ORF KN17770

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160106.1
Annotathon code: ORF_KN17770
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : LaurelineCyril
Annotated on : 2008-04-02 12:14:41
  • MESQUIN laureline
  • PICARD cyril

Synopsis

Genomic Sequence

>AACY01160106.1 ORF_KN17770 genomic DNA
CTTTCTAACAATTTGTCCATATCCGATTTAAAATCGACCGCATCCAAAAACAAGTCAATCTTAATGGCCATAACAAATTGAGAATGTTTATTGTCACCAG
CAAGAAATCCAGGACCATTACCTGAGAGAATTCCAGACATAATGTCGACTATGGTTGCAAATCCGTATCCCTTGTGACCTCCATTTTCTCTTGTCCCGCC
AAAAGGCAACATGTAGAAACCACCATAGTTGGGGGAATCGACAGGATCCATTATGGGATTTCCTTCTAAATCTGTAATCCATCCCGGTTCAAGTTGAGAC
CCAATACGACGTGTCAACATCAGCTTGTTCGCAGCTACCTGGGTAGTCGCGACATCAAACACGAATGGAGGTTGCTTATCCGCAGGAGCCCCCCAAGCGA
TGGGATGGGTACCAAATACGGTTTCCGAGCCAAATACAGGGACCTGCAATCTGCCTCCGGCCGATACCATGCATATTCCAATCATATCGTGTTGTAGGGC
CATGAGTGGGTAATATGCAAGCATGCCTACATGACCACAGTTTTGAATCGCTACAGCTCCGATTCCCGTGGTTTCGGCTTTTTCTATCGCTAGCTTCATC
GCTTTAGGACCCACCTGTATGCCCAAACCTGTATCCGCATCCCATGTTGCGCTAACGGGCGTTTCCCTCAGTGTTTTGACTTCCGGTCGCGGATTCATCC
GATCCGCTTGGTACATCGCGACATAGTTTCGCAACATATTCGAGACACCATGACTCTCACAACCTCGGAGATCACTTGTGATCAACACGTCCGTAGCGAT
AACGGCATCTTCCTCGGACATACCCATCTTTTCA

Translation

[2 - 832/834]   indirect strand
>ORF_KN17770 Translation [2-832   indirect strand]
EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCG
HVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPIMDPVDS
PNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

                        +------------------------------sinorhi [alpha]  
                    +---7 
                    !   +------------------------------brady   [alpha]  
                    ! 
                 +--9           +-------------------burkhol   [beta]
                 !  !           ! 
                 !  !           !                      +bordet1   [beta]
                 !  +-----------5                    +-2 
                 !              !   +----------------3 +bordet2   [beta]
  +--------------8              !   !                ! 
  !              !              +---4                +bordet3   [beta]
  !              !                  ! 
  !              !                  +-------------azobact [gamma]  
  !              ! 
  !              !    +------------------------ORF_KN1777
  !              +----6 
  !                   +-------------------------cytopha[Bacteroidetes/Chlorobi]
  ! 
  !
  ! 
  +--------------------entamoeba [euka]

Annotator commentaries

Notre séquence fait 834 pb. Nous avons effectué sur cette séquence une recherche d'ORF. Nous avons ainsi balayé toutes les possibilités, avec ORF finder (SMS) : ATG comme codon d'initiation, CTG ou TTG ou GTG ou ATG comme codon d'initiation, ainsi que n'importe quel codon comme codon d'initiation (option 'any codon').

Ainsi nous avons obtenus une ORF qui nous semblait intéressante avec un ATG comme codon d'initiation ; à cette séquence, il manquait la partie 3'. L'étude Blastp menée sur la protéine découlant de cette séquence nucléotidique nous a apporté des précisions quant à la pertinence de l'ORF que nous avions choisi par défaut. En effet, les alignements observés nous ont permi de voir qu'en prenant cet ATG comme codon d'initiation, nous oubliions la première partie de la protéine. Donc pour remédier à cette erreur, nous avons élargit notre champ de travail, en ne considérant plus l'ATG comme codon d'initiation, ceci grâce à l'option 'any codon' dans ORF finder. C'est pourquoi nous avons travaillé avec la séquence sur le brin indirect, allant des nucléotides 2 à 832.

Sur la séquence protéique obtenue, nous avons effectué un Blastp. Les résultats des Blast contre Swissprot et NR sont présentés dans les cadres ci dessus. Nous ne parlerons ici que du Blast contre NR. On peut voir de nombreux homologues présentant une Evalue assez intéressante (la plus forte est de 1e-50, beaucoup se situent au dessus de e-20). Ensuite si nous regardons les alignements 2 à 2 entre notre séquence et les séquences homologues, nous voyons des résultats assez satisfaisant : en effet nous pouvons voir pour les premiers homologues des identités proches ou supérieurs à 40%, des positifs supérieurs à 50%, et des gaps assez petits. Les groupes taxonomiques trouvés par cette recherche Blastp sont assez variés : Bacteroidetes/Chlorobi group, alpha-proteobacteria, beta-proteobacteria, gamma-proteobacteria, epsilon-proteobacteria, delta-proteobacteria, eubacteria, euryarchaeotes, ascomycetes, eukaryotes.

Nous nous sommes ensuite penchés sur l'alignement multiple. Nous avons dans un premier temps pris dans le Blast les séquences les plus homologues afin d'établir une première relation de parenté. L'arbre obtenu avec ces séquences nous a indiqué une très forte homologie avec une séquence provenant d'un organisme du taxon Bacteroidetes/Chlorobi group, et une parenté( bien que plus éloignée) avec les protéobactéries. Ce premier arbre nous a permis d'approfondir nos recherches phylogénétiques dans cette direction. Le Blast effectué ne nous a pas permis d'obtenir de séquence supplémentaire du taxon Bacteroidetes/Chlorobi group, mais nous avons pu fournir des séquences d'alpha-proteobacterie, de beta-proteobacterie et de gamma-proteobacterie. L'arbre obtenu est raciné grâce à la séquence provenant d'un eukaryote : Entamoeba histolytica. Ce qui est intéressant de voir, c'est qu'en fournissant l'arbre en différentes protéobactéries, notre séquence reste toujours très apparentée à la séquence 'Bacteroidetes/Chlorobi group'.

De cet arbre, nous avons pu tirer le nom des plus proches orthologues: Cytophaga hutchinsonii, Sinorhizobium medicae, Bradyrhizobium japonicum, Burkholderia phytofirmans, Azotobacter vinelandii, Bordetella parapertussis, Bordetella bronchiseptica, Bordetella pertussis, Entamoeba histolytica.

En observant les fonctions des différentes séquences provenant des homologues, nous pouvons en voir une qui revient dans la plupart des cas : malate dehydrogenase ou Malate/L-lactate dehydrogenase. Nous pouvons donc penser que notre séquence permettra de donner une protéine ayant le même type de fonction.

Nous avons poussé notre étude de la fonction de notre séquence grâce à l'étude des domaines protéiques. Nous nous sommes servis de Pfam pour ces recherches. Les résultats nous ont montré qu'un domaine était présent sur notre séquence protéique : le domaine Ldh_2. Ce domaine donne la fonction malate deshydrogenase (MDH) pour les bactéries. L'Evalue présentée par Pfam est assez bonne : 3.3E-33. Ce domaine entre en jeu dans le métabolisme, en permettant une activité oxydoreductase.

Ainsi, par l'étude portée sur les homologues, et celle faite sur les domaines protéiques, nous pouvons avancer l'hypothèse que la séquence nucléotidique dont nous disposons code pour une protéine entrant en jeu dans le métabolisme, grâce à une activité oxydoreductase.

Comme nous l'avons dit précédemment, notre séquence nucléotidique est tronquée en 5' et en 3'. Autrement dit, il nous manque les parties C-ter et N-ter de notre protéine. Nous n'avons donc pas mesuré la masse moléculaire de la portion protéique dont nous disposons. Pour information, cette portion a une masse moléculaire de 29.79 kD. En analysant l'alignement multiple au format Clutal, nous voyons qu'il nous manque en N-ter, environ 25 aa (donc sur la partie nucléotidique il nous manque 75 pb), et que sur la partie C-ter, il manque approximativement 60 aa (soit 180pb).

En ce qui concerne les symboles de gènes, nous n'avons pas pu en caractériser un pour notre séquence. Les homologues ne présentaient pas de symbole.

Nous avons donc ici une séquence génomique que nous qualifierons de codante, dans le sens indirect. La séquence protéique codée offre à l'organisme un processus biologique supplémentaire, qui consiste en une activité malate deshydrogenase.

Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


bordet2          ------------------------------------------------------------
bordet1          ------------------------------------------------------------
bordet3          ------------------------------------------------------------
azobact          MGRLRASAAERPDPVAFGDLGAQGREGHPGPARCHRPRLAPQRLAARGRRAQRPAAVAGA
burkhol          ------------------------------------------------------------
cytopha          ------------------------------------------------------------
ORF_KN17770      ------------------------------------------------------------
entamoeba        ------------------------------------------------------------
brady            ------------------------------------------------------------
sinorhi          ------------------------------------------------------------
                                                                             

bordet2          ----------------MPESGMEADMVAIGRVREQIDRVLRAWGMPEAPAGVTADLMAET
bordet1          ----------------MPESGMEADMVAIGRVREQIDRVLRAWGMPEAPAGVTADLMAET
bordet3          ----------------MPESGMEADMVAIGRVREQIDRVLRAWGMPEAPAGVTADLMAET
azobact          ARPAREIPRRGPPGGQPAMSGQAMAKVGADALRELTAAVLAAWGMPAVAAEETAALIVET
burkhol          -------------------MADTMPRVGAAIARQQIEVILEAWGMSPGQVAASADILIDS
cytopha          MQLLTISLRLSAQKAILLQTNLTLLMYPYKDLFAFTKNVFLAMGCPQEDAQVATTVLLSA
ORF_KN17770      ----------------------------------------EKMGMSEEDAVIATDVLITS
entamoeba        ------------------MADDSKYRIHFDELEKFMKDVLMAKGVEEADAARCAKVLIQA
brady            -----------------------MPIVRADRLTRISAALLQAAGASQEEADAVATGCVNA
sinorhi          --------------------MSDHVILEAEALRGFTEDVLKAAGMRPQPAATVADTLVYA
                                                            *     .   :     :

bordet2          DLLGIDSHGIS-MLPSYEDKLRAGTLRIDAQPRLVREGTASALLDGMGGLGHPVAAQAMR
bordet1          DLLGIDSHGIS-MLPSYEDKLRAGTLRIDAQPRLVREGTASALLDGMGGLGHPVVAQAMR
bordet3          DLLGIDSHGIS-MLSSYEDKLRAGTLRIDAQPRLVREGTASALLDGMGGLGHPVAAQAMR
azobact          DLAGIDSHGVS-MLPFYETLREAGGWVPDAEPRVVRESPCTALLDGGHGLGHRTAMQAMR
burkhol          DLKGIDSHGIS-MLMFYDQLYRAGQIDMKASARIVRETATTALIDGNAAMGHPTSRMAME
cytopha          DLRGVDSHGVA-RLTGYVRLWEAGRINAKPNVRIVHETPSTATVDGDGGLGLVVAPIAMQ
ORF_KN17770      DLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQVGPKAMK
entamoeba        DKQGMDTHGIQRLKTIYCDRIDCGQLNTKTVFDVVKETETTAVVDGHNGMGHSIAMQAMQ
brady            NLAGHDSHGVI-AVPTYIDRIKAGHIVPGATWTIIQESPTTTVIDGHWGFGFHVNAKAMA
sinorhi          DLRGVSSHGVA-RLGSYLDRIRAGVMEIDPQMRLIREAPASGLLDAGNGFGQIAGMTAME
                 :  * .:**:      *     ..     .    ::*   :   *.  .:*      ** 

bordet2          MAVDKAFEHGVGAVSVRNSHHFGAAGVYARLAVQRGAVALVTSSATT--LIMVPTHGARP
bordet1          MAVDKAFEHGVGAVSVRNSHHFGAAGVYARLAVQRGAVALVTSSATT--LIMVPTHGARP
bordet3          MAVDKAFEHGVGAVSVRNSHHFGAAGVYARLAVQRGAVALVTSSATT--LIMVPTHGARP
azobact          LAADKAQGVGLGAVAVRNSNHFGAAGLYARAAAERGLIGLVASTTRS--PMLVPTRARVP
burkhol          LAIEKALACDMGAVSVFNSQHFGAAGYYAEMAAERGLIALVSCSTRL--ATVVPTFGAEP
cytopha          IAIDKAKQVGSGWVSVKNSNHYGIAGYHAMMALEHDMIGISMTNAS---PLVAPTNSLKR
ORF_KN17770      LAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGG--RLQVPVFGSET
entamoeba        LAIDKAKKHGMGMVVVRNGTHYGIAGYYPQMAAQQGCIGFSGCNAR---PSVCPCWSVEP
brady            LTIEKAKTANVAACTVFRQSHVGRLAAYPLMAMREGMIGIATADSGRSPKHVAPFGGKEA
sinorhi          IAIEKAKSAGSAVIGIANSNHFGVAAYFAERATRAGMVGIVLTNSSP---AMTAFNTRIP
                 :: :**   . .   : .  * *  . ..  * . . :.:    :        .      

bordet2          MLGTNPIAFGAPAAHNDALLLDMATTTVAANKVKVYDYYGKPLPPGWAVDGAGAGVTDSA
bordet1          MLGTNPIAFGAPAAHNDALLLDMATTTVAANKVKVYDYYGKPLPPGWAVDGAGAGVTDSA
bordet3          MLGTNPIAFGAPAAHNDALLLDMATTTVAANKVKVYDYYGKPLPPGWAVDGAGAGVTDSA
azobact          VLGTNPIAFAAPARRNRPFVLDMATTTVAANKVKVYDLQGKDIPPGWVVDEAGRPVTAGE
burkhol          MLGTNPFAFATPAGRHPPVILDMSTSVVASNKVKVYALQGKPLPPGWALDANGNPLTDSA
cytopha          LLGTNPIAVAIPAKNEPPMVADFATTTAANGKLEILQRKNLDAPLGWIQDKNGVTTPN--
ORF_KN17770      VFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPIMDPV
entamoeba        KLGTNPLVFAFPSDEGFPFCLDCATSIVQRGKIEMYAREGKKCQPGWVCDRSGKVLSEP-
brady            RLGTNPISIAVPSDLDAPFYLDMATSAVAAGKIQLAVARGDKIPTGWIIDAEGRHTNDP-
sinorhi          LIGTNPIAFGIPAGAERPIILDMSTSLVARGKIRLASLTGKPIPLGWAYDDRGLSTEDA-
                  :**:*:  . *:    ..  * :*: .  .*: :    .     **  *  *       

bordet2          AAMQFIFQRPEGGLTPLGG-TAEMSSHKGYGLAIMAQVLGGTLGGSLMA------ARHAA
bordet1          AAMQFIFQRPEGGLTPLGG-TAEMSSHKGYGLAIMAQVLGGTLGGSLMA------ARHAA
bordet3          AAMQFIFQRPEGGLTPLGG-TAEMSSHKGYGLAIMAQVLGGTLGGSLMA------ARHAA
azobact          RAMEYLFRRPEGGLTALGG-VAELGSHKGYGLGMLAQILAGPLCGAAFG------ARREA
burkhol          EAYRLLFERLGGGLAPLGGDGKTLGGHKGYGLGLFAQILGSTLGGGSFS------PVRNR
cytopha          ----AHELKDGGALLPLGG-DREHGSHKGYCLGSIVDIFSAVLSGANYGPWVPPFVSFLP
ORF_KN17770      DS----PNYGGFYMLPFGG-TRENGGHKGYGFATIVDIMSGILSGNGPG-----------
entamoeba        GPMLEAFQKGTAACYPLGGYGEEMGGHKGYGYACDVEILSSALSGANFLS-----QCGGL
brady            -----TQYRKGGALLPLGG----TEGYKGSGLAAMVEVLCGLLTGLGFG-----------
sinorhi          ------HAALKGSLAPIGG-------PKGAGLSLIIDLLTGVLTGTGLTG------EVKN
                                .:**        **   .   ::: . * *               

bordet2          RRRPDDPDDVGHFFLALDPDAFRAGGSFESEMDDLIDTLHDTPAADPAQPVLVPGDPEAA
bordet1          RRRPDDPDDVGHFFLALDPDAFRAGGSFESEMDDLIDTLHDTPAADPAQPVLVPGDPEAA
bordet3          RRRPDDPDDVGHFFLALDPDAFRAGGSFESEMDDLIDTLHDTPAADPAQPVLVPGDPEAA
azobact          DEKP----NIGHFFLALDPRAFRDADEFEDELDAIVDALHATPAADPALPVLVAGDPEAQ
burkhol          TQKSDEPDNIGHFFLAMNPAAFRPIEEYHADLDAVIDALRESQPADPAQPVLIPGDPERL
cytopha          VPSDPVGEGIGHFFGAMRVDAFRPADDFKTHMDNWITTFRNAPAVE-GEKVLIPGDPERE
ORF_KN17770      --FLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE-----------------------
entamoeba        KDGKKVPIELGQFFMAINIESFRPLADFEKQVGDIARELRAAAKAPGATRIYTPGEKEHE
brady            -VEPTGRHNDGCFMAVFNVAAFRPLKEFKREVAEFARYLKSTPPSEGSTGVYYPGEIEGV
sinorhi          ITDISGPSRTGHLMIAFDVSRFISPELFKSSVDSVVANIKAMPSAD-GGPVFMPGEMEAI
                           . :. .:    *     :.  :                            

bordet2          ERARRLRDGVPLAAALRERLRRICERSGAEYVLDAG--------
bordet1          ERARRLRDGVPLAAALRERLRRICERSGAEYVLDAG--------
bordet3          ERARRLRDGVPLAAALRERLRRICERSGAEYVLDAG--------
azobact          TRETRLREGIPLPDRLQAQLREICRRSGVAYRLEGVAPSPEVAR
burkhol          TRAARSAEGIPMPDSLREKIREVAKAAGAPFLLAV---------
cytopha          IQFSRLNEGVPLLEPVVKDLKEVAEKLGVAFIE-----------
ORF_KN17770      --------------------------------------------
entamoeba        TFLERSQKGVFIPEVTRSEMEKLRADCKLDTKFPWDN-------
brady            REQQRLRDGIEVEDATWDKLRALAREYRLDTVLDLA--------
sinorhi          GAERRARDGIGVPRDIVDTLRGLSVTYLGELRL-----------
                                                             

BLAST

Blastp vs NR : 


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,196,452 sequences; 1,444,328,266 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  ORF_KN17770 traduction [2-832 sens indirect]
Length=277


