGTAHSSAAEDRKA  73
            A D++A  AR  L++        A   AH     D  A
Sbjct  185  APDSSAVGAREPLAQCARGDPDGAVRLAHLRCVADLSA  222

ORF finding

ORF Finder results
Results for 862 residue sequence "ORF_LO16880 ADN génomique" starting "TGCACACGCG"


Cadre de lecture 1, 2 et 3 sur le brin direct:

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 861.
TGCACACGCGCTCTCAATAGCTGGATAGCATACAACAAGGAGGCGGCGTTGCAACTACGA
CGGTTGCGGAAGGGCCTTTCTGTCTTCTGCGGCACTGGAATGCGCCGTGCCTTCAGCAGC
TGGCTGGCGATGCGCGCGTCCTCTCGACAGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGC
CGCATCTTGCACCTCGCCTGCAGCCGGGCCATGACCAGCTGGCAACAGAACGCGGGCGTC
AACAGCACCCAGCAAAAGATCTCGGCCGTGCTTGTCTCGTTTTCGCCGGACGGCCGCAAG
GCACGCCGCGCTCTCAACAGTTGGCTGAGCCTCAAGAGGCAACGTTCCGGCGTCGTGCGT
GCAGTGACGGCTTGGACACGTTGGAGCGAGCGCCGCAGCTTCAACGCGTGGACCGCGAGC
ATTGCGGCCCGTGCGCTTGCGCGCCTGGCGATGAAGCGCGGGGCCGTCTCGCTCTTCCAC
TACGGCCGCGAGACCCGCCGGGCGCTCAATTCGTGGGTCGAGATGGCGCAGGAATGGTCG
CTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTCTTCCCGAAGGGTCGGGCGAAG
CGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCTGAATGCC
GTGACGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTGGGCAGTC
TTCTTGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCATCACGGCGAG
CGTGCGGGTTTCAACGCGTGGATCGCTGCCGCTAAGGAGCACGCGGGCGTGCAGCGGAAG
ATGCAGCGGGCGCTGAGTGTG


>Translation of ORF number 1 in reading frame 1 on the direct strand.
CTRALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVG
RILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVR
AVTAWTRWSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQEWS
LKQRLLQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALNSWAV
FLRQRFVQVKSLRALVHHGERAGFNAWIAAAKEHAGVQRKMQRALSV

>ORF number 1 in reading frame 2 on the direct strand extends from base 29 to base 214.
CATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTCTGTCTTCT
GCGGCACTGGAATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGAC
AGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTGCAGCCGGG
CCATGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
HTTRRRRCNYDGCGRAFLSSAALECAVPSAAGWRCARPLDSCERACAALSAASCTSPAAG
P*

>ORF number 2 in reading frame 2 on the direct strand extends from base 665 to base 856.
CGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTGGGCAGTCTTCT
TGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCATCACGGCGAGCGTG
CGGGTTTCAACGCGTGGATCGCTGCCGCTAAGGAGCACGCGGGCGTGCAGCGGAAGATGC
AGCGGGCGCTGA

>Translation of ORF number 2 in reading frame 2 on the direct strand.
RPCQRRAVPCAKPSTRGQSSCGSALCRLNRCGLSFITASVRVSTRGSLPLRSTRACSGRC
SGR*

>ORF number 1 in reading frame 3 on the direct strand extends from base 21 to base 749.
CTGGATAGCATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTC
TGTCTTCTGCGGCACTGGAATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTC
CTCTCGACAGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTG
CAGCCGGGCCATGACCAGCTGGCAACAGAACGCGGGCGTCAACAGCACCCAGCAAAAGAT
CTCGGCCGTGCTTGTCTCGTTTTCGCCGGACGGCCGCAAGGCACGCCGCGCTCTCAACAG
TTGGCTGAGCCTCAAGAGGCAACGTTCCGGCGTCGTGCGTGCAGTGACGGCTTGGACACG
TTGGAGCGAGCGCCGCAGCTTCAACGCGTGGACCGCGAGCATTGCGGCCCGTGCGCTTGC
GCGCCTGGCGATGAAGCGCGGGGCCGTCTCGCTCTTCCACTACGGCCGCGAGACCCGCCG
GGCGCTCAATTCGTGGGTCGAGATGGCGCAGGAATGGTCGCTGAAGCAGCGGCTACTGCA
GCGAGGGCTCACGACGCTCTTCCCGAAGGGTCGGGCGAAGCGTCGTGCGGTCAATTCTTG
GCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCTGAATGCCGTGACGTCCATGTCAGCGGA
GGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTGGGCAGTCTTCTTGCGGCAGCGCTTTGT
GCAGGTTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
LDSIQQGGGVATTTVAEGPFCLLRHWNAPCLQQLAGDARVLSTAASVLAQRCRPHLAPRL
QPGHDQLATERGRQQHPAKDLGRACLVFAGRPQGTPRSQQLAEPQEATFRRRACSDGLDT
LERAPQLQRVDREHCGPCACAPGDEARGRLALPLRPRDPPGAQFVGRDGAGMVAEAAATA
ARAHDALPEGSGEASCGQFLATLVKAAPRAAECRDVHVSGGPCRAQSPQLVGSLLAAALC
AG*