Sequences producing significant alignments:                       (Bits)  Value

gi|110636744|ref|YP_676951.1|  probable malate/L-lactate dehyd...   202    1e-50 
gi|14521063|ref|NP_126538.1|  malate dehydrogenase [Pyrococcus...   184    3e-45 
gi|14591091|ref|NP_143166.1|  malate dehydrogenase [Pyrococcus...   181    2e-44 
gi|62738102|pdb|1V9N|A  Chain A, Structure Of Malate Dehydroge...   167    4e-40 
gi|56965806|ref|YP_177540.1|  ureidoglycolate dehydrogenase [B...   165    2e-39 
gi|110633419|ref|YP_673627.1|  Malate/L-lactate dehydrogenase ...   165    3e-39 
gi|83766533|dbj|BAE56673.1|  unnamed protein product [Aspergillus   161    3e-38
gi|85859328|ref|YP_461530.1|  malate/L-lactate dehydrogenase [...   160    7e-38 
gi|67467274|ref|XP_649756.1|  malate dehydrogenase [Entamoeba ...   159    1e-37 
gi|15669616|ref|NP_248429.1|  malate dehydrogenase [Methanocal...   157    6e-37 
gi|89095889|ref|ZP_01168783.1|  hypothetical protein B14911_04...   151    3e-35
gi|67480503|ref|XP_655601.1|  malate dehydrogenase [Entamoeba ...   151    3e-35 
gi|118035557|ref|ZP_01506965.1|  Malate/L-lactate dehydrogenas...   150    8e-35
gi|67153740|ref|ZP_00415485.1|  Malate/L-lactate dehydrogenase...   148    3e-34
gi|47168770|pdb|1RFM|A  Chain A, Sulfolactate Dehydrogenase Fr...   147    5e-34 
gi|33597138|ref|NP_884781.1|  putative malate dehydrogenase [B...   147    7e-34 
gi|27382692|ref|NP_774221.1|  putative dehydrogenase [Bradyrhi...   146    1e-33 
gi|33600982|ref|NP_888542.1|  putative malate dehydrogenase [B...   146    1e-33 
gi|15893856|ref|NP_347205.1|  Malate dehydrogenase [Clostridiu...   145    2e-33 
gi|33593736|ref|NP_881380.1|  putative malate dehydrogenase [B...   144    3e-33 
gi|54641053|gb|EAL29804.1|  GA10363-PA [Drosophila pseudoobscura]   144    6e-33
gi|89095791|ref|ZP_01168685.1|  malate dehydrogenase [Bacillus...   142    1e-32
gi|13488244|ref|NP_085760.1|  probable malate dehydrogenase [M...   142    2e-32 
gi|16078297|ref|NP_389114.1|  hypothetical protein BSU12320 [B...   141    4e-32 
gi|67479405|ref|XP_655084.1|  malate dehydrogenase [Entamoeba ...   140    7e-32 
gi|67527070|gb|AAY68339.1|  putative malate dehydrogenase [unc...   140    8e-32
gi|39964697|ref|XP_365027.1|  hypothetical protein MG09872.4 [Mag   138    2e-31 
gi|91086651|ref|XP_967440.1|  PREDICTED: similar to CG10512-PA...   138    3e-31 
gi|24667904|ref|NP_649289.2|  CG10512-PA, isoform A [Drosophil...   137    5e-31 
gi|15010470|gb|AAK77283.1|  GH06154p [Drosophila melanogaster]      137    5e-31 
gi|66523770|ref|XP_393999.2|  PREDICTED: similar to VF13D12L.3 [A   136    1e-30 
gi|24667908|ref|NP_730605.1|  CG10512-PB, isoform B [Drosophil...   135    2e-30 
gi|24667912|ref|NP_730606.1|  CG10512-PC, isoform C [Drosophil...   135    2e-30 
gi|116201731|ref|XP_001226677.1|  hypothetical protein CHGG_08...   135    2e-30 
gi|90297943|gb|EAS27574.1|  hypothetical protein CIMG_10179 [Cocc   134    3e-30
gi|28379550|ref|NP_786442.1|  malate dehydrogenase (putative) ...   134    3e-30 
gi|109646806|ref|ZP_01370710.1|  Malate/L-lactate dehydrogenas...   134    6e-30
gi|89896203|ref|YP_519690.1|  hypothetical protein DSY3457 [De...   134    7e-30 
gi|71002066|ref|XP_755714.1|  malate/L-lactate dehydrogenase [...   133    1e-29 
gi|44278|emb|CAA36133.1|  L-malate dehydrogenase (AA 339) [Methan   132    2e-29
gi|126908|sp|P16142|MDH_METFE  Malate/L-sulfolactate dehydroge...   132    2e-29
gi|89056614|ref|YP_512065.1|  Malate/L-lactate dehydrogenase [...   130    5e-29 
gi|45358696|ref|NP_988253.1|  L-sulfolactate dehydrogenase/(S)...   130    6e-29 
gi|58388874|ref|XP_316604.2|  ENSANGP00000025275 [Anopheles gambi   130    6e-29 
gi|116127193|gb|EAA44260.3|  ENSANGP00000025275 [Anopheles gambia   130    6e-29
gi|67901292|ref|XP_680902.1|  hypothetical protein AN7633.2 [A...   128    4e-28 
gi|113872023|ref|ZP_01412152.1|  Malate dehydrogenase (NADP+) ...   127    4e-28
gi|92089586|ref|ZP_01274524.1|  Malate/L-lactate dehydrogenase...   126    1e-27
gi|52079536|ref|YP_078327.1|  putative Ureidoglycolate dehydro...   125    2e-27 
gi|90419349|ref|ZP_01227259.1|  putative malate dehydrogenase ...   125    2e-27
gi|90418628|ref|ZP_01226539.1|  putative malate/L-lactate dehy...   125    2e-27
gi|28377875|ref|NP_784767.1|  malate / lactate dehydrogenase [...   125    3e-27 
gi|89090677|ref|ZP_01163719.1|  malate / lactate dehydrogenase...   124    6e-27
gi|47225928|emb|CAF98408.1|  unnamed protein product [Tetraodon n   122    1e-26
gi|77976888|ref|ZP_00832355.1|  COG2055: Malate/L-lactate dehy...   122    2e-26
gi|15679216|ref|NP_276333.1|  malate dehydrogenase [Methanothe...   122    2e-26 
gi|27378028|ref|NP_769557.1|  hypothetical oxidoreductase [Bra...   122    2e-26 
gi|15891722|ref|NP_357394.1|  hypothetical protein AGR_L_3209 ...   120    5e-26 
gi|111069064|gb|EAT90184.1|  hypothetical protein SNOG_01972 [Pha   120    5e-26
gi|91086649|ref|XP_967350.1|  PREDICTED: similar to CG10512-PA...   120    7e-26 
gi|46124275|ref|XP_386691.1|  hypothetical protein FG06515.1 [...   120    8e-26 
gi|113867275|ref|YP_725764.1|  Malate/L-lactate dehydrogenase ...   119    2e-25 
gi|39936817|ref|NP_949093.1|  malate dehydrogenase-like protei...   118    3e-25 
gi|86748833|ref|YP_485329.1|  Malate/L-lactate dehydrogenase [...   118    3e-25 
gi|16766382|ref|NP_461997.1|  putative malate/L-lactate dehydr...   118    3e-25 
gi|23100301|ref|NP_693768.1|  malate dehydrogenase [Oceanobaci...   118    3e-25 
gi|52079537|ref|YP_078328.1|  putative ureidoglycolate dehydro...   117    6e-25 
gi|73541189|ref|YP_295709.1|  Malate/L-lactate dehydrogenase [...   117    6e-25 
gi|75189842|ref|ZP_00703109.1|  COG2055: Malate/L-lactate dehy...   117    6e-25
gi|62181592|ref|YP_218009.1|  putative malate/L-lactate dehydr...   117    6e-25 
gi|46255106|ref|YP_006018.1|  dehydrogenase [Thermus thermophi...   117    7e-25 
gi|71083506|ref|YP_266225.1|  Malate/L-sulfolactate dehydrogen...   117    8e-25 
gi|73539123|ref|YP_299490.1|  Malate/L-lactate dehydrogenase [...   116    9e-25 
gi|91762076|ref|ZP_01264041.1|  Malate/L-sulfolactate dehydrog...   116    1e-24
gi|91978052|ref|YP_570711.1|  Malate/L-lactate dehydrogenase [...   116    1e-24 
gi|16128769|ref|NP_415322.1|  predicted dehydrogenase [Escheri...   116    1e-24 
gi|75230644|ref|ZP_00717115.1|  COG2055: Malate/L-lactate dehydro   116    1e-24
gi|20093830|ref|NP_613677.1|  L-sulfolactate dehydrogenase [Me...   116    1e-24 
gi|111612553|ref|ZP_01399639.1|  Malate/L-lactate dehydrogenas...   115    2e-24
gi|47571511|ref|ZP_00241563.1|  COG2055: Malate/L-lactate dehy...   115    2e-24
gi|5051810|emb|CAB45039.1|  putative carboxylic acid dehydroge...   115    3e-24
gi|16759503|ref|NP_455120.1|  ureidoglycolate dehydrogenase [S...   114    3e-24 
gi|91209835|ref|YP_539821.1|  hypothetical oxidoreductase YbiC...   114    4e-24 
gi|117622983|ref|YP_851896.1|  hypothetical oxidoreductase [Es...   114    4e-24 
gi|110641005|ref|YP_668733.1|  putative malate/L-lactate dehyd...   114    4e-24 
gi|26246775|ref|NP_752815.1|  Hypothetical oxidoreductase ybiC...   114    4e-24 
gi|75236141|ref|ZP_00720265.1|  COG2055: Malate/L-lactate dehy...   114    4e-24
gi|75178409|ref|ZP_00698463.1|  COG2055: Malate/L-lactate dehy...   114    5e-24
gi|75189580|ref|ZP_00702847.1|  COG2055: Malate/L-lactate dehy...   114    5e-24
gi|15830133|ref|NP_308906.1|  putative dehydrogenase [Escheric...   114    5e-24 
gi|15800553|ref|NP_286565.1|  putative dehydrogenase [Escheric...   114    5e-24 
gi|75194730|ref|ZP_00704800.1|  COG2055: Malate/L-lactate dehydro   114    5e-24
gi|82776122|ref|YP_402469.1|  putative dehydrogenase [Shigella...   114    5e-24 
gi|83587032|ref|ZP_00925662.1|  COG2055: Malate/L-lactate dehy...   114    5e-24
gi|15800254|ref|NP_286266.1|  putative malate dehydrogenase [E...   114    5e-24 
gi|16763908|ref|NP_459523.1|  ureidoglycolate dehydrogenase [S...   114    5e-24 
gi|56414320|ref|YP_151395.1|  ureidoglycolate dehydrogenase [S...   114    5e-24 
gi|24112169|ref|NP_706679.1|  putative dehydrogenase [Shigella...   114    6e-24 
gi|78695712|ref|ZP_00860223.1|  malate dehydrogenase-like prot...   114    6e-24
gi|75209179|ref|ZP_00709430.1|  COG2055: Malate/L-lactate dehy...   113    9e-24
gi|91789808|ref|YP_550760.1|  Malate/L-lactate dehydrogenase [...   113    1e-23 
gi|94310576|ref|YP_583786.1|  Malate/L-lactate dehydrogenase [...   113    1e-23 
gi|16128501|ref|NP_415050.1|  ureidoglycolate dehydrogenase [E...   113    1e-23 
gi|55978261|ref|YP_145317.1|  malate/L-lactate dehydrogenase f...   112    1e-23 
gi|26246525|ref|NP_752564.1|  Ureidoglycolate dehydrogenase [E...   112    1e-23 
gi|147603|gb|AAA53657.1|  YbiC                                      112    2e-23
gi|90423207|ref|YP_531577.1|  Malate/L-lactate dehydrogenase [...   112    2e-23 
gi|17936919|ref|NP_533708.1|  malate dehydrogenase [Agrobacter...   112    2e-23 
gi|26249584|ref|NP_755624.1|  Ureidoglycolate dehydrogenase [E...   111    3e-23 
gi|91212431|ref|YP_542417.1|  ureidoglycolate dehydrogenase [E...   111    3e-23 
gi|110643256|ref|YP_670986.1|  putative malate/L-lactate dehyd...   111    3e-23 
gi|13488218|ref|NP_085676.1|  malate dehydrogenase-like protei...   111    3e-23 
gi|72384165|ref|YP_293519.1|  Malate/L-lactate dehydrogenase [...   111    4e-23 
gi|10956557|ref|NP_052200.1|  hypothetical protein pLH1_p12 [L...   111    4e-23 
gi|17507179|ref|NP_492378.1|  F36A2.3 [Caenorhabditis elegans]...   110    5e-23 
gi|118035324|ref|ZP_01506732.1|  Malate/L-lactate dehydrogenas...   110    6e-23
gi|62179137|ref|YP_215554.1|  ureidoglycolate dehydrogenase [S...   110    7e-23 
gi|78061633|ref|YP_371541.1|  Malate/L-lactate dehydrogenase [...   110    8e-23 
gi|116694887|ref|YP_729098.1|  Malate/L-lactate dehydrogenase ...   109    1e-22 
gi|85097976|ref|XP_960548.1|  hypothetical protein [Neurospora...   108    2e-22 
gi|89895991|ref|YP_519478.1|  hypothetical protein DSY3245 [De...   108    2e-22 
gi|115359089|ref|YP_776227.1|  Malate/L-lactate dehydrogenase ...   108    2e-22 
gi|83769545|dbj|BAE59680.1|  unnamed protein product [Aspergillus   108    2e-22
gi|84489100|ref|YP_447332.1|  ComC [Methanosphaera stadtmanae ...   108    2e-22 
gi|109649238|ref|ZP_01373130.1|  Malate/L-lactate dehydrogenas...   108    2e-22
gi|39589739|emb|CAE66974.1|  Hypothetical protein CBG12370 [Caeno   108    2e-22
gi|56554681|pdb|1XRH|A  Chain A, Crystal Structure Of Ureidogl...   108    3e-22 
gi|99032427|pdb|2G8Y|A  Chain A, The Structure Of A Putative M...   108    3e-22 
gi|29375025|ref|NP_814178.1|  ureidoglycolate dehydrogenase [E...   108    3e-22 
gi|84354615|ref|ZP_00979517.1|  COG2055: Malate/L-lactate dehy...   108    3e-22
gi|39597477|emb|CAE59707.1|  Hypothetical protein CBG03139 [Caeno   108    4e-22
gi|107026073|ref|YP_623584.1|  (R)-2-hydroxyacid dehydrogenase...   107    5e-22 
gi|91086647|ref|XP_967269.1|  PREDICTED: similar to CG10512-PA...   107    5e-22 
gi|116694288|ref|YP_728499.1|  Malate-dehydrogenase [Ralstonia...   107    6e-22 
gi|118069375|ref|ZP_01537620.1|  Malate/L-lactate dehydrogenas...   106    1e-21
gi|107025812|ref|YP_623323.1|  Malate/L-lactate dehydrogenase ...   106    1e-21 
gi|84352516|ref|ZP_00977472.1|  COG2055: Malate/L-lactate dehy...   105    2e-21
gi|115424228|emb|CAJ50781.1|  L-lactate dehydrogenase [Bordetella   105    2e-21
gi|46093542|dbj|BAD15001.1|  ureidoglycolate dehydrogenase [Klebs   105    2e-21
gi|84359429|ref|ZP_00984174.1|  COG2055: Malate/L-lactate dehy...   105    2e-21
gi|17536633|ref|NP_496500.1|  VF13D12L.3 [Caenorhabditis elega...   105    3e-21 
gi|15966300|ref|NP_386653.1|  PUTATIVE OXIDOREDUCTASE PROTEIN ...   104    3e-21 
gi|59711859|ref|YP_204635.1|  L-sulfolactate dehydrogenase [Vi...   104    4e-21 
gi|90421185|ref|ZP_01229086.1|  putative malate/L-lactate dehy...   104    6e-21
gi|33598552|ref|NP_886195.1|  putative L-lactate dehydrogenase...   103    6e-21 
gi|33591607|ref|NP_879251.1|  putative L-lactate dehydrogenase...   103    8e-21 
gi|90419453|ref|ZP_01227363.1|  putative malate / lactate dehy...   103    1e-20
gi|73917969|gb|AAZ93596.1|  putative malate/L-lactate dehydrog...   102    2e-20
gi|91213590|ref|YP_543576.1|  putative lactate dehydrogenase [...   102    2e-20 
gi|26250851|ref|NP_756891.1|  Putative lactate dehydrogenase [...   102    2e-20 
gi|50120462|ref|YP_049629.1|  putative malate/lactate dehydrog...   102    2e-20 
gi|118029906|ref|ZP_01501365.1|  Malate/L-lactate dehydrogenas...   102    2e-20
gi|75241092|ref|ZP_00724966.1|  COG2055: Malate/L-lactate dehydro   102    3e-20
gi|111019964|ref|YP_702936.1|  possible (R)-2-hydroxyacid dehy...   101    3e-20 
gi|110644399|ref|YP_672129.1|  hypothetical malate/L-lactate d...   101    3e-20 
gi|19551891|ref|NP_599893.1|  malate/L-lactate dehydrogenase [...   101    4e-20 
gi|67643352|ref|ZP_00442099.1|  COG2055: Malate/L-lactate dehy...   101    4e-20
gi|82535284|ref|ZP_00894303.1|  hypothetical protein Bpse110_0...   101    4e-20
gi|67737531|ref|ZP_00488291.1|  COG2055: Malate/L-lactate dehy...   101    5e-20
gi|113873324|ref|ZP_01413453.1|  putative malate dehydrogenase...   100    6e-20
gi|113874355|ref|ZP_01414483.1|  Malate dehydrogenase [Sinorhi...   100    7e-20
gi|62317833|ref|YP_223686.1|  malate/L-lactate dehydrogenase f...   100    8e-20 
gi|17989350|ref|NP_541983.1|  MALATE DEHYDROGENASE [Brucella m...   100    8e-20 
gi|23499997|ref|NP_699437.1|  malate/L-lactate dehydrogenase f...   100    9e-20 
gi|53721363|ref|YP_110348.1|  malate/L-lactate dehydrogenase [...  99.8    1e-19 
gi|53716983|ref|YP_106029.1|  malate/L-lactate dehydrogenase f...  99.8    1e-19 
gi|118068952|ref|ZP_01537201.1|  Malate/L-lactate dehydrogenas...  99.8    1e-19
gi|113866693|ref|YP_725182.1|  L-Lactate dehydrogenase [Ralsto...  99.4    2e-19 
gi|113874618|ref|ZP_01414745.1|  (R)-2-hydroxyacid dehydrogena...  99.4    2e-19
gi|89069217|ref|ZP_01156584.1|  hypothetical protein OG2516_17...  99.0    2e-19
gi|115400429|ref|XP_001215803.1|  conserved hypothetical prote...  98.6    3e-19 
gi|16262594|ref|NP_435387.1|  hypothetical protein SMa0265 [Si...  98.6    3e-19 
gi|107026578|ref|YP_624089.1|  Malate/L-lactate dehydrogenase ...  98.2    3e-19 
gi|108884392|gb|EAT48617.1|  malate dehydrogenase [Aedes aegypti]  98.2    4e-19
gi|16263999|ref|NP_436791.1|  putative malate dehydrogenase pr...  98.2    4e-19 
gi|90414109|ref|ZP_01222091.1|  L-sulfolactate dehydrogenase [...  98.2    4e-19
gi|115358297|ref|YP_775435.1|  Malate/L-lactate dehydrogenase ...  97.8    4e-19 
gi|78062748|ref|YP_372656.1|  Malate/L-lactate dehydrogenase [...  97.4    6e-19 
gi|69934734|ref|ZP_00629765.1|  Malate/L-lactate dehydrogenase...  97.4    6e-19
gi|67544827|ref|ZP_00422753.1|  Malate/L-lactate dehydrogenase...  97.4    6e-19
gi|94314014|ref|YP_587223.1|  Malate/L-lactate dehydrogenase [...  97.4    7e-19 
gi|67545910|ref|ZP_00423828.1|  Malate/L-lactate dehydrogenase...  96.7    1e-18
gi|110635621|ref|YP_675829.1|  Malate/L-lactate dehydrogenase ...  96.7    1e-18 
gi|100058037|ref|ZP_01320745.1|  hypothetical protein BpseP_03...  96.7    1e-18
gi|116623792|ref|YP_825948.1|  Malate dehydrogenase [Solibacte...  95.9    2e-18 
gi|83716318|ref|YP_440259.1|  malate/L-lactate dehydrogenase f...  95.5    2e-18 
gi|56460318|ref|YP_155599.1|  Malate/L-lactate dehydrogenase f...  95.5    2e-18 
gi|94412692|ref|ZP_01292599.1|  hypothetical protein PaerP_010...  95.5    3e-18
gi|90289941|ref|ZP_01209632.1|  hypothetical protein Bpse17_02...  94.7    4e-18
gi|110635876|ref|YP_676084.1|  Malate/L-lactate dehydrogenase ...  94.7    4e-18 
gi|15596449|ref|NP_249943.1|  probable L-malate dehydrogenase ...  94.7    5e-18 
gi|84322014|ref|ZP_00970361.1|  COG2055: Malate/L-lactate dehy...  94.7    5e-18
gi|110347247|ref|YP_666064.1|  Malate/L-lactate dehydrogenase ...  94.0    6e-18 
gi|49087562|gb|AAT51472.1|  PA1252 [synthetic construct]           94.0    7e-18
gi|76817841|ref|YP_337039.1|  malate/L-lactate dehydrogenase f...  93.6    9e-18 
gi|70728796|ref|YP_258545.1|  malate/L-lactate dehydrogenase f...  93.2    1e-17 
gi|72157793|ref|XP_789073.1|  PREDICTED: hypothetical protein ...  93.2    1e-17 
gi|111614450|ref|ZP_01401526.1|  conserved hypothetical oxidor...  93.2    1e-17
gi|111017677|ref|YP_700649.1|  probable dehydrogenase [Rhodoco...  93.2    1e-17 
gi|94309504|ref|YP_582714.1|  Malate/L-lactate dehydrogenase [...  92.8    1e-17 
gi|114569262|ref|YP_755942.1|  Malate/L-lactate dehydrogenase ...  92.4    2e-17 
gi|83944043|ref|ZP_00956500.1|  Malate/L-lactate dehydrogenase...  92.4    2e-17
gi|27381385|ref|NP_772914.1|  putative dehydrogenase [Bradyrhi...  90.5    9e-17 
gi|83954594|ref|ZP_00963305.1|  Malate/L-lactate dehydrogenase...  90.1    1e-16
gi|33603656|ref|NP_891216.1|  putative malate/L-lactate dehydr...  89.4    2e-16 
gi|111614284|ref|ZP_01401361.1|  putative malate/L-lactate deh...  88.6    3e-16
gi|111025625|ref|YP_708045.1|  probable malate/L-lactate dehyd...  88.2    4e-16 
gi|69934723|ref|ZP_00629754.1|  Malate/L-lactate dehydrogenase...  87.8    4e-16
gi|104781757|ref|YP_608255.1|  malate dehydrogenase [Pseudomon...  87.8    5e-16 
gi|70729569|ref|YP_259307.1|  malate/L-lactate dehydrogenase f...  87.0    8e-16 
gi|99078299|ref|YP_611557.1|  Malate/L-lactate dehydrogenase [...  86.3    1e-15 
gi|116249266|ref|YP_765107.1|  putative L-lactate dehydrogenas...  86.3    1e-15 
gi|90419860|ref|ZP_01227769.1|  putative malate/L-lactate dehy...  85.9    2e-15
gi|17938365|ref|NP_535154.1|  malate dehydrogenase [Agrobacter...  85.9    2e-15 
gi|73537366|ref|YP_297733.1|  (R)-2-hydroxyacid dehydrogenase ...  85.5    2e-15 
gi|15890316|ref|NP_355988.1|  hypothetical protein AGR_L_410 [...  85.5    2e-15 
gi|69938793|ref|ZP_00633177.1|  Malate/L-lactate dehydrogenase...  85.1    3e-15
gi|92113894|ref|YP_573822.1|  Malate dehydrogenase (NADP+) [Ch...  85.1    3e-15 
gi|89068771|ref|ZP_01156157.1|  putative malate dehydrogenase ...  84.7    4e-15
gi|116248901|ref|YP_764742.1|  putative L-lactate dehydrogenas...  84.7    4e-15 
gi|86361096|ref|YP_472983.1|  putative malate dehydrogenase pr...  84.3    5e-15 
gi|26990302|ref|NP_745727.1|  malate dehydrogenase, putative [...  84.3    5e-15 
gi|54641410|gb|EAL30160.1|  GA15088-PA [Drosophila pseudoobscura]  84.3    5e-15
gi|59857480|dbj|BAD89743.1|  delta1-piperideine-2-carboxylate red  84.3    6e-15
gi|85711052|ref|ZP_01042112.1|  Malate/L-lactate dehydrogenase...  84.0    6e-15
gi|33593504|ref|NP_881148.1|  putative dehydrogenase [Bordetel...  83.2    1e-14 
gi|82735606|ref|ZP_00898468.1|  malate dehydrogenase, putative...  82.8    2e-14
gi|56696487|ref|YP_166844.1|  malate/L-lactate dehydrogenase f...  82.0    3e-14 
gi|110592411|ref|ZP_01380767.1|  Malate/L-lactate dehydrogenas...  82.0    3e-14
gi|91763301|ref|ZP_01265265.1|  hypothetical oxidoreductase yi...  81.6    3e-14
gi|77458792|ref|YP_348298.1|  Malate/L-lactate dehydrogenase [...  81.6    4e-14 
gi|91789812|ref|YP_550764.1|  Malate/L-lactate dehydrogenase [...  80.9    6e-14 
gi|85707345|ref|ZP_01038428.1|  putative malate dehydrogenase ...  80.9    6e-14
gi|56698019|ref|YP_168390.1|  malate/L-lactate dehydrogenase f...  80.5    8e-14 
gi|90417051|ref|ZP_01224979.1|  hypothetical oxidoreductase yi...  80.1    1e-13
gi|75238136|ref|ZP_00722140.1|  COG2055: Malate/L-lactate dehydro  79.7    1e-13
gi|70730272|ref|YP_260011.1|  malate/L-lactate dehydrogenase f...  79.3    2e-13 
gi|56757642|gb|AAW26972.1|  SJCHGC06758 protein [Schistosoma japo  77.8    6e-13 
gi|110636289|ref|YP_676497.1|  Malate/L-lactate dehydrogenase ...  77.4    7e-13 
gi|71083658|ref|YP_266378.1|  hypothetical oxidoreductase yiaK...  77.0    8e-13 
gi|83949526|ref|ZP_00958259.1|  malate/L-lactate dehydrogenase...  77.0    8e-13
gi|118030263|ref|ZP_01501721.1|  Malate/L-lactate dehydrogenas...  77.0    9e-13
gi|45825095|gb|AAS77455.1|  AT20429p [Drosophila melanogaster]     77.0    9e-13 
gi|24658010|ref|NP_652668.1|  CG18808-PA [Drosophila melanogas...  77.0    9e-13 
gi|83371055|ref|ZP_00915880.1|  malate dehydrogenase [Rhodobac...  77.0    9e-13
gi|116054892|emb|CAL56969.1|  unnamed protein product [Ostreococc  76.6    1e-12
gi|71734358|ref|YP_274337.1|  dehydrogenase, malate/L-lactate ...  76.3    1e-12 
gi|115673528|ref|XP_783696.2|  PREDICTED: hypothetical protein...  75.9    2e-12 
gi|54639611|gb|EAL29013.1|  GA14384-PA [Drosophila pseudoobscura]  75.9    2e-12
gi|86136306|ref|ZP_01054885.1|  malate/L-lactate dehydrogenase...  75.1    3e-12
gi|114705647|ref|ZP_01438550.1|  malate dehydrogenase [Fulvima...  75.1    3e-12
gi|87119857|ref|ZP_01075753.1|  malate/L-lactate dehydrogenase...  75.1    4e-12
gi|85704866|ref|ZP_01035967.1|  malate/L-lactate dehydrogenase...  74.7    5e-12
gi|15887519|ref|NP_353200.1|  hypothetical protein AGR_C_268 [...  74.7    5e-12 
gi|67904132|ref|XP_682322.1|  hypothetical protein AN9053.2 [A...  73.9    7e-12 
gi|78100860|pdb|1WTJ|A  Chain A, Crystal Structure Of Delta1-P...  73.9    7e-12 
gi|99078362|ref|YP_611620.1|  Malate/L-lactate dehydrogenase [...  73.2    1e-11 
gi|28869556|ref|NP_792175.1|  ureidoglycolate dehydrogenase [P...  72.8    2e-11 
gi|90421634|ref|YP_530004.1|  (R)-2-hydroxyacid dehydrogenase ...  72.0    3e-11 
gi|92113875|ref|YP_573803.1|  Malate/L-lactate dehydrogenase [...  71.6    3e-11 
gi|66045383|ref|YP_235224.1|  Malate/L-lactate dehydrogenase [...  71.6    3e-11 
gi|106883283|ref|ZP_01350681.1|  Malate/L-lactate dehydrogenas...  71.2    4e-11
gi|69934100|ref|ZP_00629236.1|  (R)-2-hydroxyacid dehydrogenas...  71.2    5e-11
gi|110679330|ref|YP_682337.1|  malate/L-lactate dehydrogenase,...  70.5    8e-11 
gi|114769732|ref|ZP_01447342.1|  hypothetical protein OM2255_0...  70.1    1e-10
gi|75188339|ref|ZP_00701606.1|  COG2055: Malate/L-lactate dehy...  70.1    1e-10
gi|82735354|ref|ZP_00898217.1|  oxidoreductase, Ldh family [Ps...  70.1    1e-10
gi|18446938|gb|AAL68061.1|  AT13460p [Drosophila melanogaster]     69.7    1e-10 
gi|466713|gb|AAB18552.1|  unnamed protein product [Escherichia co  69.7    1e-10
gi|16131446|ref|NP_418032.1|  2,3-diketo-L-gulonate dehydrogen...  69.7    1e-10 
gi|83571371|ref|ZP_00922811.1|  COG2055: Malate/L-lactate dehy...  69.7    1e-10
gi|24114850|ref|NP_709360.1|  putative dehydrogenase [Shigella...  69.7    1e-10 
gi|82545946|ref|YP_409893.1|  putative dehydrogenase [Shigella...  69.7    1e-10 
gi|75179829|ref|ZP_00699816.1|  COG2055: Malate/L-lactate dehy...  69.7    1e-10
gi|26250218|ref|NP_756258.1|  Hypothetical oxidoreductase yiaK...  69.7    2e-10 
gi|75242635|ref|ZP_00726379.1|  COG2055: Malate/L-lactate dehy...  69.3    2e-10
gi|16272965|ref|NP_439191.1|  hypothetical protein HI1031 [Hae...  69.3    2e-10 
gi|40063593|gb|AAR38382.1|  malate/L-lactate dehydrogenase fam...  69.3    2e-10
gi|24648360|ref|NP_650868.1|  CG17199-PA [Drosophila melanogas...  68.9    3e-10 
gi|33595974|ref|NP_883617.1|  putative malate/L-lactate dehydr...  68.6    3e-10 
gi|26989554|ref|NP_744979.1|  oxidoreductase, Ldh family [Pseu...  68.6    3e-10 
gi|75434564|ref|ZP_00733236.1|  malate/L-lactate dehydrogenase...  68.2    4e-10
gi|33601355|ref|NP_888915.1|  putative malate/L-lactate dehydr...  68.2    4e-10 
gi|16762642|ref|NP_458259.1|  putative carboxylic acid dehydro...  67.8    5e-10 
gi|111613989|ref|ZP_01401067.1|  Malate dehydrogenase (NADP+) ...  67.0    8e-10
gi|118067122|ref|ZP_01535380.1|  Malate/L-lactate dehydrogenas...  67.0    9e-10
gi|52424109|ref|YP_087246.1|  hypothetical protein MS0054 [Man...  67.0    9e-10 
gi|56415561|ref|YP_152636.1|  putative carboxylic acid dehydro...  66.6    1e-09 
gi|75408999|sp|Q93Q64|DLGD_KLEOX  2,3-diketo-L-gulonate reduct...  66.2    1e-09
gi|16766953|ref|NP_462568.1|  putative malate dehydrogenase [S...  65.9    2e-09 
gi|84028901|sp|Q65WJ9|DLGD_MANSM  2,3-diketo-L-gulonate reduct...  65.9    2e-09
gi|53728574|ref|ZP_00132092.2|  COG2055: Malate/L-lactate dehy...  65.5    2e-09
gi|89054632|ref|YP_510083.1|  Malate/L-lactate dehydrogenase [...  65.5    2e-09 
gi|110807758|ref|YP_691278.1|  putative dehydrogenase [Shigell...  64.7    5e-09 
gi|42543687|pdb|1S20|A  Chain A, A Novel Nad Binding Protein R...  63.9    7e-09 
gi|15603121|ref|NP_246193.1|  hypothetical protein PM1256 [Pas...  63.9    7e-09 
gi|29726849|pdb|1NXU|A  Chain A, Crystal Structure Of E. Coli ...  63.9    8e-09 
gi|33598579|ref|NP_886222.1|  probable malate/L-lactate dehydr...  63.5    9e-09 
gi|16263249|ref|NP_436042.1|  hypothetical protein SMa1459 [Si...  63.5    1e-08 
gi|33603529|ref|NP_891089.1|  probable malate/L-lactate dehydr...  63.2    1e-08 
gi|91222831|ref|ZP_01258143.1|  hypothetical oxidoreductase yi...  63.2    1e-08
gi|13474334|ref|NP_105902.1|  similar to malate dehydrogenase ...  62.4    2e-08 
gi|106887232|ref|ZP_01354546.1|  Malate/L-lactate dehydrogenas...  61.6    4e-08
gi|75515963|ref|ZP_00738081.1|  COG2055: Malate/L-lactate dehy...  61.2    6e-08
gi|113874469|ref|ZP_01414596.1|  putative malate dehydrogenase...  60.5    9e-08
gi|86361158|ref|YP_473045.1|  putative malate dehydrogenase pr...  60.5    9e-08 
gi|77980137|ref|ZP_00835552.1|  COG2055: Malate/L-lactate dehy...  58.5    3e-07
gi|62424225|ref|ZP_00379374.1|  COG2055: Malate/L-lactate dehy...  53.1    1e-05
gi|70730909|ref|YP_260650.1|  malate/L-lactate dehydrogenase f...  52.8    2e-05 
gi|20385929|gb|AAM21507.1|AF434799_5  putative malate dehydrogena  52.4    2e-05
gi|53729229|ref|ZP_00133751.2|  COG2055: Malate/L-lactate dehy...  51.2    5e-05
gi|15922415|ref|NP_378084.1|  hypothetical malate dehydrogenas...  48.9    2e-04 
gi|91219478|ref|ZP_01256127.1|  putative malate/L-lactate dehy...  47.4    8e-04
gi|86144642|ref|ZP_01062974.1|  Hypothetical oxidoreductase yi...  47.0    0.001
gi|116249177|ref|YP_765018.1|  putative malate/lactate dehydro...  46.6    0.001 
gi|115712694|ref|XP_795375.2|  PREDICTED: similar to MGC80281 ...  39.3    0.20  
gi|115619249|ref|XP_001182293.1|  PREDICTED: hypothetical prot...  36.6    1.4   
gi|83570223|ref|ZP_00921669.1|  COG2055: Malate/L-lactate dehy...  35.0    3.5  
gi|83716397|ref|YP_440265.1|  lactate permease family protein ...  33.9    7.8   
gi|107025600|ref|YP_623111.1|  TonB-dependent receptor [Burkho...  33.9    9.2   



>gi|110636744|ref|YP_676951.1|  probable malate/L-lactate dehydrogenase [Cytophaga hutchinsonii 
ATCC 33406]
 gi|110279425|gb|ABG57611.1|  probable malate/L-lactate dehydrogenase [Cytophaga hutchinsonii 
ATCC 33406]
Length=381

 Score =  202 bits (515),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 122/288 (42%), Positives = 166/288 (57%), Gaps = 25/288 (8%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            MG  +EDA +AT VL+++DLRG +SHGV+  L  YV +++A R+N +P V+ + ETP +A
Sbjct  43   MGCPQEDAQVATTVLLSADLRGVDSHGVAR-LTGYVRLWEAGRINAKPNVRIVHETPSTA  101

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
            T D D GLG+ V P AM++AI+KA+  G G V+++N  H G+  Y+ +MAL+HDMIGI M
Sbjct  102  TVDGDGGLGLVVAPIAMQIAIDKAKQVGSGWVSVKNSNHYGIAGYHAMMALEHDMIGISM  161

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +A   L  P    + + GT+PIA   PA  +PP V D ATT  A  KL + +R      
Sbjct  162  TNA-SPLVAPTNSLKRLLGTNPIAVAIPAKNEPPMVADFATTTAANGKLEILQRKNLDAP  220

Query  183  PGWITDLEGNPIMDPVDSPNY----GGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             GWI D  G      V +PN      G  +LP GG RE+G HKGY   +IVDI S +LSG
Sbjct  221  LGWIQDKNG------VTTPNAHELKDGGALLPLGGDREHGSHKGYCLGSIVDIFSAVLSG  274

Query  239  NGPG--------FLAGDNKH-----SQFVMAIKIDLFLDAVDFKSDMD  273
               G        FL   +         F  A+++D F  A DFK+ MD
Sbjct  275  ANYGPWVPPFVSFLPVPSDPVGEGIGHFFGAMRVDAFRPADDFKTHMD  322


>gi|14521063|ref|NP_126538.1|  malate dehydrogenase [Pyrococcus abyssi GE5]
 gi|13878573|sp|Q9V0D5|MDH_PYRAB  Malate dehydrogenase
 gi|5458280|emb|CAB49769.1|  mdh malate dehydrogenase [Pyrococcus abyssi GE5]
Length=362

 Score =  184 bits (468),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 157/280 (56%), Gaps = 9/280 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G  EEDA I  D LI +DLRG ESHGV   L+ YV    +  +N  P +K +RE P  
Sbjct  29   KLGTPEEDAKIVADNLIMADLRGIESHGVQR-LKRYVDGILSGGINLHPRIKIIREGPSY  87

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D D G G  VG KAMKLAIEKA  TGIG VA++N  H G+  YY LMA +  MIGI 
Sbjct  88   ALLDGDEGFGQVVGYKAMKLAIEKARKTGIGIVAVRNSNHYGIAGYYALMAAEEGMIGIS  147

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M ++   L  P  G E + GT+PIA  AP  K  PF+ D+AT+ V   KL + RR G ++
Sbjct  148  MTNS-RPLVAPTGGVERILGTNPIALAAPT-KGKPFLLDMATSVVPIGKLEVYRRKGEEI  205

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN--  239
              GW  + +G  I   V+    GG  +   G     GGHKGYG + +VDI+SGILSG   
Sbjct  206  PEGWAINSKGE-ITRSVEEVFNGGSLLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTW  264

Query  240  GPGFLAGDNKHS---QFVMAIKIDLFLDAVDFKSDMDKLL  276
                   + K+S    F MAI I+ F    +FK  M +++
Sbjct  265  SKHVKNTNEKNSNVCHFFMAINIEHFTPLEEFKGRMSEMI  304


>gi|14591091|ref|NP_143166.1|  malate dehydrogenase [Pyrococcus horikoshii OT3]
 gi|7387868|sp|O59028|MDH_PYRHO  Malate dehydrogenase
 gi|3257697|dbj|BAA30380.1|  360aa long hypothetical malate dehydrogenase [Pyrococcus horikoshii 
OT3]
Length=360

 Score =  181 bits (460),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 157/281 (55%), Gaps = 9/281 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G+ EEDA I  D L+ +DLRG ESHGV   L+ YV    +  +N  P+++ +RE P  
Sbjct  29   KLGVPEEDAKIVADNLVMADLRGVESHGVQR-LKRYVDGIISGGVNLHPKIRVIREGPSY  87

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D D GLG  VG ++MKLAI+KA+ TGIG V  +N  H G+  YY LMA +  MIGI 
Sbjct  88   ALIDGDEGLGQVVGYRSMKLAIKKAKDTGIGIVIARNSNHYGIAGYYALMAAEEGMIGIS  147

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M ++   L  P  G E + GT+PIA  AP  K  PF+ D+AT+ V   KL + RR G  +
Sbjct  148  MTNS-RPLVAPTGGIERILGTNPIALAAPT-KDKPFLLDMATSVVPIGKLEVYRRKGKDI  205

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW  + EGN I   V+    GG  +   G     GGHKGYG + +VDI+SGILSG   
Sbjct  206  PEGWAINREGN-ITTKVEEVFNGGALLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTW  264

Query  242  GFLAGDNKHS-----QFVMAIKIDLFLDAVDFKSDMDKLLE  277
                 +          F M I I+ F+   +FK  + +++E
Sbjct  265  SKYVKNTSEKGSNVCHFFMVIDIEHFIPLEEFKEKISQMIE  305


>gi|62738102|pdb|1V9N|A  Chain A, Structure Of Malate Dehydrogenase From Pyrococcus Horikoshii 
Ot3
Length=360

 Score =  167 bits (424),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 149/281 (53%), Gaps = 9/281 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G+ EEDA I  D L+ +DLRG ESHGV   L+ YV    +  +N  P+++ +RE P  
Sbjct  29   KLGVPEEDAKIVADNLVXADLRGVESHGVQR-LKRYVDGIISGGVNLHPKIRVIREGPSY  87

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D D GLG  VG ++ KLAI+KA+ TGIG V  +N  H G+  YY L A +   IGI 
Sbjct  88   ALIDGDEGLGQVVGYRSXKLAIKKAKDTGIGIVIARNSNHYGIAGYYALXAAEEGXIGIS  147

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              ++   L  P  G E + GT+PIA  AP  K  PF+ D AT+ V   KL + RR G  +
Sbjct  148  XTNS-RPLVAPTGGIERILGTNPIALAAPT-KDKPFLLDXATSVVPIGKLEVYRRKGKDI  205

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW  + EGN I   V+    GG  +   G     GGHKGYG +  VDI+SGILSG   
Sbjct  206  PEGWAINREGN-ITTKVEEVFNGGALLPLGGFGELLGGHKGYGLSLXVDILSGILSGGTW  264

Query  242  GFLAGDNKHS-----QFVMAIKIDLFLDAVDFKSDMDKLLE  277
                 +          F   I I+ F+   +FK  + + +E
Sbjct  265  SKYVKNTSEKGSNVCHFFXVIDIEHFIPLEEFKEKISQXIE  305


>gi|56965806|ref|YP_177540.1|  ureidoglycolate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56912052|dbj|BAD66579.1|  ureidoglycolate dehydrogenase [Bacillus clausii KSM-K16]
Length=345

 Score =  165 bits (417),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 106/282 (37%), Positives = 158/282 (56%), Gaps = 25/282 (8%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQAD--RMNPRPEVKTLRETPVSA  62
            ++EEDA IA DVL+ ++LRG +SHGV   + +Y+    A   + NP+P +K +  TP +A
Sbjct  23   VNEEDAHIAADVLVHANLRGVDSHGVMR-VEHYLKRIAAGGLKTNPQPAIKQI--TPSTA  79

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             +DAD GLG     KAM  AI+ A+  GIGAVA+QN  H G L+Y+   A   ++IGI M
Sbjct  80   VYDADHGLGHPASKKAMDHAIQLAKNNGIGAVAVQNSSHCGALSYFVQQAAHSNVIGIAM  139

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             S   +  VP  G    FGT+PIA+G PA+ + P + D AT++ A  K++  +  G+ + 
Sbjct  140  -SQTDKAVVPFGGKAPFFGTNPIAFGFPAEAEKPVILDFATSEAAFGKILNAQASGNSIP  198

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN--G  240
              W  D EG    +P +       Y+LPFGG       KGYG A +V+I S +L+ +  G
Sbjct  199  ANWGVDKEGKTTTNPNEVA-----YLLPFGGA------KGYGLAMVVEIFSALLTASAFG  247

Query  241  PGF--LAGD----NKHSQFVMAIKIDLFLDAVDFKSDMDKLL  276
            P    + GD     +   F +AI  + F  AV F + +D+++
Sbjct  248  PHVTKMYGDYDQYRRLGHFFIAIDTEAFAPAVSFPTQIDQMV  289


>gi|110633419|ref|YP_673627.1|  Malate/L-lactate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110284403|gb|ABG62462.1|  Malate/L-lactate dehydrogenase [Mesorhizobium sp. BNC1]
Length=375

 Score =  165 bits (417),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 103/278 (37%), Positives = 149/278 (53%), Gaps = 14/278 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GM E  A    D+L  +DL G ESHG+S ML  Y   ++A R+    + K +RETPVS  
Sbjct  20   GMPEAQAARTADILGWADLHGVESHGIS-MLVEYDMRFRAGRLKMNADFKVVRETPVSVL  78

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D G+G      A   AIEKA+ +GI   +++N  H G + Y+  +A +  +I +   
Sbjct  79   IDGDGGMGHIAYAMAADAAIEKAKASGIAVASVRNSSHFGAVGYFTELAARAGLIAMGAT  138

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            SA G    P  G+E   GT P+++ AP+  + PF+ D+ATT VA  K+       + +  
Sbjct  139  SAAGIRVAPTNGAEAKLGTDPLSFAAPSTDENPFLLDMATTTVAYGKIRNKMNENASMPI  198

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPGF  243
            GW TD  G P  DP+D    GGF M P GGT E   +KGYG + +V+I+S  LSG+    
Sbjct  199  GWGTDSNGEPTTDPLDVTRRGGF-MSPLGGTPEGASYKGYGLSVMVNILSSCLSGST---  254

Query  244  LAGDNKHSQ---------FVMAIKIDLFLDAVDFKSDM  272
            L  D  H++         F +A+   LF DA +F++D+
Sbjct  255  LITDPMHTKKPKGFDIGHFYLALDPKLFRDAGEFETDV  292


>gi|83766533|dbj|BAE56673.1|  unnamed protein product [Aspergillus oryzae]
Length=369

 Score =  161 bits (408),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 98/283 (34%), Positives = 147/283 (51%), Gaps = 18/283 (6%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K G+S EDA    D L+ +D+RG ++HG++  L  Y+      R+   PE K   +TPV 
Sbjct  33   KAGLSPEDAKSMADCLVMADVRGVDTHGLAR-LPQYLDRVSNGRVKANPEFKLTEKTPVV  91

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D D G G  V  +AM+ A+++AE  GIG V + +  H GM A Y + AL+ +MI + 
Sbjct  92   AQLDGDNGFGFVVATRAMEEAVKRAEIYGIGMVTVNHSNHFGMAATYVIQALEKNMISLV  151

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              ++  ++  P  G ET+ G  P A GAP++ + P++ D+A + VA  K+    R G  +
Sbjct  152  FTNSAKQMP-PFGGKETLLGISPFAAGAPSNNEVPYILDMAPSVVAKGKIRRAARRGESI  210

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW  D +GNP  D   + N         G     GG KG G A ++D+MSG+L+G   
Sbjct  211  PLGWALDADGNPTTDANIALN---------GSMAPIGGPKGSGIAILMDVMSGVLTGAAF  261

Query  242  GFLAGDNKHS-------QFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G   GD              +AIK D+F+    FK+ MD L++
Sbjct  262  GGEVGDQYKDTKPQNVGHCFIAIKPDIFMTTDQFKARMDTLVQ  304


>gi|85859328|ref|YP_461530.1|  malate/L-lactate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722419|gb|ABC77362.1|  malate/L-lactate dehydrogenase [Syntrophus aciditrophicus SB]
Length=373

 Score =  160 bits (404),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 107/288 (37%), Positives = 150/288 (52%), Gaps = 16/288 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G++ EDAVI  D L+ +DLRG  SHGV+  LR YV       + P  +   +RE P +AT
Sbjct  32   GVTREDAVICADNLVLADLRGIPSHGVAR-LRRYVDGMSNGTILPHSKPIIVREAPSTAT  90

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   GLG  VG  + +LAIEKA  TG+G VA++N  H G+  YY  M L   ++GI M 
Sbjct  91   VDGQAGLGQIVGHFSTQLAIEKARKTGVGIVAVRNSNHYGIAGYYTQMMLDAGLLGISMT  150

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            +    L VP FG + + GT+PI+  AP  +  PF  D+AT+ +   KL +  R+G  +  
Sbjct  151  NT-APLVVPTFGRKMIIGTNPISMTAPTRRNKPFFLDMATSVIPRGKLEVYDRMGKDMPE  209

Query  184  GWITDLEGNPIMDPVD-----SPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            GW  D +G    D  +         GG  +   G     GG+KGYG A +VDI+ G+LSG
Sbjct  210  GWAVDSKGQTATDATEVLRNMVARLGGGILPLGGEGELYGGYKGYGIALLVDILCGVLSG  269

Query  239  ---------NGPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                      GPG        + F MA+ I+ F++   F   MD L++
Sbjct  270  GAYADLVDIKGPGGAGQPALVAHFFMALNIENFVEMEIFMEKMDDLID  317


>gi|67467274|ref|XP_649756.1|  malate dehydrogenase [Entamoeba histolytica HM-1:IMSS]
 gi|56466264|gb|EAL44379.1|  malate dehydrogenase, putative [Entamoeba histolytica HM-1:IMSS]
Length=351

 Score =  159 bits (402),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 95/275 (34%), Positives = 142/275 (51%), Gaps = 12/275 (4%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G  EE+A +  D LI +DLRG ++HG+      Y+   +   +NP  +   +RET  +
Sbjct  24   KVGSDEENARMVRDTLIAADLRGMDTHGIQRFKTVYIDRIKKGMINPTAKPSIIRETSTT  83

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
               D + G G   G   MK+AIEKA+  G+G V ++N  H G+  YY L+A Q   IGIC
Sbjct  84   CVLDGNNGFGHVNGTIGMKMAIEKAKKYGMGMVVVRNSTHFGIAGYYSLLAAQEGCIGIC  143

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              +A   +    FG E + GT+P+A G P D+  P+ FD AT+     +     R+G  +
Sbjct  144  GTNARSSVAA-TFGDEPILGTNPLAIGIPLDEAFPYCFDGATSISPTGRFEKYVRMGKTV  202

Query  182  EPGWITDLEGNPIMDPVD-SPNY--GGFYMLPFGGTRE-NGGHKGYGFATIVDIMSGILS  237
            +  W +   G PI DP +   NY  G  Y+ P GG+ E +G HKGY  +  V+IMS    
Sbjct  203  DKSWASMKGGKPIEDPKELLENYPKGKAYLHPLGGSDEVSGSHKGYCLSEFVEIMSKKEK  262

Query  238  GNGPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDM  272
                   +G      F +AI ++ F D  +FK ++
Sbjct  263  -------SGKFSLGHFFIAINVECFRDLNEFKKNV  290


>gi|15669616|ref|NP_248429.1|  malate dehydrogenase [Methanocaldococcus jannaschii DSM 2661]
 gi|2497860|sp|Q58820|COMC_METJA  L-sulfolactate dehydrogenase ((R)-sulfolactate dehydrogenase) 
((R)-2-hydroxyacid dehydrogenase)
 gi|1592075|gb|AAB99436.1|  malate dehydrogenase [Methanocaldococcus jannaschii DSM 2661]
Length=344

 Score =  157 bits (396),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 148/283 (52%), Gaps = 18/283 (6%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            +K G+ EEDA I  DV + +DL+G  SHG+      Y+   +   +NP+P++K ++E+P 
Sbjct  17   KKFGVPEEDAKITADVFVDADLKGFTSHGIGR-FPQYITALKLGNINPKPDIKIVKESPA  75

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
            +A  D D GLG  VG KAM+LAI+KA+  G+G VA +N  H G+  YY  +A+  DMIGI
Sbjct  76   TAVIDGDLGLGQVVGKKAMELAIKKAKNVGVGVVATRNANHFGIAGYYSELAMNQDMIGI  135

Query  121  CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             + +    +  P  G E + GT+PIA     +K   F  D+AT  +A  K++   R   +
Sbjct  136  TITNTEPAM-APFGGKEKILGTNPIAIAFKGNKY-KFSLDMATASIARGKILEALRKKIK  193

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
            +  G   D +G P  DP  +       +LPFGG       KGYG A  ++++S I     
Sbjct  194  IPEGCAVDKDGKPTTDPAKALEG---CILPFGGP------KGYGLALAIEMLSAIGGAEV  244

Query  241  PGFLAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
               + G     +        +AI  + F+   +FK  +D+LL+
Sbjct  245  GTKVKGTANPEERCTKGDLFIAINPEFFMGKEEFKRKVDELLD  287


>gi|89095889|ref|ZP_01168783.1|  hypothetical protein B14911_04129 [Bacillus sp. NRRL B-14911]
 gi|89089635|gb|EAR68742.1|  hypothetical protein B14911_04129 [Bacillus sp. NRRL B-14911]
Length=336

 Score =  151 bits (382),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 98/282 (34%), Positives = 142/282 (50%), Gaps = 21/282 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+++E +    ++L+ +DLR   SHGV     +YV    A  +NP   +   +  PV+  
Sbjct  23   GLNQEHSEKVAEILVHADLRNVNSHGVLRT-EHYVNRLNAGGINPDANITFNKTGPVTGV  81

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D G G  +G +AMK AI  A+  GIG V   N  H G L+Y+   A + ++IGI M 
Sbjct  82   VDGDDGFGHVIGDEAMKQAISMAKENGIGMVTAINSSHCGALSYFVQEAAEENLIGIAMT  141

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
                ++ VP  G E   GT+PIA+G PA    PF+ D+AT+ VA  K++  +  G  +  
Sbjct  142  HTD-KIVVPFGGKEAFLGTNPIAYGVPAKMNKPFILDMATSNVAFGKVLQHKEEGKDIPE  200