cadre de lecture 1, 2 et 3 sur le brin indirect:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 190.
CACACTCAGCGCCCGCTGCATCTTCCGCTGCACGCCCGCGTGCTCCTTAGCGGCAGCGAT
CCACGCGTTGAAACCCGCACGCTCGCCGTGATGAACGAGAGCCCGCAGCGATTTAACCTG
CACAAAGCGCTGCCGCAAGAAGACTGCCCACGAGTTGAGGGCTTTGCGCACGGCACGGCC
CTCCGCTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
HTQRPLHLPLHARVLLSGSDPRVETRTLAVMNESPQRFNLHKALPQEDCPRVEGFAHGTA
LR*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 311 to base 808.
CCGCTGCTTCAGCGACCATTCCTGCGCCATCTCGACCCACGAATTGAGCGCCCGGCGGGT
CTCGCGGCCGTAGTGGAAGAGCGAGACGGCCCCGCGCTTCATCGCCAGGCGCGCAAGCGC
ACGGGCCGCAATGCTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCA
AGCCGTCACTGCACGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAG
AGCGCGGCGTGCCTTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTG
CTGGGTGCTGTTGACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAG
GTGCAAGATGCGGCCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCG
CATCGCCAGCCAGCTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCC
CTTCCGCAACCGTCGTAG

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
PLLQRPFLRHLDPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCP
SRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGE
VQDAADNAAQARSQLSRGRAHRQPAAEGTAHSSAAEDRKALPQPS*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 96 to base 383.
ACGAGAGCCCGCAGCGATTTAACCTGCACAAAGCGCTGCCGCAAGAAGACTGCCCACGAG
TTGAGGGCTTTGCGCACGGCACGGCCCTCCGCTGACATGGACGTCACGGCATTCAGCAGC
TCGAGGCGCTGCTTTGACCAAAGTAGCCAAGAATTGACCGCACGACGCTTCGCCCGACCC
TTCGGGAAGAGCGTCGTGAGCCCTCGCTGCAGTAGCCGCTGCTTCAGCGACCATTCCTGC
GCCATCTCGACCCACGAATTGAGCGCCCGGCGGGTCTCGCGGCCGTAG

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
TRARSDLTCTKRCRKKTAHELRALRTARPSADMDVTAFSSSRRCFDQSSQELTARRFARP
FGKSVVSPRCSSRCFSDHSCAISTHELSARRVSRP*

>ORF number 2 in reading frame 3 on the reverse strand extends from base 384 to base 860.
TGGAAGAGCGAGACGGCCCCGCGCTTCATCGCCAGGCGCGCAAGCGCACGGGCCGCAATG
CTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCAAGCCGTCACTGCA
CGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAGAGCGCGGCGTGCC
TTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTGCTGGGTGCTGTTG
ACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAGGTGCAAGATGCGG
CCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCGCATCGCCAGCCAG
CTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCCCTTCCGCAACCGT
CGTAGTTGCAACGCCGCCTCCTTGTTGTATGCTATCCAGCTATTGAGAGCGCGTGTG

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
WKSETAPRFIARRASARAAMLAVHALKLRRSLQRVQAVTARTTPERCLLRLSQLLRARRA
LRPSGENETSTAEIFCWVLLTPAFCCQLVMARLQARCKMRPTTLRKHARSCREDARIASQ
LLKARRIPVPQKTERPFRNRRSCNAASLLYAIQLLRARV