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN--GP  241
            GW  D  G  + DP    +     +LPFGG       KGYG + IVDI SG+L+G   GP
Sbjct  201  GWGVDENGGAVTDPGKVVS-----LLPFGGP------KGYGLSMIVDIFSGLLAGAAFGP  249

Query  242  ------GFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                  G L    K   +  AI    F D   F  +MD++++
Sbjct  250  HVAKMYGDLDKKRKLGHYFCAINPAFFTDEEVFLENMDRMMD  291


>gi|67480503|ref|XP_655601.1|  malate dehydrogenase [Entamoeba histolytica HM-1:IMSS]
 gi|56472753|gb|EAL50215.1|  malate dehydrogenase, putative [Entamoeba histolytica HM-1:IMSS]
Length=370

 Score =  151 bits (381),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 95/283 (33%), Positives = 144/283 (50%), Gaps = 17/283 (6%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+ E DA     VLI +D +G ++HG+  +   Y       ++N +     ++ET  +A 
Sbjct  26   GVEEADAARCAKVLIQADKQGMDTHGIQRLKTIYCDRIDCGQLNTKTVFDVVKETETTAV  85

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   G+G  +  +AM+LAI+KA+  G+G V ++N  H G+  YYP MA Q   IG    
Sbjct  86   VDGHNGMGHSIAMQAMQLAIDKAKKHGMGMVVVRNGTHYGIAGYYPQMAAQQGCIGFSGC  145

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            +A   +  P +  E   GT+P+ +  P+D+  PF  D AT+ V   K+ +  R G + +P
Sbjct  146  NARPSV-CPCWSVEPKLGTNPLVFAFPSDEGFPFCLDCATSIVQRGKIEMYAREGKKCQP  204

Query  184  GWITDLEGNPIMDP---VDSPNYGGFYMLPFGG-TRENGGHKGYGFATIVDIMSGILSGN  239
            GW+ D  G  + +P   +++   G     P GG   E GGHKGYG+A  V+I+S  LS  
Sbjct  205  GWVCDRSGKVLSEPGPMLEAFQKGTAACYPLGGYGEEMGGHKGYGYACDVEILSSALS--  262

Query  240  GPGFLA-----GDNKH-----SQFVMAIKIDLFLDAVDFKSDM  272
            G  FL+      D K       QF MAI I+ F    DF+  +
Sbjct  263  GANFLSQCGGLKDGKKVPIELGQFFMAINIESFRPLADFEKQV  305


>gi|118035557|ref|ZP_01506965.1|  Malate/L-lactate dehydrogenase [Burkholderia phytofirmans PsJN]
 gi|117993820|gb|EAV08110.1|  Malate/L-lactate dehydrogenase [Burkholderia phytofirmans PsJN]
Length=367

 Score =  150 bits (378),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 95/295 (32%), Positives = 146/295 (49%), Gaps = 25/295 (8%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E  GMS      + D+LI SDL+G +SHG+S ML  Y  +Y+A +++ +   + +RET  
Sbjct  22   EAWGMSPGQVAASADILIDSDLKGIDSHGIS-MLMFYDQLYRAGQIDMKASARIVRETAT  80

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
            +A  D +  +G      AM+LAIEKA    +GAV++ N  H G   YY  MA +  +I +
Sbjct  81   TALIDGNAAMGHPTSRMAMELAIEKALACDMGAVSVFNSQHFGAAGYYAEMAAERGLIAL  140

Query  121  CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
               S      VP FG+E + GT+P A+  PA + PP + D++T+ VA+NK+ +    G  
Sbjct  141  VSCSTRLATVVPTFGAEPMLGTNPFAFATPAGRHPPVILDMSTSVVASNKVKVYALQGKP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPF-----------GGTRENGGHKGYGFATIV  229
            L PGW  D  GNP+ D  ++      Y L F           G  +  GGHKGYG     
Sbjct  201  LPPGWALDANGNPLTDSAEA------YRLLFERLGGGLAPLGGDGKTLGGHKGYGLGLFA  254

Query  230  DIMSGILSGNGPGFLAGDNKHS-------QFVMAIKIDLFLDAVDFKSDMDKLLE  277
             I+   L G     +    + S        F +A+    F    ++ +D+D +++
Sbjct  255  QILGSTLGGGSFSPVRNRTQKSDEPDNIGHFFLAMNPAAFRPIEEYHADLDAVID  309


>gi|67153740|ref|ZP_00415485.1|  Malate/L-lactate dehydrogenase [Azotobacter vinelandii AvOP]
 gi|67087873|gb|EAM07339.1|  Malate/L-lactate dehydrogenase [Azotobacter vinelandii AvOP]
Length=450

 Score =  148 bits (373),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 100/283 (35%), Positives = 147/283 (51%), Gaps = 12/283 (4%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GM    A     +++ +DL G +SHGVS ML  Y  + +A    P  E + +RE+P +A 
Sbjct  104  GMPAVAAEETAALIVETDLAGIDSHGVS-MLPFYETLREAGGWVPDAEPRVVRESPCTAL  162

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   GLG +   +AM+LA +KA+  G+GAVA++N  H G    Y   A +  +IG+   
Sbjct  163  LDGGHGLGHRTAMQAMRLAADKAQGVGLGAVAVRNSNHFGAAGLYARAAAERGLIGLVAS  222

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            +    + VP      V GT+PIA+ APA +  PFV D+ATT VAANK+ +    G  + P
Sbjct  223  TTRSPMLVPTRARVPVLGTNPIAFAAPARRNRPFVLDMATTTVAANKVKVYDLQGKDIPP  282

Query  184  GWITDLEGNPIMDPVDSPNY------GGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS  237
            GW+ D  G P+     +  Y      GG   L  GG  E G HKGYG   +  I++G L 
Sbjct  283  GWVVDEAGRPVTAGERAMEYLFRRPEGGLTAL--GGVAELGSHKGYGLGMLAQILAGPLC  340

Query  238  GNGPGF-LAGDNKHS--QFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G   G     D K +   F +A+    F DA +F+ ++D +++
Sbjct  341  GAAFGARREADEKPNIGHFFLALDPRAFRDADEFEDELDAIVD  383


>gi|47168770|pdb|1RFM|A  Chain A, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168771|pdb|1RFM|B  Chain B, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168772|pdb|1RFM|C  Chain C, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168773|pdb|1RFM|D  Chain D, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168774|pdb|1RFM|E  Chain E, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168775|pdb|1RFM|F  Chain F, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168776|pdb|1RFM|G  Chain G, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
 gi|47168777|pdb|1RFM|H  Chain H, Sulfolactate Dehydrogenase From Methanocaldococcus Jannaschii
Length=344

 Score =  147 bits (372),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 18/283 (6%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            +K G+ EEDA I  DV + +DL+G  SHG+      Y+   +   +NP+P++K ++E+P 
Sbjct  17   KKFGVPEEDAKITADVFVDADLKGFTSHGIGR-FPQYITALKLGNINPKPDIKIVKESPA  75

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
            +A  D D GLG  VG KA +LAI+KA+  G+G VA +N  H G+  YY  +A   D IGI
Sbjct  76   TAVIDGDLGLGQVVGKKAXELAIKKAKNVGVGVVATRNANHFGIAGYYSELAXNQDXIGI  135

Query  121  CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             + +       P  G E + GT+PIA     +K   F  D AT  +A  K++   R   +
Sbjct  136  TITNT-EPAXAPFGGKEKILGTNPIAIAFKGNKY-KFSLDXATASIARGKILEALRKKIK  193

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
            +  G   D +G P  DP  +       +LPFGG       KGYG A  ++ +S I     
Sbjct  194  IPEGCAVDKDGKPTTDPAKALEG---CILPFGGP------KGYGLALAIEXLSAIGGAEV  244

Query  241  PGFLAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
               + G     +        +AI  + F    +FK  +D+LL+
Sbjct  245  GTKVKGTANPEERCTKGDLFIAINPEFFXGKEEFKRKVDELLD  287


>gi|33597138|ref|NP_884781.1|  putative malate dehydrogenase [Bordetella parapertussis 12822]
 gi|33566589|emb|CAE37846.1|  putative malate dehydrogenase [Bordetella parapertussis]
Length=370

 Score =  147 bits (370),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 97/287 (33%), Positives = 146/287 (50%), Gaps = 16/287 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GM E  A +  D++  +DL G +SHG+S ML +Y    +A  +    + + +RE   SA 
Sbjct  28   GMPEAPAGVTADLMAETDLLGIDSHGIS-MLSSYEDKLRAGTLRIDAQPRLVREGTASAL  86

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   GLG  V  +AM++A++KA   G+GAV+++N  H G    Y  +A+Q   + +   
Sbjct  87   LDGMGGLGHPVAAQAMRMAVDKAFEHGVGAVSVRNSHHFGAAGVYARLAVQRGAVALVTS  146

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            SA   + VP  G+  + GT+PIA+GAPA      + D+ATT VAANK+ +    G  L P
Sbjct  147  SATTLIMVPTHGARPMLGTNPIAFGAPAAHNDALLLDMATTTVAANKVKVYDYYGKPLPP  206

Query  184  GWITDLEGNPIMDPVDSPNY------GGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS  237
            GW  D  G  + D   +  +      GG  + P GGT E   HKGYG A +  ++ G L 
Sbjct  207  GWAVDGAGAGVTDSAAAMQFIFQRPEGG--LTPLGGTAEMSSHKGYGLAIMAQVLGGTLG  264

Query  238  GN-----GPGFLAGDNKHS--QFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G+            D+      F +A+  D F     F+S+MD L++
Sbjct  265  GSLMAARHAARRRPDDPDDVGHFFLALDPDAFRAGGSFESEMDDLID  311


>gi|27382692|ref|NP_774221.1|  putative dehydrogenase [Bradyrhizobium japonicum USDA 110]
 gi|27355864|dbj|BAC52846.1|  blr7581 [Bradyrhizobium japonicum USDA 110]
Length=350

 Score =  146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 94/275 (34%), Positives = 138/275 (50%), Gaps = 9/275 (3%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            +  G S+E+A       + ++L G +SHGV   +  Y+   +A  + P      ++E+P 
Sbjct  18   QAAGASQEEADAVATGCVNANLAGHDSHGVI-AVPTYIDRIKAGHIVPGATWTIIQESPT  76

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
            +   D   G G  V  KAM L IEKA+T  + A  +    HVG LA YPLMA++  MIGI
Sbjct  77   TTVIDGHWGFGFHVNAKAMALTIEKAKTANVAACTVFRQSHVGRLAAYPLMAMREGMIGI  136

Query  121  CMVSAGGRLQ--VPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIG  178
                +G   +   P  G E   GT+PI+   P+D   PF  D+AT+ VAA K+ L    G
Sbjct  137  ATADSGRSPKHVAPFGGKEARLGTNPISIAVPSDLDAPFYLDMATSAVAAGKIQLAVARG  196

Query  179  SQLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             ++  GWI D EG    DP      G   +LP GGT    G+KG G A +V+++ G+L+G
Sbjct  197  DKIPTGWIIDAEGRHTNDPTQYRKGGA--LLPLGGTE---GYKGSGLAAMVEVLCGLLTG  251

Query  239  NGPGF-LAGDNKHSQFVMAIKIDLFLDAVDFKSDM  272
             G G    G +    F+    +  F    +FK ++
Sbjct  252  LGFGVEPTGRHNDGCFMAVFNVAAFRPLKEFKREV  286


>gi|33600982|ref|NP_888542.1|  putative malate dehydrogenase [Bordetella bronchiseptica RB50]
 gi|33575417|emb|CAE32494.1|  putative malate dehydrogenase [Bordetella bronchiseptica RB50]
Length=370

 Score =  146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 97/287 (33%), Positives = 146/287 (50%), Gaps = 16/287 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GM E  A +  D++  +DL G +SHG+S ML +Y    +A  +    + + +RE   SA 
Sbjct  28   GMPEAPAGVTADLMAETDLLGIDSHGIS-MLPSYEDKLRAGTLRIDAQPRLVREGTASAL  86

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   GLG  V  +AM++A++KA   G+GAV+++N  H G    Y  +A+Q   + +   
Sbjct  87   LDGMGGLGHPVAAQAMRMAVDKAFEHGVGAVSVRNSHHFGAAGVYARLAVQRGAVALVTS  146

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            SA   + VP  G+  + GT+PIA+GAPA      + D+ATT VAANK+ +    G  L P
Sbjct  147  SATTLIMVPTHGARPMLGTNPIAFGAPAAHNDALLLDMATTTVAANKVKVYDYYGKPLPP  206

Query  184  GWITDLEGNPIMDPVDSPNY------GGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS  237
            GW  D  G  + D   +  +      GG  + P GGT E   HKGYG A +  ++ G L 
Sbjct  207  GWAVDGAGAGVTDSAAAMQFIFQRPEGG--LTPLGGTAEMSSHKGYGLAIMAQVLGGTLG  264

Query  238  GN-----GPGFLAGDNKHS--QFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G+            D+      F +A+  D F     F+S+MD L++
Sbjct  265  GSLMAARHAARRRPDDPDDVGHFFLALDPDAFRAGGSFESEMDDLID  311


>gi|15893856|ref|NP_347205.1|  Malate dehydrogenase [Clostridium acetobutylicum ATCC 824]
 gi|15023433|gb|AAK78545.1|AE007571_11  Malate dehydrogenase [Clostridium acetobutylicum ATCC 824]
Length=369

 Score =  145 bits (365),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 85/244 (34%), Positives = 137/244 (56%), Gaps = 11/244 (4%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            +++G ++ED+    +VL+ +DL G ESHGV  +   Y  +     +  +  +  ++E+PV
Sbjct  27   QRLGYTKEDSYTIGEVLLLADLFGIESHGVQRLTLYYKGIRNGS-IKVKNHMNIVKESPV  85

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
            S   D D G+G  +  KAM+ AI+KA+ TGIG   ++N  H G+  YY  MA +  ++GI
Sbjct  86   SVVIDGDGGMGQIISKKAMERAIDKAKKTGIGMAIVKNSNHFGIAGYYSRMAERKGLMGI  145

Query  121  CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             M +    + +P +G E + GT+PI+   PA +  PF+ D+AT+ +   K+ +  +   +
Sbjct  146  AMTNTRA-IVLPTYGREQMLGTNPISIAMPA-RPIPFLLDMATSVITRGKVEVYSKNNQK  203

Query  181  LEPGWITDLEGNPIMDP-----VDSPNYGGFYMLPFGGTRE-NGGHKGYGFATIVDIMSG  234
            L  GW  D EG    +P     + + N GG  +LP GG  E  GGHKGYG +  V++ + 
Sbjct  204  LNYGWAMDDEGRKTDNPDKVLKLANGNTGG--LLPLGGDTEIFGGHKGYGISFAVEMFTS  261

Query  235  ILSG  238
            ILSG
Sbjct  262  ILSG  265


>gi|33593736|ref|NP_881380.1|  putative malate dehydrogenase [Bordetella pertussis Tohama I]
 gi|33563809|emb|CAE43053.1|  putative malate dehydrogenase [Bordetella pertussis Tohama I]
Length=370

 Score =  144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 97/287 (33%), Positives = 146/287 (50%), Gaps = 16/287 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GM E  A +  D++  +DL G +SHG+S ML +Y    +A  +    + + +RE   SA 
Sbjct  28   GMPEAPAGVTADLMAETDLLGIDSHGIS-MLPSYEDKLRAGTLRIDAQPRLVREGTASAL  86

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   GLG  V  +AM++A++KA   G+GAV+++N  H G    Y  +A+Q   + +   
Sbjct  87   LDGMGGLGHPVVAQAMRMAVDKAFEHGVGAVSVRNSHHFGAAGVYARLAVQRGAVALVTS  146

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            SA   + VP  G+  + GT+PIA+GAPA      + D+ATT VAANK+ +    G  L P
Sbjct  147  SATTLIMVPTHGARPMLGTNPIAFGAPAAHNDALLLDMATTTVAANKVKVYDYYGKPLPP  206

Query  184  GWITDLEGNPIMDPVDSPNY------GGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS  237
            GW  D  G  + D   +  +      GG  + P GGT E   HKGYG A +  ++ G L 
Sbjct  207  GWAVDGAGAGVTDSAAAMQFIFQRPEGG--LTPLGGTAEMSSHKGYGLAIMAQVLGGTLG  264

Query  238  GN-----GPGFLAGDNKHS--QFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G+            D+      F +A+  D F     F+S+MD L++
Sbjct  265  GSLMAARHAARRRPDDPDDVGHFFLALDPDAFRAGGSFESEMDDLID  311


>gi|54641053|gb|EAL29804.1|  GA10363-PA [Drosophila pseudoobscura]
Length=362

 Score =  144 bits (362),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 84/224 (37%), Positives = 123/224 (54%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  +   E K L+ETP +A  D   GLG  V
Sbjct  39   DLLVAADHRGHFSHGM-NRLEMYINDLAINSTDGGAEPKVLKETPATAWVDGLNGLGAVV  97

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI+KA+T G+G V  +   H GM  +Y + A++  ++G+ M +    L  P  
Sbjct  98   GNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMEQGLVGMSMTNT-SPLMAPTR  156

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+P++ GAPA     F+ D+ATT VA  K+ + RR G+ L  GW  D  GN  
Sbjct  157  AKEAALGTNPLSLGAPAANGDKFLLDMATTAVAVGKIEIQRRKGAALPDGWAQDPNGNIT  216

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D     + G   ++P GG+    G+KG+G   +VDI+SG++SG
Sbjct  217  NDAELGFSTG--CLMPLGGSELTSGYKGFGLGAMVDILSGVMSG  258


>gi|89095791|ref|ZP_01168685.1|  malate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89089537|gb|EAR68644.1|  malate dehydrogenase [Bacillus sp. NRRL B-14911]
Length=364

 Score =  142 bits (359),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 92/283 (32%), Positives = 141/283 (49%), Gaps = 19/283 (6%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K G+  EDA    + LI +DLRG +SHGV      Y+   + + MNP  E+    ET  +
Sbjct  22   KAGVKREDAETVAESLIQADLRGIDSHGVVRT-DIYIKRIEKNMMNPFAEISIEEETDAT  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  +    LG  VG KA+ LA+ KA+  G   V ++   H G  A+Y   A++ DMI + 
Sbjct  81   ALVNGHNQLGAIVGSKALDLALHKAKEKGAAIVGVKGSNHFGTGAFYVSKAIEKDMI-LL  139

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            ++S   +   P  G     GT+P+A G PA ++  F+ D+AT+ VA  K+++  + G  +
Sbjct  140  VLSNASQTMPPTGGVRPFIGTNPLAIGVPAGEEEAFILDMATSVVARGKIIVAAQKGEDI  199

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW  D  GNP  +  D+       +LP GG       KGYG +  +DI++G+L+G G 
Sbjct  200  PLGWAIDKHGNPTTNAQDALEGS---VLPLGGP------KGYGISMFIDILAGVLTGAGF  250

Query  242  GFLAGDNKHS--------QFVMAIKIDLFLDAVDFKSDMDKLL  276
            G    +   +         F +AI I+ F+    FK  +D  L
Sbjct  251  GRYVNNMYENWNDPQNVGHFFLAIDINSFMPIETFKKRIDMYL  293


>gi|13488244|ref|NP_085760.1|  probable malate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14028009|dbj|BAB54601.1|  probable malate dehydrogenase [Mesorhizobium loti MAFF303099]
Length=366

 Score =  142 bits (357),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 89/242 (36%), Positives = 127/242 (52%), Gaps = 10/242 (4%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G SE++A       + ++L G +SHGV   +  Y+   +A  + P  E   +RE+P +A 
Sbjct  37   GASEDEAQAVATGCVNANLAGHDSHGVI-AIPGYIDSLKAGDIVPGAEWTIVRESPTTAV  95

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D + G G  V  KAM L IEKA+   + A  +    HVG LA YPLMA+   MIG  + 
Sbjct  96   IDGNWGFGFHVNAKAMALVIEKAKIANVAACTVFRQSHVGRLAAYPLMAVSAGMIGFAVA  155

Query  124  SAGG--RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             +G       P  G E   GT+PI+ G P++ Q PF+ D+AT+  AA KL +      ++
Sbjct  156  GSGSFPDCVAPFGGREARLGTNPISIGVPSNLQAPFLLDMATSAAAAGKLEVAIARREKI  215

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW+ D EG P  +P D     G  +LP GG     G+KG G A IV+++ G+L    P
Sbjct  216  PEGWLIDAEGRPTTNPHDY--LKGGVLLPLGGPE---GYKGSGLAAIVELLCGLLP--DP  268

Query  242  GF  243
            GF
Sbjct  269  GF  270


>gi|16078297|ref|NP_389114.1|  hypothetical protein BSU12320 [Bacillus subtilis subsp. subtilis 
str. 168]
 gi|17367959|sp|O34736|YJMC_BACSU  Hypothetical oxidoreductase yjmC
 gi|2612904|gb|AAC46328.1|  malate dehydrogenase-like protein [Bacillus subtilis]
 gi|2633586|emb|CAB13089.1|  yjmC [Bacillus subtilis subsp. subtilis str. 168]
Length=337

 Score =  141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 134/282 (47%), Gaps = 21/282 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G++E DA    DVL+ +DLR   SHGV +   +YV    A  +NP  +       PV+  
Sbjct  23   GLNERDAEKVADVLVHADLRNVHSHGVLHT-EHYVNRLLAGGINPGAQPVFKETGPVTGV  81

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D G G      AM  AI+ A+  G+G V   N  H G L+Y+   A    +IG+ M 
Sbjct  82   LDGDDGFGHVNCDMAMDHAIDMAKKKGVGMVTAVNSSHCGALSYFVQKAADEKLIGMAMT  141

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
                 + VP  G   + GT+PIA+G PA  + PF+ D+AT++VA  K++  R  G ++  
Sbjct  142  HTDS-IVVPFGGRTPILGTNPIAYGVPAKHKKPFILDMATSKVAFGKILQAREEGKEIPE  200

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN--GP  241
            GW  D  G  + DP    +   F           GG KGYG + +VD+ SG+L+G   GP
Sbjct  201  GWGVDENGEAVTDPDKVVSLSTF-----------GGPKGYGLSIVVDVFSGLLAGAAFGP  249

Query  242  GF------LAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                    L    K   +V AI    F D   F   MD +++
Sbjct  250  HIAKMYNGLDQKRKLGHYVCAINPSFFTDWDTFLEQMDAMID  291


>gi|67479405|ref|XP_655084.1|  malate dehydrogenase [Entamoeba histolytica HM-1:IMSS]
 gi|56472193|gb|EAL49698.1|  malate dehydrogenase, putative [Entamoeba histolytica HM-1:IMSS]
Length=319

 Score =  140 bits (353),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 86/258 (33%), Positives = 132/258 (51%), Gaps = 12/258 (4%)

Query  26   ESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQVGPKAMKLAIEK  85
            ++HG+      Y+   +   +NP  +   +RET  +   D + G G   G   MK+AIEK
Sbjct  2    DTHGIQRFKTVYIDRIKKGMINPTAKPSIIRETSTTCVLDGNNGFGHVNGTIGMKMAIEK  61

Query  86   AETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVFGSETVFGTHPI  145
            A+  G+G V ++N  H G+  YY L+A Q   IGIC  +A   +    FG E + GT+P+
Sbjct  62   AKKYGMGMVVVRNSTHFGIAGYYSLLAAQEGCIGICGTNARSSVAA-TFGDEPILGTNPL  120

Query  146  AWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPIMDPVD-SPNY-  203
            A G P+D+  P+ FD AT+     +     R+G  ++  W +   G PI DP +   NY 
Sbjct  121  AIGIPSDEAFPYCFDGATSISPTGRFEKYVRMGKTVDKSWASMKGGKPIEDPKELLENYP  180

Query  204  -GGFYMLPFGGTRE-NGGHKGYGFATIVDIMSGILS-GNGPGFLAGDNKHS------QFV  254
             G  Y+ P GG+ E +G HKGY  +  V+IMS  LS  N    +  + + S       F 
Sbjct  181  KGKAYLHPLGGSDEVSGSHKGYCLSEFVEIMSSCLSIANFLNHIEEEKEKSGKFSLGHFF  240

Query  255  MAIKIDLFLDAVDFKSDM  272
            +AI ++ F D  +FK ++
Sbjct  241  IAINVECFRDLNEFKKNV  258


>gi|67527070|gb|AAY68339.1|  putative malate dehydrogenase [uncultured marine bacterium 66A03]
Length=349

 Score =  140 bits (352),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 144/280 (51%), Gaps = 18/280 (6%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G ++++A I  D+++ +D+ G + HG+   L  Y+   Q   MNP+P+ K L +   +A 
Sbjct  22   GFTKKNAEITADLMVQADISGQDGHGIFR-LPQYIKRLQEGGMNPKPKFKILSQRTATAL  80

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D G+G  V   A  +AI+KA  TG+  V  +   H G  A Y    L + +IGI + 
Sbjct  81   IDGDNGIGHLVMRHAADIAIKKARRTGVSWVGARMSNHAGPAALYTKYVLDNGLIGIYVA  140

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
                    P  G++ +  T+PI+   P+   PP + D+ATT  A  K+    + G ++  
Sbjct  141  VGSANHMPPWGGTDLLLSTNPISIAIPSGVNPPIILDMATTVAAYGKVKTLLQSGGKMPE  200

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGIL--SGNGP  241
            GW+ D +GNP+ DP+ S +  GF +LP GG       KGYG + I  I++G L  +  G 
Sbjct  201  GWMIDKQGNPLTDPLKSKD--GF-LLPIGGP------KGYGLSLIFGILAGTLNDAAFGK  251

Query  242  GFLAGDNKHS------QFVMAIKIDLFLDAVDFKSDMDKL  275
              +  ++ H        F++A+ I+ F+D   FKS +D +
Sbjct  252  DVIDFNSDHKTITNTGHFIIALDIEAFMDLEQFKSQIDNV  291


>gi|39964697|ref|XP_365027.1|  hypothetical protein MG09872.4 [Magnaporthe grisea 70-15]
Length=362

 Score =  138 bits (348),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 149/287 (51%), Gaps = 24/287 (8%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPR--PEVKTLRET  58
            EK G+    A +    LI +DLRG ESHG+ N + +YV   +   ++P+  PE+K +  T
Sbjct  29   EKHGVPSAHASVVASGLIQADLRGVESHGI-NRIPSYVERIRKGVLDPKATPELKQV--T  85

Query  59   PVSATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMI  118
            P  A  DA    G     KAM+ AI  A   GIG V++++  H GM A+    A+   M+
Sbjct  86   PAVAQVDAHNAFGFVAAHKAMESAINMARIYGIGMVSVKHSNHFGMSAWIVQQAVDAGMM  145

Query  119  GICMVSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRI  177
             +   ++   +  PV+G  E + G  PIA GAP++   PF+ D+A +  A  K+   +R 
Sbjct  146  SLVFTNSSPAM--PVWGGREQLLGVSPIACGAPSEPT-PFILDMAPSVAARGKIHKAKRR  202

Query  178  GSQLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS  237
            G ++   W  D +GN   DP  + + G   MLP GG       KG G A ++D+ SG+LS
Sbjct  203  GEKIPTDWALDAQGNRTDDPAAALDGG--VMLPMGGP------KGSGLALMMDVFSGVLS  254

Query  238  GNG-PGFLAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
            G+   G +AG    S+      F+MAIK DLF+   +FK  M  L E
Sbjct  255  GSAYAGHVAGPYDPSRAGDVGHFIMAIKPDLFMSMEEFKERMKYLYE  301


>gi|91086651|ref|XP_967440.1|  PREDICTED: similar to CG10512-PA, isoform A [Tribolium castaneum]
Length=391

 Score =  138 bits (348),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 85/240 (35%), Positives = 123/240 (51%), Gaps = 4/240 (1%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G  ++ A I  D L  +D RG  SHG+ N L  YV   Q    + +     ++ETP +A
Sbjct  57   VGTPKKYADILADNLTAADYRGHYSHGM-NRLDMYVRDVQGGLCDCKATPSVIKETPATA  115

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
                + GLG  VG   M+LAI+KA++ GIG V  +   H G+   Y L A+   ++G+  
Sbjct  116  WVTGNNGLGAVVGEFCMELAIKKAKSVGIGMVVAKESNHYGIAGKYSLQAIDQGVLGMSF  175

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +    L  P     +  GT+P++ GAPA     FV D+ATT VA  K+   +R G  + 
Sbjct  176  TNT-SPLMAPTRAKGSALGTNPLSLGAPAAGGDSFVLDMATTAVAVGKIEFQKRKGQPIP  234

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
             GW  D  G    DP  S  Y    ++P GG+  N G+KGYG A +V+I  G+L G+  G
Sbjct  235  EGWAQDAHGKITTDP--SVAYDAKRLMPLGGSEINSGYKGYGLAALVEIFCGMLGGSAYG  292


>gi|24667904|ref|NP_649289.2|  CG10512-PA, isoform A [Drosophila melanogaster]
 gi|7296399|gb|AAF51687.1|  CG10512-PA, isoform A [Drosophila melanogaster]
Length=446

 Score =  137 bits (345),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 82/224 (36%), Positives = 119/224 (53%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  +     K L+ETP +A  D   GLG  V
Sbjct  122  DLLVAADHRGHFSHGM-NRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVV  180

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI+KA+T G+G V  +   H GM  +Y + A+   ++G+ M +    L  P  
Sbjct  181  GNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNT-SPLMAPTR  239

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+P++ GA A     F+ D+ATT VA  K+ + RR G+ L  GW  D  G   
Sbjct  240  AKEAALGTNPLSLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVT  299

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D     + G   ++P GG+    G+KGYG   +VDI+SG++SG
Sbjct  300  NDAELGFSTG--CLMPLGGSELTSGYKGYGLGAMVDILSGVMSG  341


>gi|15010470|gb|AAK77283.1|  GH06154p [Drosophila melanogaster]
Length=446

 Score =  137 bits (345),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 82/224 (36%), Positives = 119/224 (53%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  +     K L+ETP +A  D   GLG  V
Sbjct  122  DLLVAADHRGHFSHGM-NRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVV  180

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI+KA+T G+G V  +   H GM  +Y + A+   ++G+ M +    L  P  
Sbjct  181  GNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNT-SPLMAPTR  239

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+P++ GA A     F+ D+ATT VA  K+ + RR G+ L  GW  D  G   
Sbjct  240  AKEAALGTNPLSLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVT  299

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D     + G   ++P GG+    G+KGYG   +VDI+SG++SG
Sbjct  300  NDAELGFSTG--CLMPLGGSELTSGYKGYGLGAMVDILSGVMSG  341


>gi|66523770|ref|XP_393999.2|  PREDICTED: similar to VF13D12L.3 [Apis mellifera]
Length=406

 Score =  136 bits (342),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 125/241 (51%), Gaps = 4/241 (1%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G + EDA I    L+TSD  G  SHG+ N ++ YV   +    NP  + K + +    
Sbjct  69   KVGTTPEDAYIVGHHLMTSDYCGHFSHGM-NRMQAYVLSIKNGITNPSAKPKIVSDFQAV  127

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D + GLG  +G   M+LAI+KA+  GI  + ++   H G+  YY  MA++ D+IG  
Sbjct  128  ALIDGNNGLGHTIGKYCMELAIDKAKKYGISMITVRGSNHYGICGYYSQMAIEKDLIGF-  186

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              S    L  P     +  GT+P++ G  A     F+ D+ATT VA  K+ L  R    +
Sbjct  187  TCSNTSPLMAPTRSKISGLGTNPLSLGMGASGGDKFLLDMATTAVAFGKIELAMRKNESI  246

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW   ++G    D  D+  +    ++P GG  EN  +KGYG A +V+++ GILSG+  
Sbjct  247  LKGWALGMDGKITTDARDA--FNAARLMPLGGVEENSSYKGYGLALMVEVLCGILSGSNF  304

Query  242  G  242
            G
Sbjct  305  G  305


>gi|24667908|ref|NP_730605.1|  CG10512-PB, isoform B [Drosophila melanogaster]
 gi|23094213|gb|AAN12158.1|  CG10512-PB, isoform B [Drosophila melanogaster]
Length=381

 Score =  135 bits (341),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 82/224 (36%), Positives = 119/224 (53%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  +     K L+ETP +A  D   GLG  V
Sbjct  57   DLLVAADHRGHFSHGM-NRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVV  115

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI+KA+T G+G V  +   H GM  +Y + A+   ++G+ M +    L  P  
Sbjct  116  GNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNT-SPLMAPTR  174

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+P++ GA A     F+ D+ATT VA  K+ + RR G+ L  GW  D  G   
Sbjct  175  AKEAALGTNPLSLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVT  234

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D     + G   ++P GG+    G+KGYG   +VDI+SG++SG
Sbjct  235  NDAELGFSTG--CLMPLGGSELTSGYKGYGLGAMVDILSGVMSG  276


>gi|24667912|ref|NP_730606.1|  CG10512-PC, isoform C [Drosophila melanogaster]
 gi|45553211|ref|NP_996133.1|  CG10512-PD, isoform D [Drosophila melanogaster]
 gi|23094214|gb|AAN12159.1|  CG10512-PC, isoform C [Drosophila melanogaster]
 gi|45446055|gb|AAS65086.1|  CG10512-PD, isoform D [Drosophila melanogaster]
Length=361

 Score =  135 bits (340),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 82/224 (36%), Positives = 119/224 (53%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  +     K L+ETP +A  D   GLG  V
Sbjct  37   DLLVAADHRGHFSHGM-NRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVV  95

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI+KA+T G+G V  +   H GM  +Y + A+   ++G+ M +    L  P  
Sbjct  96   GNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNT-SPLMAPTR  154

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+P++ GA A     F+ D+ATT VA  K+ + RR G+ L  GW  D  G   
Sbjct  155  AKEAALGTNPLSLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVT  214

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D     + G   ++P GG+    G+KGYG   +VDI+SG++SG
Sbjct  215  NDAELGFSTG--CLMPLGGSELTSGYKGYGLGAMVDILSGVMSG  256


>gi|116201731|ref|XP_001226677.1|  hypothetical protein CHGG_08750 [Chaetomium globosum CBS 148.51]
 gi|88177268|gb|EAQ84736.1|  hypothetical protein CHGG_08750 [Chaetomium globosum CBS 148.51]
Length=353

 Score =  135 bits (340),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 94/286 (32%), Positives = 146/286 (51%), Gaps = 21/286 (7%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E  G+S+++A I    L+ +DLRG ESHG+ N + +Y+A  +   ++P+ E    + TPV
Sbjct  24   EAAGVSQKNAKIVAQGLVQADLRGVESHGI-NRIPSYLARIRNGVLDPKAEPALTQVTPV  82

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
             A  D + G G      AM  AI  A+T GIG V++++  H GM A+    A    M+ +
Sbjct  83   VAQVDGNNGFGFPAAHLAMDTAITMAQTFGIGMVSVKHSNHFGMSAWIVRQAADAGMMSL  142

Query  121  CMVSAGGRLQVPVFGSET-VFGTHPIAWGAPADKQP-PFVFDVATTQVAANKLMLTRRIG  178
               ++   L  PV+G ++ + G  PIA GAP  +   PF+ D+A +  A  K+    R G
Sbjct  143  VFTNSSPAL--PVWGGKSQLMGVSPIACGAPGGETSLPFILDMAPSVAARGKIYKALRRG  200

Query  179  SQLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             ++   W  D +G P  DP  +       MLP GG       KG   A ++D+ SG+LSG
Sbjct  201  EKIPQDWALDEDGKPTDDPAKALKG---VMLPMGGP------KGSALAIMMDVFSGVLSG  251

Query  239  N-------GPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
            +       GP  ++       F++AIK DLF+   +F+  MD L +
Sbjct  252  SAFAGGVTGPYDMSKPGDVGHFIVAIKPDLFVSLDEFRQRMDTLYQ  297


>gi|90297943|gb|EAS27574.1|  hypothetical protein CIMG_10179 [Coccidioides immitis RS]
Length=387

 Score =  134 bits (338),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 94/286 (32%), Positives = 141/286 (49%), Gaps = 27/286 (9%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K  +  ++  I    L+ +DLRG +SHG+ N + +Y+A  +   ++P       + TPV 
Sbjct  56   KYNVPSQNGAIVAKCLVEADLRGVDSHGI-NRIPSYLARIRQKVLDPSVSPVVNKITPVV  114

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
               DA  G G     +AM  AI+ A+  GIG V++++  H GM A +   A+  DM+ + 
Sbjct  115  TQIDAQNGFGFIAANEAMNTAIKIAQVYGIGMVSVKHSNHFGMSASFVQQAIDADMLSLV  174

Query  122  MVSAGGRLQVPVF-GSETVFGTHPIAWGAPADKQP-PFVFDVATTQVAANKLMLTRRIGS  179
              ++   L  PV+ G + + G  PIA GAPA +   PF+ D+  +  A  K+    R G 
Sbjct  175  FTNSSPAL--PVWGGKDKLMGVSPIACGAPAGENSIPFILDMCPSIAARGKIYKALRRGD  232

Query  180  QLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN  239
            Q+ PGW  D +G P  DP  +       MLP GG       KG   + ++D+ SG+LSG+
Sbjct  233  QIPPGWALDKDGLPTTDPASALKG---VMLPMGGA------KGSALSIMMDVFSGVLSGS  283

Query  240  GPGFLAGD--NKHS--------QFVMAIKIDLFLDAVDFKSDMDKL  275
                 AG   N H          F +AIK DLF+   +FK  MD L
Sbjct  284  A---FAGHVINPHDPSEPADVGHFFVAIKPDLFMTLEEFKGRMDYL  326


>gi|28379550|ref|NP_786442.1|  malate dehydrogenase (putative) [Lactobacillus plantarum WCFS1]
 gi|28272390|emb|CAD65308.1|  malate dehydrogenase (putative) [Lactobacillus plantarum WCFS1]
Length=362

 Score =  134 bits (338),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 92/260 (35%), Positives = 137/260 (52%), Gaps = 24/260 (9%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQ------ADRMNPRPEVKTLRE  57
            G +EE++     +LI +DL G ESHGV  M+     MY         R++ RPEV  ++E
Sbjct  22   GFTEEESQEVAHMLIYTDLIGIESHGVQRMI-----MYDDFIRNGKIRVHNRPEV--VKE  74

Query  58   TPVSATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDM  117
            T VSA  DA  GLG   G  +M+LAIEKA+  GIG V  +N GH G+  YY  MA +  +
Sbjct  75   TDVSAVVDAHFGLGQLNGIYSMRLAIEKAKQHGIGIVTTRNSGHYGIAGYYANMAAEEGL  134

Query  118  IGICMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRI  177
            IG+   ++   + +P   ++ + GT+PIA+  PA+    F+FD ATT V   K+ + R++
Sbjct  135  IGLSSCNSRSAM-LPTHATKALVGTNPIAFAMPANPN-TFIFDAATTTVPQGKIEVYRKL  192

Query  178  GSQLEPGWITDLEGNPIMDPVDSPNYGGFYML-------PFGG-TRENGGHKGYGFATIV  229
            G  +   W+      P+    D+ +      L       P GG T + G HKG+G   IV
Sbjct  193  GKDMPALWVAKDGETPVNSHNDTKDLDALRDLDSNVGLAPLGGVTEDTGSHKGFGLGVIV  252

Query  230  DIMSGILS-GNGPGFLAGDN  248
            ++ + ILS GN    +  D+
Sbjct  253  EVFTAILSMGNTSNEITPDD  272


>gi|109646806|ref|ZP_01370710.1|  Malate/L-lactate dehydrogenase [Desulfitobacterium hafniense 
DCB-2]
 gi|109642052|gb|EAT51606.1|  Malate/L-lactate dehydrogenase [Desulfitobacterium hafniense 
DCB-2]
Length=352

 Score =  134 bits (336),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 142/282 (50%), Gaps = 19/282 (6%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+SE D  I  D L+ ++LRG +SHGVS     Y+   Q   +NP+P++   + TPV   
Sbjct  27   GVSEADGQIVVDNLLYAELRGIKSHGVSR-FPVYLRRIQMGAVNPQPQISMEQRTPVLLK  85

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D GLG  V   A+   +E AE  GI AV I+   H G   YY  +A +  ++ I ++
Sbjct  86   VDGDNGLGSVVMVHALNRGMELAEQLGICAVGIKGSNHCGASGYYCELAAEQGLVSI-VL  144

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            + G     P  G +  FGT+P+A+G P  ++P  + D+AT+  A  K++     G ++  
Sbjct  145  TDGPPATPPWGGRKAYFGTNPMAFGLPRAQKPHIIVDLATSLAARGKVIRAAAQGEKIPE  204

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG-  242
            GW  D EG P  DP       G  +LP  G       KGY  + +V+ ++G+L G G G 
Sbjct  205  GWALDREGLPTTDP--QAALAGV-LLPMAGA------KGYALSLVVEHLAGVLVGAGFGK  255

Query  243  -----FLAGDNKHS--QFVMAIKIDLFLDAVDFKSDMDKLLE  277
                 +  G+   +   F++ +K D F++  D+    ++ +E
Sbjct  256  DVAWQYSEGNKPANVGHFIILVKADAFMEMADYHKRTEQFVE  297


>gi|89896203|ref|YP_519690.1|  hypothetical protein DSY3457 [Desulfitobacterium hafniense Y51]
 gi|89335651|dbj|BAE85246.1|  hypothetical protein [Desulfitobacterium hafniense Y51]
Length=349

 Score =  134 bits (336),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 142/282 (50%), Gaps = 19/282 (6%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+SE D  I  D L+ ++LRG +SHGVS     Y+   Q   +NP+P++   + TPV   
Sbjct  24   GVSEADGQIVVDNLLYAELRGIKSHGVSR-FPVYLRRIQMGAVNPQPQISMEQRTPVLLK  82

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D GLG  V   A+   +E AE  GI AV I+   H G   YY  +A +  ++ I ++
Sbjct  83   VDGDNGLGSVVMVHALNRGMELAEQLGICAVGIKGSNHCGASGYYCELAAEQGLVSI-VL  141

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            + G     P  G +  FGT+P+A+G P  ++P  + D+AT+  A  K++     G ++  
Sbjct  142  TDGPPATPPWGGRKAYFGTNPMAFGLPRAQKPHIIVDLATSLAARGKVIRAAAQGEKIPE  201

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG-  242
            GW  D EG P  DP       G  +LP  G       KGY  + +V+ ++G+L G G G 
Sbjct  202  GWALDREGLPTTDP--QAALAGV-LLPMAGA------KGYALSLVVEHLAGVLVGAGFGK  252

Query  243  -----FLAGDNKHS--QFVMAIKIDLFLDAVDFKSDMDKLLE  277
                 +  G+   +   F++ +K D F++  D+    ++ +E
Sbjct  253  DVAWQYSEGNKPANVGHFIILVKADAFMEMADYHKRTEQFVE  294


>gi|71002066|ref|XP_755714.1|  malate/L-lactate dehydrogenase [Aspergillus fumigatus Af293]
 gi|66853352|gb|EAL93676.1|  malate/L-lactate dehydrogenase, putative [Aspergillus fumigatus 
Af293]
Length=356

 Score =  133 bits (334),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 95/282 (33%), Positives = 141/282 (50%), Gaps = 20/282 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+S E+A I  D L+ +DLRG ++HG+ N + +Y+   +   ++ +      + TPV A 
Sbjct  27   GVSPENATIIADCLVRADLRGVDTHGI-NRIPSYMERIRQGVLDAKANPVLNQVTPVVAQ  85

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   G G       MK AIE A   GIG V++++  H GM A+    AL   M+ +   
Sbjct  86   VDGQNGFGFIAAHLGMKRAIEMAREFGIGFVSVKHSNHFGMSAWVVQQALDAGMMSLVFT  145

Query  124  SAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            ++   L  PV+G  E + G  P+A GAPA K+ PF+ D+A +  A  K+    R G ++ 
Sbjct  146  NSSPAL--PVWGGREKLMGVSPLACGAPAGKEKPFILDMAPSIAARGKIYKAARRGEKIP  203

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG-P  241
              W  D EG P  DP  +       MLP GG       KG   A ++D+ SG+LSG+   
Sbjct  204  SDWALDGEGRPTDDPHKALEG---VMLPMGGP------KGSALAVMMDVFSGVLSGSAFA  254

Query  242  GFLAGDNKHS------QFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G +      S       F++AIK DLF+   +FK  MD L +
Sbjct  255  GHVTNPYDPSTPADVGHFLVAIKPDLFMGLEEFKERMDYLYQ  296


>gi|44278|emb|CAA36133.1|  L-malate dehydrogenase (AA 339) [Methanothermus fervidus]
Length=339

 Score =  132 bits (332),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 96/282 (34%), Positives = 146/282 (51%), Gaps = 19/282 (6%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G+SEE A I  DV++ +DL+G  SHG+      YV   +   +     ++  +ET   A
Sbjct  19   LGVSEEHAKITADVIVDADLKGFTSHGIGR-FPQYVEGIKLGTIKTSGNIEIEKETDSVA  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              + +  LG  V  K MKLAIEKA+ TG+G V I +  H G+  YY  MA+++DMIGI M
Sbjct  78   LINGNHLLGQVVAYKGMKLAIEKAKNTGVGIVGIHDSNHFGIAGYYSDMAMKNDMIGITM  137

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +    +  P+ G   V GT+PIA   P+++    V D++T  VA  KL+   R   ++ 
Sbjct  138  TNTEPAV-APLGGKIPVLGTNPIAISIPSNEYYVAV-DMSTAAVARGKLLEAARKNEKIP  195

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
             G   D  GNP  DP ++ N     +LPF      GGHKGY    +++I++G L     G
Sbjct  196  EGIAVDKNGNPTTDPNEALNGS---ILPF------GGHKGYALCFMIEILAGPLVKAEFG  246

Query  243  F-LAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
              + G    SQ       ++AI    F D  +FK ++D+ ++
Sbjct  247  SKVKGTVDPSQMCTKGDLLIAIDPSKFYDIEEFKRNVDEFVK  288


>gi|126908|sp|P16142|MDH_METFE  Malate/L-sulfolactate dehydrogenase ((R)-2-hydroxyacid dehydrogenase)
 gi|809713|emb|CAA36010.1|  unnamed protein product [Methanothermus fervidus]
Length=339

 Score =  132 bits (331),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 96/282 (34%), Positives = 146/282 (51%), Gaps = 19/282 (6%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G+SEE A I  DV++ +DL+G  SHG+      YV   +   +     ++  +ET   A
Sbjct  19   LGVSEEHAKITADVIVDADLKGFTSHGIGR-FPQYVEGIKLGTIKTSGNIEIEKETDSVA  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              + +  LG  V  K MKLAIEKA+ TG+G V I +  H G+  YY  MA+++DMIGI M
Sbjct  78   LINGNHLLGQVVAYKGMKLAIEKAKNTGVGIVGIHDSNHFGIAGYYSDMAMKNDMIGITM  137

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +    +  P+ G   V GT+PIA   P+++    V D++T  VA  KL+   R   ++ 
Sbjct  138  TNTEPAV-APLGGKIPVLGTNPIAISIPSNEYYVAV-DMSTAAVARGKLLEAARKNEKIP  195

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
             G   D  GNP  DP ++ N     +LPF      GGHKGY    +++I++G L     G
Sbjct  196  EGIAVDKNGNPTTDPNEALNGS---ILPF------GGHKGYALCFMIEILAGPLVKAEFG  246

Query  243  F-LAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
              + G    SQ       ++AI    F D  +FK ++D+ ++
Sbjct  247  SKVKGTVDPSQMCTKGDLLIAIDPSKFYDIEEFKRNVDEFVK  288


>gi|89056614|ref|YP_512065.1|  Malate/L-lactate dehydrogenase [Jannaschia sp. CCS1]
 gi|88866163|gb|ABD57040.1|  Malate/L-lactate dehydrogenase [Jannaschia sp. CCS1]
Length=362

 Score =  130 bits (328),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 138/281 (49%), Gaps = 17/281 (6%)

Query  3    MGMSEEDAVIATDVLITSDLR--GCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            +G++EEDA I  + LI S+LR    +  GV+  LR Y        +NPR     ++E P 
Sbjct  26   LGLTEEDAGIFANALIFSELRFHPGQGQGVAR-LRRYHERIGNGEVNPRAGWSIVKEGPA  84

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
             A  DA  G+G     KAM LAI+KA+  GIG V ++N  H G  A +   AL+H  IG+
Sbjct  85   LALVDAHNGIGTVAASKAMALAIKKAKEGGIGTVVVRNSTHYGSSAVHACQALEHGCIGV  144

Query  121  CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
               +AG  +  P  G E V GT+P +  AP+D+  P V D+A T      +    R G +
Sbjct  145  AFTNAGPEM-APWGGREGVTGTNPWSIAAPSDQGFPTVLDIAITTAGKGMMNWLIREGKK  203

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
            +   W    +G+   DP  +         P  G    GGHKGYG A + + ++G+LSG G
Sbjct  204  MPLDWAITPDGDETDDPAAA------LKGPLLGI---GGHKGYGLAFMTEALTGVLSGGG  254

Query  241  PGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
             G     +      S +  AI I+ F+D  D+ + M   ++
Sbjct  255  FGLTPYSDPQKLDVSHYFQAIDIEWFMDPDDYATRMGAFVQ  295


>gi|45358696|ref|NP_988253.1|  L-sulfolactate dehydrogenase/(S)-hydroxyglutaric acid dehydrogenase 
[Methanococcus maripaludis S2]
 gi|45047562|emb|CAF30689.1|  L-sulfolactate dehydrogenase/(S)-hydroxyglutaric acid dehydrogenase 
[Methanococcus maripaludis S2]
Length=347

 Score =  130 bits (327),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 138/280 (49%), Gaps = 24/280 (8%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+ EE A I  ++   +DL+G  SHG+    +  + + + + +   PE+K ++E+P  AT
Sbjct  22   GVKEEHAKITAEIYTEADLKGFTSHGIGRFPQTIIGL-ETENIKTDPEIKIIKESPAIAT  80

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             + D  LG      AM LA+EKA+  GIGAVA  N  H G+  +Y   A +  MIGI + 
Sbjct  81   INGDLALGYVTAAMAMDLAVEKAKNVGIGAVATYNSNHFGITGHYSERASKKGMIGIAIT  140

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            +    +  P  G + + GT+PIA  A + K+  +  D+AT  VA  K+   +R+G  L  
Sbjct  141  NTEPAM-APYGGKDKILGTNPIAI-AVSGKKHKYSLDMATASVARGKIFEAKRLGKILPE  198

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGI----LSGN  239
                D+ GN   DP D    G   +LPFGG       KGYG A  V+I+S I    +  N
Sbjct  199  NAAVDINGNITTDP-DKALAGS--ILPFGGI------KGYGIAMAVEILSAIGGAEIGTN  249

Query  240  GPGFLAGDNKHSQFVMAIKID--------LFLDAVDFKSD  271
              G    D K ++  + I I+         FLD  DF  D
Sbjct  250  VKGTARADEKCTKGDLFIAINPEFFGEKSEFLDKTDFLVD  289


>gi|58388874|ref|XP_316604.2|  ENSANGP00000025275 [Anopheles gambiae str. PEST]
Length=365

 Score =  130 bits (327),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 80/224 (35%), Positives = 113/224 (50%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  N       L ETP +A  D + GLG  V
Sbjct  41   DLLVEADYRGHFSHGM-NRLEMYINDLHKNACNGSAVPAVLNETPATAWVDGNNGLGAVV  99

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI KA+  G+G V  +   H G+  +Y L A+    IG+ M +    L  P  
Sbjct  100  GNFCMDLAIRKAKEVGVGWVCAKRSNHYGIAGWYTLRAMNAGCIGMSMTNT-SPLASPTR  158

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+PI+ GAP      FV D+ATT VA  K+ + RR    +  GW    +G+P 
Sbjct  159  SKEAALGTNPISVGAPGKDGDGFVLDMATTAVAVGKIEMQRRKNEPIPVGWAQGPDGHPT  218

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D   S  +    ++P GGT    G+KGYG   +V++  G+L+G
Sbjct  219  TDA--SVAFDTACLMPLGGTELTSGYKGYGLGAMVEVFCGVLAG  260


>gi|116127193|gb|EAA44260.3|  ENSANGP00000025275 [Anopheles gambiae str. PEST]
Length=363

 Score =  130 bits (327),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 80/224 (35%), Positives = 113/224 (50%), Gaps = 4/224 (1%)

Query  15   DVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQV  74
            D+L+ +D RG  SHG+ N L  Y+     +  N       L ETP +A  D + GLG  V
Sbjct  40   DLLVEADYRGHFSHGM-NRLEMYINDLHKNACNGSAVPAVLNETPATAWVDGNNGLGAVV  98

Query  75   GPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVF  134
            G   M LAI KA+  G+G V  +   H G+  +Y L A+    IG+ M +    L  P  
Sbjct  99   GNFCMDLAIRKAKEVGVGWVCAKRSNHYGIAGWYTLRAMNAGCIGMSMTNT-SPLASPTR  157

Query  135  GSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPI  194
              E   GT+PI+ GAP      FV D+ATT VA  K+ + RR    +  GW    +G+P 
Sbjct  158  SKEAALGTNPISVGAPGKDGDGFVLDMATTAVAVGKIEMQRRKNEPIPVGWAQGPDGHPT  217

Query  195  MDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             D   S  +    ++P GGT    G+KGYG   +V++  G+L+G
Sbjct  218  TDA--SVAFDTACLMPLGGTELTSGYKGYGLGAMVEVFCGVLAG  259


>gi|67901292|ref|XP_680902.1|  hypothetical protein AN7633.2 [Aspergillus nidulans FGSC A4]
 gi|40742629|gb|EAA61819.1|  hypothetical protein AN7633.2 [Aspergillus nidulans FGSC A4]
Length=361

 Score =  128 bits (321),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 90/276 (32%), Positives = 137/276 (49%), Gaps = 20/276 (7%)

Query  10   AVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTG  69
            A I    L+ +DLRG ++HG SN + +Y+   + + ++P    +  + TP++A  D    
Sbjct  36   ATIVAACLVQADLRGVDTHG-SNRIPSYMQRIRQNVLDPAASPEITQITPIAALVDGKNT  94

Query  70   LGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRL  129
             G       MK AIE A   G+G V++++  H GM A+    A+   M+ +   ++   L
Sbjct  95   FGFVSAHMGMKRAIEMANEFGLGLVSVKHSNHFGMSAWLVQQAIDAGMMSLVFTNSSPAL  154

Query  130  QVPVFG-SETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITD  188
              PV+G  E + G  PIA GAPA K+ PF+ D+A +  A  K+    R G  +   W  D
Sbjct  155  --PVWGGKEKLMGVSPIACGAPAGKERPFILDMAPSVAARGKIYKALRRGENIPTDWALD  212

Query  189  LEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG-PGFLAGD  247
             +GN   DP  +       MLP GG       KG   A ++D+ SG+ SG+   G + G 
Sbjct  213  RDGNITDDPARALEG---VMLPMGGP------KGSALAVMMDVFSGVFSGSAFAGHVTGP  263

Query  248  NKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
               S+      F++AIK DLF+   DFK  MD L +
Sbjct  264  YDPSKPADVGHFLLAIKPDLFVSLEDFKERMDYLYQ  299


>gi|113872023|ref|ZP_01412152.1|  Malate dehydrogenase (NADP+) [Sinorhizobium medicae WSM419]
 gi|113726695|gb|EAU07787.1|  Malate dehydrogenase (NADP+) [Sinorhizobium medicae WSM419]
Length=348

 Score =  127 bits (320),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 86/281 (30%), Positives = 140/281 (49%), Gaps = 20/281 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GM  + A    D L+ +DLRG  SHGV+  L +Y+   +A  M   P+++ +RE P S  
Sbjct  24   GMRPQPAATVADTLVYADLRGVSSHGVAR-LGSYLDRIRAGVMEIDPQMRLIREAPASGL  82

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             DA  G G   G  AM++AIEKA++ G   + I N  H G+ AY+   A +  M+GI + 
Sbjct  83   LDAGNGFGQIAGMTAMEIAIEKAKSAGSAVIGIANSNHFGVAAYFAERATRAGMVGIVLT  142

Query  124  SAGGRLQVPVFGSET-VFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            ++   +    F +   + GT+PIA+G PA  + P + D++T+ VA  K+ L    G  + 
Sbjct  143  NSSPAMT--AFNTRIPLIGTNPIAFGIPAGAERPIILDMSTSLVARGKIRLASLTGKPIP  200

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
             GW  D  G    D          +    G     GG KG G + I+D+++G+L+G G  
Sbjct  201  LGWAYDDRGLSTEDA---------HAALKGSLAPIGGPKGAGLSLIIDLLTGVLTGTGLT  251

Query  243  F-------LAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLL  276
                    ++G ++    ++A  +  F+    FKS +D ++
Sbjct  252  GEVKNITDISGPSRTGHLMIAFDVSRFISPELFKSSVDSVV  292


>gi|92089586|ref|ZP_01274524.1|  Malate/L-lactate dehydrogenase [Lactobacillus reuteri 100-23]
 gi|91803664|gb|EAS88525.1|  Malate/L-lactate dehydrogenase [Lactobacillus reuteri 100-23]
Length=358

 Score =  126 bits (316),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 84/290 (28%), Positives = 140/290 (48%), Gaps = 17/290 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G +++D+ +  D L+ +DLRG  SHG+   L  Y  M +   + P+ + K +RE P S
Sbjct  18   KLGFNQDDSQLLADTLVDADLRGISSHGIQR-LAWYRRMIKEGTIIPQNKAKIIRELPGS  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
               DA+  +G      A +  IEKA+ TG+    I+N  H G   YY  +ALQ  ++G+ 
Sbjct  77   VLVDANQNMGQLATVLATQKIIEKAKKTGVAIAVIRNSNHFGTAGYYTRLALQAGLVGVA  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            + +    L VP   ++   G++  A+G PA    PF+FD AT  V+  K+ +  + G  L
Sbjct  137  LTNT-RPLVVPTNATQAFLGSNAFAFGFPASPH-PFMFDGATCVVSGGKIQVHAKKGEPL  194

Query  182  EPGWITDLEGNPIMDPVDSPNY------------GGFYMLPFGGTRENGGHKGYGFATIV  229
               W  D     + D  ++ +             GG  +   G   EN  +KG G + ++
Sbjct  195  PGEWAVDKNRQVVTDAQEAEDILATAAFTEGEQKGGGVLTLGGSNEENSNYKGMGNSIVI  254

Query  230  DIMSGILSGN--GPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
            ++++GIL+        ++G +  SQFVM +    F D    K D   +L+
Sbjct  255  ELLTGILAQGSISADTVSGKHDFSQFVMVLNPAFFGDPEVLKKDATSMLD  304


>gi|52079536|ref|YP_078327.1|  putative Ureidoglycolate dehydrogenase [Bacillus licheniformis 
ATCC 14580]
 gi|52784901|ref|YP_090730.1|  hypothetical protein BLi01129 [Bacillus licheniformis ATCC 14580]
 gi|52002747|gb|AAU22689.1|  putative Ureidoglycolate dehydrogenase [Bacillus licheniformis 
ATCC 14580]
 gi|52347403|gb|AAU40037.1|  putative protein [Bacillus licheniformis DSM 13]
Length=342

 Score =  125 bits (315),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 113/237 (47%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K G+ EE A    D+LI +D RG  SHG   M + Y         N +P +   +  P S
Sbjct  23   KAGLPEEQADKTADLLIFADERGVHSHGAVRM-QYYSERALKGGYNLKPNLSFEKTGPAS  81

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
              +  D  LG  V  +AMK AIE A+T+GIG V ++  GH G + YY   A    M  + 
Sbjct  82   GIYHGDNALGHYVSYQAMKKAIELAKTSGIGVVGVKEMGHSGAIGYYAHQAALEGMAAL-  140

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             V     + VP  G+E  FGT+ IA+ AP     P +FD+ATT  A  K++  R     +
Sbjct  141  TVCQSDPMVVPFGGTEPYFGTNSIAFSAPRKDGSPILFDMATTVQAWGKILDARSKNKSI  200

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
               W  D  G P  DP     +    +LP  G       KGYG A +VDI+SG L G
Sbjct  201  PDSWAVDKNGAPTTDP-----FKVNALLPMAGP------KGYGLAMMVDILSGSLLG  246


>gi|90419349|ref|ZP_01227259.1|  putative malate dehydrogenase [Aurantimonas sp. SI85-9A1]
 gi|90336286|gb|EAS50027.1|  putative malate dehydrogenase [Aurantimonas sp. SI85-9A1]
Length=381

 Score =  125 bits (314),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 87/279 (31%), Positives = 137/279 (49%), Gaps = 14/279 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            GMS+  A +  DVL+ +DL G +SHG++ +L  Y            P ++ + +    A 
Sbjct  49   GMSDAHAAVTADVLVAADLMGIDSHGLT-LLPLYDQQLGNGGATATPNIEVVHDMGAVAL  107

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D G G   G  A+ +A E+A   GI A++I+N  H G    Y     +  ++GI   
Sbjct  108  IDGDAGFGQVPGMMAVDMAAERAGRFGISAISIRNSNHYGAAGVYVRRLAEQGLVGISTS  167

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            S      VP  G     GT+PIA+ AP+ +  PF+ D+AT+  A  KL L +R  ++L  
Sbjct  168  SVWRAGIVPTGGLAPKLGTNPIAFAAPSARGQPFLLDMATSTAAIGKLKLAQRAETELPE  227

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPGF  243
            GW    +G P  DP  +                 GGHKGYG AT+V+++S +LSG     
Sbjct  228  GWALTRQGTPQRDPNLALLD--------PLLAPLGGHKGYGLATMVEVLSSVLSGAALTP  279

Query  244  LAGD--NKHS--QFVMAIKIDLFLDA-VDFKSDMDKLLE  277
            L G    KH    F++A+   +   +   F++D+D++++
Sbjct  280  LRGKPGQKHDVGHFILALDPAMIRGSRAAFEADLDRMVD  318


>gi|90418628|ref|ZP_01226539.1|  putative malate/L-lactate dehydrogenase [Aurantimonas sp. SI85-9A1]
 gi|90336708|gb|EAS50413.1|  putative malate/L-lactate dehydrogenase [Aurantimonas sp. SI85-9A1]
Length=348

 Score =  125 bits (314),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 135/282 (47%), Gaps = 19/282 (6%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            + + E DA    ++++ +D  G ++HG+   LR YV   +    NP      LRET  +A
Sbjct  22   LKVPEGDARAVAELMVEADRLGYDTHGLFR-LRQYVNRLRDGGCNPAANPHVLRETVATA  80

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              D D GLG     +A  LAI KA   GIG V ++   H G  A Y     +  MIGIC 
Sbjct  81   LIDGDNGLGQLAMAQACDLAIIKARQAGIGWVGVRGGNHAGPAALYVRPQARAGMIGICA  140

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
                     P  G++ + GT+PIA+ AP     PFV D+ATT  A  K+    + G  + 
Sbjct  141  AVGSANHVAPYGGTDLLLGTNPIAFAAPGGAD-PFVLDMATTVAAMGKIKTLAQKGEPMP  199

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
             GW+   +G P+ DP +  + G  ++LP GG       KGYG A ++ +++G+L+G   G
Sbjct  200  EGWMVGRDGKPLTDP-NRKDEG--FLLPIGGP------KGYGLAMVIGLLAGVLNGAAFG  250

Query  243  FLAGD--------NKHSQFVMAIKIDLFLDAVDFKSDMDKLL  276
                D            QFV AI I  F D  DF +  +++ 
Sbjct  251  SDVVDFTKDTESPTNTGQFVAAIDIAAFGDLGDFTATANRVF  292


>gi|28377875|ref|NP_784767.1|  malate / lactate dehydrogenase [Lactobacillus plantarum WCFS1]
 gi|28270708|emb|CAD63614.1|  malate / lactate dehydrogenase [Lactobacillus plantarum WCFS1]
Length=362

 Score =  125 bits (313),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 89/285 (31%), Positives = 134/285 (47%), Gaps = 16/285 (5%)

Query  6    SEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWD  65
            S +D  +  D L+ +DLRG  SHG+   L  Y  M +   + P  + K L ETP S   D
Sbjct  22   SAKDGALLADTLVDADLRGISSHGIQR-LAWYTRMIKDHTLEPTHQPKILNETPTSLLID  80

Query  66   ADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSA  125
            A+  +G       M   IEK +  G+    I+N  H G   YY  MA +  +IGI   + 
Sbjct  81   ANQSMGQIASAFTMNKLIEKTKQLGVSLAVIRNSNHFGTAGYYSRMACKAGLIGISTTNT  140

Query  126  GGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGW  185
               L VP   +E   G++ +A+  PAD   PFVFD AT  V++ K+ +  + G+Q+   W
Sbjct  141  -RPLVVPTNATEAFLGSNALAFTFPADPH-PFVFDGATAVVSSGKIQVLAKKGAQIPGDW  198

Query  186  ITDLEGNPIMDPVD----------SPNYGGFYMLPFGGTRE-NGGHKGYGFATIVDIMSG  234
              D     + D             S N  G  +L  GG +E N  +KG+G + I+++++G
Sbjct  199  AVDEHRQVLHDAQTVEDNLTKIAFSENRPGGGVLTLGGQQEVNSNYKGFGNSLIIELLTG  258

Query  235  ILSGNGPGFLAGDNKH--SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
            IL+           KH  SQF M I   LF D    K+++  + +
Sbjct  259  ILAQGSLSADTNTGKHDFSQFFMTINPALFGDPEVLKANVTTMFD  303


>gi|89090677|ref|ZP_01163719.1|  malate / lactate dehydrogenase [Lactobacillus reuteri JCM 1112]
 gi|89079481|gb|EAR58770.1|  malate / lactate dehydrogenase [Lactobacillus reuteri JCM 1112]
Length=358

 Score =  124 bits (310),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 83/290 (28%), Positives = 140/290 (48%), Gaps = 17/290 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G + +D+ +  D L+ +DLRG  SHG+   L  Y  M +   + P+ + K +RE P S
Sbjct  18   KLGFNHDDSQLLADTLVDADLRGISSHGIQR-LAWYRRMIKEGTIIPQNKAKIIRELPGS  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
               DA+  +G      A +  IEKA+ TG+    I+N  H G   YY  +AL+  ++G+ 
Sbjct  77   VLVDANQNMGQLATVLATQKIIEKAKKTGVAIAVIRNSNHFGTAGYYTRLALEAGLVGVA  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            + +    L VP   ++   G++  A+G PA    PF+FD AT  V+  K+ +  + G  L
Sbjct  137  LTNT-RPLVVPTNATQAFLGSNAFAFGFPASPY-PFMFDGATCVVSGGKIQVHAKKGEPL  194

Query  182  EPGWITDLEGNPIMDPVDSPNY------------GGFYMLPFGGTRENGGHKGYGFATIV  229
               W  D +   + D  ++ +             GG  +   G   EN  +KG G + ++
Sbjct  195  PGEWAVDKDRQVVTDAQEAEDILATAAFTEGEQKGGGVLTLGGSNEENSNYKGMGNSIVI  254

Query  230  DIMSGILSGN--GPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
            ++++GIL+        ++G +  SQFVM +    F D    K D   +L+
Sbjct  255  ELLTGILAQGSISADTVSGKHDFSQFVMVLNPAFFGDPEVLKKDATSMLD  304


>gi|47225928|emb|CAF98408.1|  unnamed protein product [Tetraodon nigroviridis]
Length=361

 Score =  122 bits (307),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 118/238 (49%), Gaps = 9/238 (3%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G     A    +VL+  D RG  SHG+ N +  YV   Q+       E    +++  +A
Sbjct  22   VGTKPHHARSLAEVLVEGDHRGHYSHGL-NRMDMYVKDIQSGICAKEGEPVVEKQSAATA  80

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              D    LG  VG   M LA++KA+  GIG V      H G+  +Y ++AL+ +MI +  
Sbjct  81   LVDGKNLLGPVVGNFCMDLAVKKAKEVGIGWVVAHGSNHYGIAGHYAMLALKENMIHVIH  140

Query  123  --VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
              V  GG  +    G +   GT+PI+  AP      FV D+AT+ VA  K+ L  R G  
Sbjct  141  QHVPTGGSTR----GKQCTLGTNPISVAAPGKDGDSFVLDMATSAVALGKVELHDRRGDS  196

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            +  GW  D EG    DP    N GG  ++P GG+   GG+KGYG   +V++  GIL+G
Sbjct  197  IPEGWGCDAEGKLSTDPKKVLNGGG--LVPIGGSEATGGYKGYGLGMMVEVFCGILAG  252


>gi|77976888|ref|ZP_00832355.1|  COG2055: Malate/L-lactate dehydrogenases [Yersinia intermedia 
ATCC 29909]
Length=349

 Score =  122 bits (306),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 80/235 (34%), Positives = 113/235 (48%), Gaps = 13/235 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+S++ A I  DVL  +D RG  SHG    +  Y        +N  P        P SA 
Sbjct  20   GLSQDHAAIVADVLAHADARGIHSHGAVR-VEYYAERISKGGINNHPNFTFTPTGPCSAV  78

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
            +D D G G      +M  AIE A++ G+  V ++  GH G L+Y+   A    MIGI + 
Sbjct  79   FDGDNGAGHVAAKMSMDHAIEMAKSAGVAVVGVRRIGHSGALSYFVQQAAHAGMIGISLC  138

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
             +   + VP  G+E  +GT+PIA+ APA+ +    FD+ATT  A  K++  R     +  
Sbjct  139  QSD-PMVVPYGGAEVYYGTNPIAFAAPAEGEDIVTFDMATTVQAWGKVLDARSRNVPIPD  197

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
             W  D EG    DP     +    +LP  G       KGYG   +VDI+SG+L G
Sbjct  198  TWAVDKEGKNTTDP-----FAVSGLLPIAGP------KGYGLMMMVDILSGVLLG  241


>gi|15679216|ref|NP_276333.1|  malate dehydrogenase [Methanothermobacter thermautotrophicus 
str. Delta H]
 gi|17366164|sp|O27273|COMC_METTH  L-sulfolactate dehydrogenase ((R)-sulfolactate dehydrogenase)
 gi|2622314|gb|AAB85694.1|  malate dehydrogenase [Methanothermobacter thermautotrophicus 
str. Delta H]
Length=341

 Score =  122 bits (306),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 86/282 (30%), Positives = 141/282 (50%), Gaps = 19/282 (6%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            M + EE + I  DV + +DL+G  SHG+      YV   +   +    ++   RET  +A
Sbjct  19   MNVPEESSDIVADVTLDADLKGFSSHGIGR-FPQYVDGLRHGTIRADGDITIERETESTA  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              + +   G  V  +AM+LAIEKA  TG+G V + +  H G+  YY  MA+ +DMIG+ +
Sbjct  78   LINGNHIFGHVVAYRAMELAIEKARNTGVGLVGVHDSNHFGVAGYYSDMAVMNDMIGVVI  137

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +    +  P+ G + + GT+P+A G P+++    V D+AT+  A  KL+   R G  + 
Sbjct  138  ANTEPAV-APIGGRKPILGTNPVAIGIPSNRYYVSV-DMATSASARGKLLEAARKGESIP  195

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
                 D EG P  DP  +       +LPF      GGHKGY  + +++I++G L G   G
Sbjct  196  ENVALDAEGKPTTDPEMALKGS---ILPF------GGHKGYALSFMIEILAGPLVGAAFG  246

Query  243  FLAGDNKHSQ-------FVMAIKIDLFLDAVDFKSDMDKLLE  277
                   + +        +MAI     +D  +F++ +D+ +E
Sbjct  247  TAVTGTANPEEMCTKGDLMMAIDPSKMVDPDEFRAQVDEFIE  288


>gi|27378028|ref|NP_769557.1|  hypothetical oxidoreductase [Bradyrhizobium japonicum USDA 110]
 gi|27351174|dbj|BAC48182.1|  hypothetical oxidoreductase [Bradyrhizobium japonicum USDA 110]
Length=357

 Score =  122 bits (305),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 125/238 (52%), Gaps = 12/238 (5%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G S+ +A + +  L+ ++LRG +SHGV  M+  YV       +     VK + +T    T
Sbjct  24   GSSDREAELVSANLVEANLRGHDSHGVG-MIPRYVQSVTNGGLAVNQHVKIVLDTGPLLT  82

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D  TG G  +G +AM+LA E+A++ G+  V + N  H+G + ++    + H ++ I  V
Sbjct  83   LDGLTGYGQVIGHEAMELAAERAKSNGVCLVGLSNAHHIGRIGHWAEQCIDHGLVSIHFV  142

Query  124  SAGGR-LQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            +   R +  P  GS+   GT+P   G P   + P V D AT+++A  K  +    G +LE
Sbjct  143  NVISRPIVAPWGGSDARHGTNPFCVGIPRRGKEPIVLDFATSRIAQGKTRVAHNKGVELE  202

Query  183  PGWITDLEGNPIMDPVDS--PNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            PG I D EG P ++P  +  P YG   +LPF      G HKG G A + +I+ G LSG
Sbjct  203  PGTIIDNEGKPTVNPRYTVIPPYGA--ILPF------GEHKGSGLALVCEILGGALSG  252


>gi|15891722|ref|NP_357394.1|  hypothetical protein AGR_L_3209 [Agrobacterium tumefaciens str. 
C58]
 gi|62738880|pdb|1Z2I|A  Chain A, Crystal Structure Of Agrobacterium Tumefaciens Malate 
Dehydrogenase, New York Structural Genomics Consortium
 gi|62738881|pdb|1Z2I|B  Chain B, Crystal Structure Of Agrobacterium Tumefaciens Malate 
Dehydrogenase, New York Structural Genomics Consortium
 gi|62738882|pdb|1Z2I|C  Chain C, Crystal Structure Of Agrobacterium Tumefaciens Malate 
Dehydrogenase, New York Structural Genomics Consortium
 gi|62738883|pdb|1Z2I|D  Chain D, Crystal Structure Of Agrobacterium Tumefaciens Malate 
Dehydrogenase, New York Structural Genomics Consortium
 gi|15160184|gb|AAK90179.1|  AGR_L_3209p [Agrobacterium tumefaciens str. C58]
Length=358

 Score =  120 bits (302),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 95/286 (33%), Positives = 141/286 (49%), Gaps = 23/286 (8%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G  EE A  AT  ++     G +SHGV  +L +YV   +  R+N RP++  +       
Sbjct  28   VGTDEETADAATRAMMHGTRLGVDSHGV-RLLAHYVTALEGGRLNRRPQISRVSGFGAVE  86

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
            T DAD   G +    AM+ A+  AE  GIGAVAI+N  H G    Y L A +   IG+  
Sbjct  87   TIDADHAHGARATYAAMENAMALAEKFGIGAVAIRNSSHFGPAGAYALEAARQGYIGLAF  146

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             ++   +++   G+    GT+PIA G PA    P++ D+AT+ V  N+++L R +G QL 
Sbjct  147  CNSDSFVRLHD-GAMRFHGTNPIAVGVPAADDMPWLLDMATSAVPYNRVLLYRSLGQQLP  205

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYML-PFGGTRENGGHKGYGFATIVDIMSGILSG---  238
             G  +D +G      VD+ +     ML P GG     G KG   A +V+I S +L+G   
Sbjct  206  QGVASDGDG------VDTRDPNAVEMLAPVGG---EFGFKGAALAGVVEIFSAVLTGMRL  256

Query  239  -------NGPGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                    GP F +       FV+A+K + FL+   F   M + LE
Sbjct  257  SFDLAPMGGPDF-STPRGLGAFVLALKPEAFLERDVFDESMKRYLE  301


>gi|111069064|gb|EAT90184.1|  hypothetical protein SNOG_01972 [Phaeosphaeria nodorum SN15]
Length=366

 Score =  120 bits (302),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 141/281 (50%), Gaps = 21/281 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+  ++AVI    L+ +DLRG ++HG+ N + +Y+A  +   ++        + TP  A 
Sbjct  28   GVPRDNAVIVAKCLVEADLRGVDTHGM-NRIPSYMARIREGVLDAGVSPTLRQITPAVAQ  86

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   G G     K M  AI+ A+T GIG V++++  H GM A+    AL  +M+ +   
Sbjct  87   VDGHNGFGFLAASKGMAAAIDMAQTIGIGMVSVKHSNHFGMSAWVVQQALDANMMSLVFT  146

Query  124  SAGGRLQVPVFGSET-VFGTHPIAWGAPADKQ-PPFVFDVATTQVAANKLMLTRRIGSQL  181
            ++   L  P +G ++ + G  PIA GAPA K+  PF+ D+A +  A  K+    R G ++
Sbjct  147  NSSPAL--PAWGGKSKLMGVSPIACGAPAGKKGRPFIMDMAPSVAARGKIYKALRRGEKI  204

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG-  240
               W  D EG    DP  +       MLP GG       KG   A ++D+ SG+LSG+  
Sbjct  205  PEDWALDKEGRRTSDPALALEG---VMLPMGGP------KGSAIAIMMDVFSGVLSGSAF  255

Query  241  PGFLAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKL  275
             G +      S+      F++AIK DLF+   +F+  MD L
Sbjct  256  AGHVTNPYDPSRPADVGHFLVAIKPDLFMSIEEFRERMDYL  296


>gi|91086649|ref|XP_967350.1|  PREDICTED: similar to CG10512-PA, isoform A [Tribolium castaneum]
Length=352

 Score =  120 bits (301),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 120/246 (48%), Gaps = 29/246 (11%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQAD------RMNPRPEVKTLR  56
            +G  + +A    D+L+ +D RG  SHG+     N V MY ++      + +  PE+  L+
Sbjct  29   VGAPKSNAEALADLLVEADYRGHYSHGM-----NRVEMYLSEIQNGICKTDAVPEI--LK  81

Query  57   ETPVSATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHD  116
            E+P +A  D  +GLG+ VG   M LAI+KA+  G+G V  +   H G+   Y L A++  
Sbjct  82   ESPATAWVDGHSGLGVIVGNFCMDLAIQKAQKVGVGFVVCKGSNHYGIAGKYALQAMEKG  141

Query  117  MIGICMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRR  176
            +IG+   +    +  P    +   GT+P++  AP      F  D+AT+ VA  K+ + +R
Sbjct  142  LIGLSFTNTSPAV-APTRTRQAALGTNPLSLAAPGLNGDSFCLDMATSAVALGKIEMKKR  200

Query  177  IGSQLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGIL  236
              S++   W     G                + P GG+ EN  +KGYG A +V+I  GIL
Sbjct  201  TNSEIPAQWWDSQTGA---------------LHPLGGSEENSSYKGYGLAALVEIFCGIL  245

Query  237  SGNGPG  242
             G   G
Sbjct  246  GGGAYG  251


>gi|46124275|ref|XP_386691.1|  hypothetical protein FG06515.1 [Gibberella zeae PH-1]
 gi|42555457|gb|EAA78300.1|  hypothetical protein FG06515.1 [Gibberella zeae PH-1]
Length=357

 Score =  120 bits (301),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 93/284 (32%), Positives = 140/284 (49%), Gaps = 23/284 (8%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+  E+A I +  LI +DLRG ++HG+ N + +Y+   +   ++   +    + TP  A 
Sbjct  30   GIPSENASIISRCLIAADLRGVDTHGM-NRIPSYMERIRQGVLSATAQPILTQVTPAVAQ  88

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D   G G     K M  AIE A   GIG  +I++  H GM A+    AL  DM+ +   
Sbjct  89   VDGQNGFGFVAAHKGMAAAIESARIFGIGMASIKHSNHFGMSAWIVQQALDADMMSLVFT  148

Query  124  SAGGRLQVPVFGSET-VFGTHPIAWGAPADKQP--PFVFDVATTQVAANKLMLTRRIGSQ  180
            ++   L  P FG ++ + G  PIA GAP  K P   F+ D+A +  A  K+   +R G +
Sbjct  149  NSSPAL--PAFGGKSKLMGVSPIACGAPG-KGPMENFILDMAPSVAARGKIYKAKRRGEK  205

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
            +   W  D +G P  DP      GG  MLP GG       KG   + ++D+ SG+LSG+ 
Sbjct  206  IPLDWALDSDGRPTDDP--EAALGGV-MLPMGGP------KGSALSIMMDVFSGVLSGSA  256

Query  241  -PGFLAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
              G + G    S+      F++AIK DLF+   +F+  M  L E
Sbjct  257  FAGHVTGPYDPSKPADVGHFLVAIKPDLFMSLDEFRERMQYLYE  300


>gi|113867275|ref|YP_725764.1|  Malate/L-lactate dehydrogenase [Ralstonia eutropha H16]
 gi|113526051|emb|CAJ92396.1|  Malate/L-lactate dehydrogenase [Ralstonia eutropha H16]
Length=344

 Score =  119 bits (298),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 131/275 (47%), Gaps = 29/275 (10%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E  G++ + A  A   L+ S+LRG ++HG++  + +YV   +A   NPRPE+ + +  P 
Sbjct  19   ESCGVAPDQATQAAAALVRSELRGYKTHGLTR-VPSYVERLRAGDFNPRPEM-SHKTFPG  76

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
                DAD  +G   GP+A++L +E  +++    VA+Q+CGH+G L    L+A +      
Sbjct  77   GVVLDADGAMGQIAGPRAVQLGLEALQSSASVLVAVQSCGHLGALGIPALLAAEAG--AF  134

Query  121  CMVSAGGRLQVPVFGSE----TVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRR  176
            CMV   G+   PV G E       G +PIA+G P     P VFDVA +  A   ++L  R
Sbjct  135  CMV---GQRTPPVLGMEGFARAAIGHNPIAFGCPLPGAAPIVFDVACSVAARGHILLAAR  191

Query  177  IGSQLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGIL  236
             G  +  GW  D +G+P  D   +           G     GGHKG G A +V+ ++G +
Sbjct  192  EGKPIPAGWALDADGHPTTDAQRALE---------GSLLPTGGHKGIGIAMMVECLAGAM  242

Query  237  SGNGPGFLAGDN---------KHSQFVMAIKIDLF  262
            +          N         +   FV  +K D F
Sbjct  243  AATADSLSPARNTVSGAGAVGRQGGFVWLVKPDAF  277


>gi|39936817|ref|NP_949093.1|  malate dehydrogenase-like protein [Rhodopseudomonas palustris 
CGA009]
 gi|39650674|emb|CAE29197.1|  malate dehydrogenase-like protein [Rhodopseudomonas palustris 
CGA009]
Length=361

 Score =  118 bits (296),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 83/250 (33%), Positives = 125/250 (50%), Gaps = 15/250 (6%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E+ G S+E+A      L T++L G +SHGV   +  Y+    A  ++P   V    + P 
Sbjct  18   ERAGSSKEEARRIASYLTTANLTGHDSHGVIR-VPVYIRWRNAGAVHPDQTVDVPVDLPS  76

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
             A  D   G G  VGP+A+++ I+K +  G+ AVA++N GH+G +  +  MA    ++ I
Sbjct  77   LAVVDGKFGYGQTVGPQAVRIGIDKCKAQGLSAVALKNAGHIGRIGDWAEMAAAEGLVSI  136

Query  121  CMVSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGS  179
              V+A G + V  FG  E    T P   G P    PP V D+AT+ VA  K+++  R G 
Sbjct  137  HFVTAAGSILVAPFGGVERRLSTAPYCVGIPRPDAPPVVLDLATSIVAEGKVLVAARGGK  196

Query  180  QLEPGWITDLEGNPIMDPV--------DSP-NYGGFYMLPFGGTRENGGHKGYGFATIVD  230
            +L  G + + +G+   DP         D P N+        G  R  G HKG G A I +
Sbjct  197  KLPQGALINADGSLSEDPATLYGPHEKDGPINHANGR----GAIRAFGEHKGSGLALICE  252

Query  231  IMSGILSGNG  240
            ++ G L+GNG
Sbjct  253  LLGGALTGNG  262


>gi|86748833|ref|YP_485329.1|  Malate/L-lactate dehydrogenase [Rhodopseudomonas palustris HaA2]
 gi|86571861|gb|ABD06418.1|  Malate/L-lactate dehydrogenase [Rhodopseudomonas palustris HaA2]
Length=361

 Score =  118 bits (295),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 84/248 (33%), Positives = 124/248 (50%), Gaps = 11/248 (4%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E+ G S+E+A      L T++L G +SHGV   +  Y+    A  ++P   V    + P 
Sbjct  18   ERAGSSKEEARRIGSYLTTANLTGHDSHGVIR-VPVYIRWRNAGAVHPDQVVGVPVDLPS  76

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
             A  D   G G  VGP+A+++ I+K +  G+ AV ++N GH+G +  +  MA    ++ I
Sbjct  77   LAVVDGKYGYGQTVGPQAVRIGIDKCKAQGLSAVGLKNAGHIGRIGDWAEMAAAEGLVSI  136

Query  121  CMVSAGGRLQV-PVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGS  179
              V+A G + V P  G E    T P   G P    PP V D AT+ VA  K+++  R G 
Sbjct  137  HFVTAAGSILVAPYGGVERRLSTAPYCVGVPRPGAPPVVLDFATSIVAEGKVLVAARGGK  196

Query  180  QLEPGWITDLEGNPIMDPVDSPNYGGF-------YMLPFGGTRENGGHKGYGFATIVDIM  232
            QL  G + + +G    DP  +  YG F       ++   G  R  G HKG G A I +++
Sbjct  197  QLPKGALINPDGTFSEDP--ATLYGPFEKDGPINHVNGAGAIRAFGEHKGSGLALICELL  254

Query  233  SGILSGNG  240
             G LSGNG
Sbjct  255  GGALSGNG  262


>gi|16766382|ref|NP_461997.1|  putative malate/L-lactate dehydrogenase [Salmonella typhimurium 
LT2]
 gi|16421633|gb|AAL21956.1|  putative malate; L-lactate dehydrogenase [Salmonella typhimurium 
LT2]
Length=335

 Score =  118 bits (295),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 116/237 (48%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            + G+  + A    DVL+ +D+ G  SHGV   + +Y     A  +NP+      + +P  
Sbjct  21   QAGLDAQTAQQVADVLVHADITGVHSHGVIR-VEHYCTRLNAGGLNPKATFSIEQISPSV  79

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D+D G+G     KA   AI  A  TG+G V+++N  H G L+++   A    M+ I 
Sbjct  80   AILDSDDGMGHCALIKATDHAISLARETGLGFVSVKNTSHCGALSWFIEQATSQGMVAIA  139

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M      +  P  G+E   GT+PIA+G P     P + D+AT+ +A  K++  +  G  +
Sbjct  140  MTRTDTCV-APYGGAERFLGTNPIAFGFPVKDSHPMIVDMATSAIAFGKILHAKETGKPI  198

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
              G   D EG+   DP    N     +LPF      GGHKG G A  +D ++G+L G
Sbjct  199  GHGLALDKEGHITTDPHKIEN-----LLPF------GGHKGSGIALAIDALTGVLMG  244


>gi|23100301|ref|NP_693768.1|  malate dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22778533|dbj|BAC14802.1|  malate dehydrogenase [Oceanobacillus iheyensis HTE831]
Length=356

 Score =  118 bits (295),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 74/239 (30%), Positives = 126/239 (52%), Gaps = 13/239 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K  + +E+A +  + L+ +DLRG  SHGV   +  Y+   +   +  + ++  ++++  +
Sbjct  20   KQSLPDEEAEVIAETLVDADLRGVTSHGVQR-VAGYLKRMEDGIIERKTDISVVQDSFAT  78

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  DA+ G G   G KAM++AI+KA   G   V + N  H G  ++Y  MA +   IGI 
Sbjct  79   ALLDANNGWGQVAGVKAMEMAIQKAGQYGTSFVGVSNSNHFGTASFYTRMAAEKGFIGIS  138

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPA-DKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
            M +A   + VP    E   G +PI+   PA + + P + D++T+ VA  K+M+ ++    
Sbjct  139  MTNA-SPIMVPFGAKEPSLGPNPISISIPAGEGKKPIILDMSTSNVARGKIMVAKKNKES  197

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN  239
            +  GW    +G    D  ++  + GF +LP G        KG G A I+DI+SG+L+G+
Sbjct  198  IPEGWAITKDGKQTTDADEA--WEGF-VLPMGP-------KGSGLAIIIDILSGVLTGS  246


>gi|52079537|ref|YP_078328.1|  putative ureidoglycolate dehydrogenase [Bacillus licheniformis 
ATCC 14580]
 gi|52784902|ref|YP_090731.1|  YjmC [Bacillus licheniformis ATCC 14580]
 gi|52002748|gb|AAU22690.1|  putative ureidoglycolate dehydrogenase [Bacillus licheniformis 
ATCC 14580]
 gi|52347404|gb|AAU40038.1|  YjmC [Bacillus licheniformis DSM 13]
Length=349

 Score =  117 bits (293),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 86/284 (30%), Positives = 126/284 (44%), Gaps = 21/284 (7%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K G++E  A   +DVL  +D RG  SHG    +  Y        +   P     +  P S
Sbjct  18   KAGLNEGAAHDVSDVLTFADHRGIHSHGAVR-VEYYAERIAKGGITANPNYTFEQTGPAS  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A +  D G G Q   +AM+ AIE A+ +G+  V ++N  H G L Y+  MA + DM+ + 
Sbjct  77   AVFSGDNGPGHQAAKQAMEKAIEMAKNSGVAVVGMKNISHSGALGYFVEMAAEQDMVALS  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M  +   + VP  G+E  FGT+PIA+ AP+  +    FD+ATT  A  K++  R     +
Sbjct  137  MCQS-DPMVVPFGGTEPYFGTNPIAFSAPSADERMITFDMATTVQAWGKVLDARSKNESI  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
               W  D  G P  +  D        ++P  G       KGYG   +VD++SG L G   
Sbjct  196  PETWAVDAAGAPTTNARDV-----HALVPIAGP------KGYGLMMMVDVLSGSLLGVPH  244

Query  242  GF--------LAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
            G         L       Q  + I    F D   FK  +  +L+
Sbjct  245  GVHVSSMYQDLTKGRDLGQIHIVINPAYFTDLTAFKQQISTMLD  288


>gi|73541189|ref|YP_295709.1|  Malate/L-lactate dehydrogenase [Ralstonia eutropha JMP134]
 gi|72118602|gb|AAZ60865.1|  Malate/L-lactate dehydrogenase [Ralstonia eutropha JMP134]
Length=364

 Score =  117 bits (293),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 75/237 (31%), Positives = 120/237 (50%), Gaps = 7/237 (2%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G  E +A +  D L+ ++L G +SHGV  M+  YV  +QAD++    +V  + E+    +
Sbjct  23   GSDEREAALTADHLVGANLSGHDSHGVG-MIPKYVMSWQADQLQLNQQVSVVHESGGILS  81

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D + G+G  V  +AM+L IE+A+  G+  + ++   H+G + ++   A    MI I  V
Sbjct  82   LDGNRGMGQAVTEQAMRLGIERAQDHGVCVLGLRRSHHLGRVGHWAEQATAAGMISIHFV  141

Query  124  SAGGR-LQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            +   + +  P  G +  FGT+P   G P   QPP V D AT+ +A  K+ +    G  + 
Sbjct  142  NVLSKPIVAPHGGYDPRFGTNPFTIGVPVPGQPPLVLDFATSAIALGKVRVANNKGVPVP  201

Query  183  PGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            PG + D  G P  DP V  P  G     P G  R  G HKGY  A + +++   ++G
Sbjct  202  PGCLMDANGYPTADPGVMFPPPG----TPQGALRTFGEHKGYVLAVMCELLGAAVTG  254


>gi|75189842|ref|ZP_00703109.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli E24377A]
Length=361

 Score =  117 bits (293),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 111/238 (46%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      KT++E+  +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKTVKESGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHKHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGALLTFAEHKGYALAAMCEILGGALSG  252


>gi|62181592|ref|YP_218009.1|  putative malate/L-lactate dehydrogenase [Salmonella enterica 
subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|62129225|gb|AAX66928.1|  putative malate/L-lactate dehydrogenase [Salmonella enterica 
subsp. enterica serovar Choleraesuis str. SC-B67]
Length=335

 Score =  117 bits (293),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 116/237 (48%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            + G+  + A    DVL+ +D+ G  SHGV   + +Y     A  +NP+      + +P  
Sbjct  21   QAGLDAQTAQQVADVLVHADITGVHSHGVIR-VEHYCTRLNAGGLNPKATFSIEQISPSV  79

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D+D G+G     KA   AI  A  TG+G V+++N  H G L+++   A    M+ I 
Sbjct  80   AILDSDDGMGHCALIKATDHAISLARETGLGFVSVKNTSHCGALSWFIEQATIQGMVAIA  139

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M      +  P  G+E   GT+PIA+G P     P + D+AT+ +A  K++  +  G  +
Sbjct  140  MTQTDTCV-APYGGAERFLGTNPIAFGFPVKDSHPMIVDMATSAIAFGKILHAKETGKPI  198

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
              G   D EG+   DP    N     +LPF      GGHKG G A  +D ++G+L G
Sbjct  199  GHGLALDKEGHITTDPHKIEN-----LLPF------GGHKGSGIALAIDALTGVLMG  244


>gi|46255106|ref|YP_006018.1|  dehydrogenase [Thermus thermophilus HB27]
 gi|46197955|gb|AAS82365.1|  dehydrogenase [Thermus thermophilus HB27]
Length=344

 Score =  117 bits (292),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 83/239 (34%), Positives = 118/239 (49%), Gaps = 15/239 (6%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K G  E  A      L+ +DLRG  SHG+   L  YV   +A  +NP P +      PV 
Sbjct  18   KAGADEPSAKAVAWALVEADLRGVGSHGLLR-LPVYVRRLEAGLVNPSPTLPLEERGPV-  75

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D + G G +V  KA++ A   A   G+GAV ++   H GM   Y     Q   + + 
Sbjct  76   ALLDGEHGFGPRVALKAVEAAQSLARRHGLGAVGVRRSTHFGMAGLYAEKLAQAGFLALV  135

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              +A   + VP  G E   GT+P+A+ APA  Q   V D+AT++ A  K+ L R  G ++
Sbjct  136  TTNAEPDV-VPFGGREKALGTNPLAFAAPA-PQGILVADLATSESAMGKVFLAREKGERI  193

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
             P W  D EGNP  DP     +  + + P GG       KGY  A +V+++SG+L+G G
Sbjct  194  PPSWGVDREGNPTDDP-----HRVYALRPLGGP------KGYALALLVEVLSGVLTGAG  241


>gi|71083506|ref|YP_266225.1|  Malate/L-sulfolactate dehydrogenase multifunction enzyme [Candidatus 
Pelagibacter ubique HTCC1062]
 gi|71062619|gb|AAZ21622.1|  Malate/L-sulfolactate dehydrogenase multifunction enzyme [Candidatus 
Pelagibacter ubique HTCC1062]
Length=336

 Score =  117 bits (292),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 72/237 (30%), Positives = 121/237 (51%), Gaps = 11/237 (4%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K  ++++ A I  + LI ++L G  SHG+S  L+ Y        +NP+ ++K  + +   
Sbjct  16   KYKLNKDHATICAEALINAELVGAPSHGLSR-LKMYCDRISKKVINPKAKIKVKKISQSI  74

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D +  +G      A+K AI  A+ TGIG VA++N GH G+  YY   A++  ++ + 
Sbjct  75   AHVDGNNSIGFVAADTAIKTAISNAKKTGIGLVAVKNSGHYGLSGYYAEQAVKKGLMVMV  134

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              +A   +  P    +++FGT+PI +G P   + PF+ D + + +   K+ +  R G+++
Sbjct  135  FTNAPPAV-APHGALKSLFGTNPICFGTPTGSKVPFILDTSISMINRGKIRVAAREGTKI  193

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
              G   D  G P  DP  +        LP  G R      G G A +VDI+SG+L+G
Sbjct  194  PEGVALDKFGKPTTDPKKALEG---VQLPIAGFR------GSGLAWMVDILSGVLTG  241


>gi|73539123|ref|YP_299490.1|  Malate/L-lactate dehydrogenase [Ralstonia eutropha JMP134]
 gi|72122460|gb|AAZ64646.1|  Malate/L-lactate dehydrogenase [Ralstonia eutropha JMP134]
Length=352

 Score =  116 bits (291),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 82/244 (33%), Positives = 121/244 (49%), Gaps = 20/244 (8%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E  G++ E AV A   L+ S+LRG ++HG++  + +YV   +A   NPR  + + R    
Sbjct  19   ESCGVAPEHAVEAAAALVRSELRGYKTHGMTR-VPSYVDRLRAGDFNPRATM-SHRAFAG  76

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
                DAD  +G   GP A++L +E  E++    VA+Q+CGH+G L  + L+A +      
Sbjct  77   GIVLDADGAMGQVAGPHAVRLGLEALESSASVLVAVQSCGHLGALGIHALLAAEAG--AF  134

Query  121  CMVSAGGRLQVPVFGSE----TVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRR  176
            CMV   G+   PV G E       G +PIA+G P   Q P VFDVA +  A   ++L  R
Sbjct  135  CMV---GQRTPPVLGMEGFSGPAIGHNPIAFGCPLPGQAPIVFDVACSVAARGHILLAAR  191

Query  177  IGSQLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGIL  236
             G  +  GW  D +G P  D   +           G     GGHKG G A +V+ ++G L
Sbjct  192  EGKPIPEGWALDADGQPTTDAQRALA---------GSLLPTGGHKGIGIAMMVECLAGAL  242

Query  237  SGNG  240
            +   
Sbjct  243  AATA  246


>gi|91762076|ref|ZP_01264041.1|  Malate/L-sulfolactate dehydrogenase multifunction enzyme [Candidatus 
Pelagibacter ubique HTCC1002]
 gi|91717878|gb|EAS84528.1|  Malate/L-sulfolactate dehydrogenase multifunction enzyme [Candidatus 
Pelagibacter ubique HTCC1002]
Length=336

 Score =  116 bits (291),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 72/237 (30%), Positives = 121/237 (51%), Gaps = 11/237 (4%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K  ++++ A I  + LI ++L G  SHG+S  L+ Y        +NP+ ++K  + +   
Sbjct  16   KYKLNKDHATICAEALINAELVGAPSHGLSR-LKMYCDRISKKVINPKAKIKVKKISQSI  74

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D +  +G      A+K AI  A+ TGIG VA++N GH G+  YY   A++  ++ + 
Sbjct  75   AHVDGNNSIGFVAADTAIKTAINNAKKTGIGLVAVKNSGHYGLSGYYAEQAVKKGLMVMV  134

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              +A   +  P    +++FGT+PI +G P   + PF+ D + + +   K+ +  R G+++
Sbjct  135  FTNAPPAV-APHGALKSLFGTNPICFGTPTGSKVPFILDTSISMINRGKIRVAAREGTKI  193

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
              G   D  G P  DP  +        LP  G R      G G A +VDI+SG+L+G
Sbjct  194  PEGVALDKFGKPTTDPKKALEG---VQLPIAGFR------GSGLAWMVDILSGVLTG  241


>gi|91978052|ref|YP_570711.1|  Malate/L-lactate dehydrogenase [Rhodopseudomonas palustris BisB5]
 gi|91684508|gb|ABE40810.1|  Malate/L-lactate dehydrogenase [Rhodopseudomonas palustris BisB5]
Length=366

 Score =  116 bits (291),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 83/248 (33%), Positives = 122/248 (49%), Gaps = 11/248 (4%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            E+ G S+ +A      L T++L G +SHGV   +  Y+    A  ++P   V    + P 
Sbjct  23   ERAGSSKAEARRIGSYLTTANLTGHDSHGVIR-VPVYIRWRNAGAVHPDQTVDVPVDLPS  81

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
             A  D   G G  VGP+A+++ IEK +  G+ AV ++N GH+G +  +  MA    ++ I
Sbjct  82   LAVVDGKFGYGQTVGPQAVRIGIEKCKAQGLSAVGLKNAGHIGRIGDWAEMAAAEGLVSI  141

Query  121  CMVSAGGRLQV-PVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGS  179
              V+A G + V P  G E    T P   G P    PP V D AT+ VA  K+++  R G 
Sbjct  142  HFVTAAGSILVAPYGGVERRLSTAPYCVGVPRPGAPPVVLDFATSIVAEGKVLVAARGGK  201

Query  180  QLEPGWITDLEGNPIMDPVDSPNYGGF-------YMLPFGGTRENGGHKGYGFATIVDIM  232
             L  G + + +G    DP  +  YG F       ++   G  R  G HKG G A I +++
Sbjct  202  ALPQGALINPDGTFSEDP--ATLYGAFEKDGPINHVNGAGAIRAFGEHKGSGLALICELL  259

Query  233  SGILSGNG  240
             G LSGNG
Sbjct  260  GGALSGNG  267


>gi|16128769|ref|NP_415322.1|  predicted dehydrogenase [Escherichia coli K12]
 gi|74311344|ref|YP_309763.1|  putative dehydrogenase [Shigella sonnei Ss046]
 gi|75194952|ref|ZP_00705022.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli HS]
 gi|75512804|ref|ZP_00735296.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli 53638]
 gi|83586104|ref|ZP_00924741.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli 101-1]
 gi|89107652|ref|AP_001432.1|  predicted dehydrogenase [Escherichia coli W3110]
 gi|2506851|sp|P30178|YBIC_ECOLI  Hypothetical oxidoreductase ybiC
 gi|1787020|gb|AAC73888.1|  predicted dehydrogenase [Escherichia coli K12]
 gi|4062362|dbj|BAA35467.1|  predicted dehydrogenase [Escherichia coli W3110]
 gi|73854821|gb|AAZ87528.1|  putative dehydrogenase [Shigella sonnei Ss046]
Length=361

 Score =  116 bits (291),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 110/238 (46%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      KT++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKTVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|75230644|ref|ZP_00717115.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli B7A]
Length=361

 Score =  116 bits (291),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 111/238 (46%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      KT++E+  +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKTVKESGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHKHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPSCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGALLTFAEHKGYALAAMCEILGGALSG  252


>gi|20093830|ref|NP_613677.1|  L-sulfolactate dehydrogenase [Methanopyrus kandleri AV19]
 gi|19886753|gb|AAM01607.1|  L-sulfolactate dehydrogenase [Methanopyrus kandleri AV19]
Length=341

 Score =  116 bits (290),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 117/241 (48%), Gaps = 13/241 (5%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G+  +DA  A +V++  DLRG  SHGV   L  Y+   +   + P   ++ +       
Sbjct  19   VGVPRKDARTAAEVIVEGDLRGFHSHGVLR-LPGYIEGIKRGAIRPEMRIEEISRKSSVV  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             +DAD  LG  VG +A   A+E A   G+G VA++N  H G+  YY  +  +   IG   
Sbjct  78   LYDADHSLGHVVGYRATLEAVELARKHGLGMVAVRNASHYGIAGYYTTLVAERGFIG--F  135

Query  123  VSAGGRLQV-PVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             + G    V P  GS+ V GT+P++   P    PP V D+AT+ VA  K++   R   ++
Sbjct  136  TTCGTEPAVAPYGGSQPVLGTNPVSIAFPRRDGPPIVVDMATSVVARGKILQALRENREI  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
               W    +G P  DP ++       +LPF      GGHKGY     +++++G + G   
Sbjct  196  PQDWAVGPDGEPTTDPEEALEGA---LLPF------GGHKGYALCLALEVLAGPVVGAAA  246

Query  242  G  242
            G
Sbjct  247  G  247


>gi|111612553|ref|ZP_01399639.1|  Malate/L-lactate dehydrogenases-like [Verminephrobacter eiseniae 
EF01-2]
 gi|110830256|gb|EAT74564.1|  Malate/L-lactate dehydrogenases-like [Verminephrobacter eiseniae 
EF01-2]
Length=585

 Score =  115 bits (289),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 79/227 (34%), Positives = 117/227 (51%), Gaps = 20/227 (8%)

Query  8    EDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDAD  67
            EDA+ A  +L+ S+LRG  +HG++  L +YV    A   NP   ++  RE P     DAD
Sbjct  267  EDALQAAQLLVRSELRGYATHGMAR-LPSYVERLLAQDFNPSARLRQ-REFPGGVVLDAD  324

Query  68   TGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGG  127
              +G   G +A++LA++  E +    VAIQ+CGH+G L  Y L+A +     +C+V   G
Sbjct  325  GAMGQIAGARAVRLALQGLERSASVLVAIQSCGHMGALGVYALLAAEAG--AMCLV---G  379

Query  128  RLQVPVFGSE----TVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
            +   P+   E       G +PIA+G PA    P VFD+A +  A   +++  R G  +  
Sbjct  380  QRTPPLLAMEGFTGAAIGHNPIAFGCPAPGGSPIVFDIACSVAARGHVLVAEREGRDIPA  439

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVD  230
            GW  D +G P  DP  +   G   +LP       GGHKG G A +V+
Sbjct  440  GWALDSQGCPTTDP-QAALAGA--LLPM------GGHKGIGIAMVVE  477


>gi|47571511|ref|ZP_00241563.1|  COG2055: Malate/L-lactate dehydrogenases [Rubrivivax gelatinosus 
PM1]
Length=348

 Score =  115 bits (288),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 88/274 (32%), Positives = 128/274 (46%), Gaps = 24/274 (8%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            + +G+S E A    +V++ +DLRG ESHGV    R YV       +NP+P+++ +     
Sbjct  8    QAVGVSPEHADQIAEVVVFADLRGVESHGVQFTPR-YVRGIARGHLNPKPDIRVVHRRGA  66

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
             A  DAD GLG     +AMK A+  A   G G+VA++N  H G  A+YP+MAL+  MIG 
Sbjct  67   VAVVDADNGLGFLSARRAMKEAMAIAAEHGSGSVAVRNSNHFGPAAFYPMMALEAGMIG-  125

Query  121  CMVSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGS  179
               +  G     V+GS   V    P+ W  P  +  P V D A T V   K+ L  + G 
Sbjct  126  -YATTDGPPHTVVWGSRRPVLSNDPVGWAFPTLEGLPIVVDTAFTGV-KEKIRLAAQRGG  183

Query  180  QLEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN  239
             +   W    +GNP  DP  +      Y+LP       G HKG       +++ G L+G 
Sbjct  184  TIPADWAVGPDGNPTTDPKVALEG---YLLPI------GQHKGSALIIANEVVCGALAGA  234

Query  240  ------GPGFLAGDNKHSQFVMAIKIDLFLDAVD  267
                   P  + G + H  +    K   F+ A+D
Sbjct  235  LFSFEVSPKLVMGADHHDSW----KCGHFVQALD  264


>gi|5051810|emb|CAB45039.1|  putative carboxylic acid dehydrogenase [Amycolatopsis orientalis]
Length=337

 Score =  115 bits (287),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 89/279 (31%), Positives = 130/279 (46%), Gaps = 18/279 (6%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G S  DA      L+ SDL G +SHGV  ++ +YV       ++PR E K     P +  
Sbjct  20   GSSTVDAETVARSLVGSDLLGHDSHGVRRVI-DYVKRIHTGLIDPRAEPKAETTRPGTVV  78

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
                   G     +A++  +      G G   ++ C H+G L  Y  M    D+IG+   
Sbjct  79   VHGRRAFGQLAVRRAVRELLSLVPHQGSGVAVVRECNHIGRLGEYVAMLADQDLIGLAFG  138

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAP-ADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            +A   +  P  G E   GT+P+AW  P    QPP V D AT+ +A  KL + R  G Q+ 
Sbjct  139  NADPTV-APYGGRERRLGTNPLAWAVPRGPGQPPIVMDWATSGIAEGKLRVARDRGEQVA  197

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG--  240
             G + D  G P   P D   Y G  +LPF      GGHKGYG + +++I+ G+LSG G  
Sbjct  198  EGLVLDAAGRPSTTPADF--YQGGALLPF------GGHKGYGLSVLIEIVGGLLSGIGIG  249

Query  241  --PGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
              PGF  G       ++A  I  FL   +F++  ++  +
Sbjct  250  SMPGFREG---WGTVLVAFDIAAFLPVPEFRAQTERFCQ  285


>gi|16759503|ref|NP_455120.1|  ureidoglycolate dehydrogenase [Salmonella enterica subsp. enterica 
serovar Typhi str. CT18]
 gi|29142725|ref|NP_806067.1|  ureidoglycolate dehydrogenase [Salmonella enterica subsp. enterica 
serovar Typhi Ty2]
 gi|25325329|pir||AB0568  ureidoglycolate dehydrogenase (EC 1.1.1.154) [imported] - Salmonella 
enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501795|emb|CAD05012.1|  ureidoglycolate dehydrogenase [Salmonella enterica subsp. enterica 
serovar Typhi]
 gi|29138356|gb|AAO69927.1|  ureidoglycolate dehydrogenase [Salmonella enterica subsp. enterica 
serovar Typhi Ty2]
Length=349

 Score =  114 bits (286),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 74/237 (31%), Positives = 109/237 (45%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K G+  E A I  DVL+ +D RG  SHG    +  Y         N  P  +     P +
Sbjct  18   KAGLKREHAAIVADVLVYADARGIHSHGAVR-VEYYAERISKGGTNREPTFRIENTGPCT  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A   AD   G       M+ AIE A+  G+  V I   GH G ++Y+   A +  +IG+ 
Sbjct  77   AILHADNAAGQVAAKMGMEHAIEIAKKNGVAVVGISRMGHSGAISYFVRQAAREGLIGLS  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            +  +   + VP  G++  +GT+P+A+ AP++      FD+ATT  A  K++  R     +
Sbjct  137  ICQSD-PMVVPFGGADIYYGTNPLAFAAPSEGDDIITFDMATTVQAWGKVLDARSRNESI  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
               W  D  G P  DP     +    +LP  G       KGYG   ++DI+SGIL G
Sbjct  196  PESWAVDKNGAPTHDP-----FAVNALLPAAGP------KGYGLMMMIDILSGILLG  241


>gi|91209835|ref|YP_539821.1|  hypothetical oxidoreductase YbiC [Escherichia coli UTI89]
 gi|91071409|gb|ABE06290.1|  hypothetical oxidoreductase YbiC [Escherichia coli UTI89]
Length=361

 Score =  114 bits (286),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKVVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKARQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|117622983|ref|YP_851896.1|  hypothetical oxidoreductase [Escherichia coli APEC O1]
 gi|115512107|gb|ABJ00182.1|  hypothetical oxidoreductase [Escherichia coli APEC O1]
Length=361

 Score =  114 bits (286),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKVVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKARQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|110641005|ref|YP_668733.1|  putative malate/L-lactate dehydrogenase [Escherichia coli 536]
 gi|110342597|gb|ABG68834.1|  putative malate/L-lactate dehydrogenase [Escherichia coli 536]
Length=361

 Score =  114 bits (286),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKVVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|26246775|ref|NP_752815.1|  Hypothetical oxidoreductase ybiC [Escherichia coli CFT073]
 gi|26107174|gb|AAN79358.1|AE016757_262  Hypothetical oxidoreductase ybiC [Escherichia coli CFT073]
Length=361

 Score =  114 bits (286),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKVVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKARQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|75236141|ref|ZP_00720265.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli E110019]
Length=361

 Score =  114 bits (286),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKIVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGALLTFAEHKGYALAAMCEILGGALSG  252


>gi|75178409|ref|ZP_00698463.1|  COG2055: Malate/L-lactate dehydrogenases [Shigella boydii BS512]
 gi|75210605|ref|ZP_00710753.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli B171]
 gi|75257601|ref|ZP_00729098.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli E22]
 gi|82543246|ref|YP_407193.1|  putative dehydrogenase [Shigella boydii Sb227]
 gi|81244657|gb|ABB65365.1|  putative dehydrogenase [Shigella boydii Sb227]
Length=361

 Score =  114 bits (285),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKIVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|75189580|ref|ZP_00702847.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli E24377A]
 gi|75238992|ref|ZP_00722974.1|  COG2055: Malate/L-lactate dehydrogenases [Escherichia coli E110019]
Length=349

 Score =  114 bits (285),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 108/237 (45%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            + G+  E A    +VL+ +D RG  SHG    +  Y         N  PE +     P S
Sbjct  18   QAGLKREHAATVAEVLVYADARGIHSHGAVR-VEYYAERISKGGTNREPEFRLEETGPCS  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A   AD   G       M+ AI+ A+  G+  V I   GH G ++Y+   A +  +IGI 
Sbjct  77   AILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGLIGIS  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M  +   + VP  G+E  +GT+P+A+ AP +      FD+ATT  A  K++  R     +
Sbjct  137  MCQSD-PMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSI  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
               W  D  G P  DP     +    +LP  G       KGYG   ++D++SG+L G
Sbjct  196  PDTWAVDKNGAPTTDP-----FAVHALLPAAGP------KGYGLMMMIDVLSGVLLG  241



----------------------------------------------------------------------------

Blastp vs Swissprot : 

Database: Non-redundant SwissProt sequences
           217,875 sequences; 82,042,039 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  ORF_KN17770 traduction [2-832 sens indirect]
Length=277


Sequences producing significant alignments:                       (Bits)  Value

gi|13878573|sp|Q9V0D5|MDH_PYRAB  Malate dehydrogenase               184    2e-46
gi|7387868|sp|O59028|MDH_PYRHO  Malate dehydrogenase                181    2e-45
gi|2497860|sp|Q58820|COMC_METJA  L-sulfolactate dehydrogenase ...   157    5e-38
gi|17367959|sp|O34736|YJMC_BACSU  Hypothetical oxidoreductase yjm   141    3e-33
gi|126908|sp|P16142|MDH_METFE  Malate/L-sulfolactate dehydroge...   132    2e-30
gi|17366164|sp|O27273|COMC_METTH  L-sulfolactate dehydrogenase ((   122    1e-27 
gi|2506851|sp|P30178|YBIC_ECOLI  Hypothetical oxidoreductase ybiC   116    7e-26
gi|17368294|sp|P58409|YBIC_ECO57  Hypothetical oxidoreductase ybi   114    4e-25
gi|17366364|sp|P58408|ALLD_ECO57  Ureidoglycolate dehydrogenase     114    4e-25
gi|2497861|sp|P77555|ALLD_ECOLI  Ureidoglycolate dehydrogenase      113    9e-25
gi|729928|sp|Q07251|LDH_RALEU  L-lactate dehydrogenase             99.4    1e-20
gi|17369019|sp|Q9I492|Y1252_PSEAE  Hypothetical oxidoreductase PA  94.7    3e-19
gi|2506852|sp|P37672|DLGD_ECOLI  2,3-diketo-L-gulonate reducta...  69.7    9e-12
gi|81724058|sp|Q83PQ6|DLGD_SHIFL  2,3-diketo-L-gulonate reduct...  69.7    1e-11
gi|81473775|sp|Q8FCD6|DLGD_ECOL6  2,3-diketo-L-gulonate reduct...  69.7    1e-11
gi|1176297|sp|P44995|DLGD_HAEIN  2,3-diketo-L-gulonate reducta...  69.3    1e-11
gi|81512557|sp|Q8Z2C5|DLGD_SALTI  2,3-diketo-L-gulonate reduct...  67.8    3e-11
gi|81361634|sp|Q5PLN6|DLGD_SALPA  2,3-diketo-L-gulonate reduct...  66.6    9e-11
gi|75408999|sp|Q93Q64|DLGD_KLEOX  2,3-diketo-L-gulonate reduct...  66.2    1e-10
gi|81521290|sp|Q8ZL83|DLGD_SALTY  2,3-diketo-L-gulonate reduct...  65.9    1e-10
gi|84028901|sp|Q65WJ9|DLGD_MANSM  2,3-diketo-L-gulonate reduct...  65.9    1e-10
gi|17368767|sp|Q9CLH5|DLGD_PASMU  2,3-diketo-L-gulonate reduct...  63.9    5e-10
gi|2495662|sp|Q46839|GLCA_ECOLI  Glycolate permease glcA           30.8    4.8  
gi|22096202|sp|Q97AH7|SYA_THEVO  Alanyl-tRNA synthetase (Alanine-  30.8    5.2  



     
>gi|13878573|sp|Q9V0D5|MDH_PYRAB  Malate dehydrogenase
Length=362

 Score =  184 bits (468),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 157/280 (56%), Gaps = 9/280 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G  EEDA I  D LI +DLRG ESHGV   L+ YV    +  +N  P +K +RE P  
Sbjct  29   KLGTPEEDAKIVADNLIMADLRGIESHGVQR-LKRYVDGILSGGINLHPRIKIIREGPSY  87

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D D G G  VG KAMKLAIEKA  TGIG VA++N  H G+  YY LMA +  MIGI 
Sbjct  88   ALLDGDEGFGQVVGYKAMKLAIEKARKTGIGIVAVRNSNHYGIAGYYALMAAEEGMIGIS  147

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M ++   L  P  G E + GT+PIA  AP  K  PF+ D+AT+ V   KL + RR G ++
Sbjct  148  MTNS-RPLVAPTGGVERILGTNPIALAAPT-KGKPFLLDMATSVVPIGKLEVYRRKGEEI  205

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN--  239
              GW  + +G  I   V+    GG  +   G     GGHKGYG + +VDI+SGILSG   
Sbjct  206  PEGWAINSKGE-ITRSVEEVFNGGSLLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTW  264

Query  240  GPGFLAGDNKHS---QFVMAIKIDLFLDAVDFKSDMDKLL  276
                   + K+S    F MAI I+ F    +FK  M +++
Sbjct  265  SKHVKNTNEKNSNVCHFFMAINIEHFTPLEEFKGRMSEMI  304


>gi|7387868|sp|O59028|MDH_PYRHO  Malate dehydrogenase
Length=360

 Score =  181 bits (460),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 157/281 (55%), Gaps = 9/281 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            K+G+ EEDA I  D L+ +DLRG ESHGV   L+ YV    +  +N  P+++ +RE P  
Sbjct  29   KLGVPEEDAKIVADNLVMADLRGVESHGVQR-LKRYVDGIISGGVNLHPKIRVIREGPSY  87

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A  D D GLG  VG ++MKLAI+KA+ TGIG V  +N  H G+  YY LMA +  MIGI 
Sbjct  88   ALIDGDEGLGQVVGYRSMKLAIKKAKDTGIGIVIARNSNHYGIAGYYALMAAEEGMIGIS  147

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M ++   L  P  G E + GT+PIA  AP  K  PF+ D+AT+ V   KL + RR G  +
Sbjct  148  MTNS-RPLVAPTGGIERILGTNPIALAAPT-KDKPFLLDMATSVVPIGKLEVYRRKGKDI  205

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
              GW  + EGN I   V+    GG  +   G     GGHKGYG + +VDI+SGILSG   
Sbjct  206  PEGWAINREGN-ITTKVEEVFNGGALLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTW  264

Query  242  GFLAGDNKHS-----QFVMAIKIDLFLDAVDFKSDMDKLLE  277
                 +          F M I I+ F+   +FK  + +++E
Sbjct  265  SKYVKNTSEKGSNVCHFFMVIDIEHFIPLEEFKEKISQMIE  305


>gi|2497860|sp|Q58820|COMC_METJA  L-sulfolactate dehydrogenase ((R)-sulfolactate dehydrogenase) 
((R)-2-hydroxyacid dehydrogenase)
Length=344

 Score =  157 bits (396),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 148/283 (52%), Gaps = 18/283 (6%)

Query  1    EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV  60
            +K G+ EEDA I  DV + +DL+G  SHG+      Y+   +   +NP+P++K ++E+P 
Sbjct  17   KKFGVPEEDAKITADVFVDADLKGFTSHGIGR-FPQYITALKLGNINPKPDIKIVKESPA  75

Query  61   SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI  120
            +A  D D GLG  VG KAM+LAI+KA+  G+G VA +N  H G+  YY  +A+  DMIGI
Sbjct  76   TAVIDGDLGLGQVVGKKAMELAIKKAKNVGVGVVATRNANHFGIAGYYSELAMNQDMIGI  135

Query  121  CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             + +    +  P  G E + GT+PIA     +K   F  D+AT  +A  K++   R   +
Sbjct  136  TITNTEPAM-APFGGKEKILGTNPIAIAFKGNKY-KFSLDMATASIARGKILEALRKKIK  193

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
            +  G   D +G P  DP  +       +LPFGG       KGYG A  ++++S I     
Sbjct  194  IPEGCAVDKDGKPTTDPAKALEG---CILPFGGP------KGYGLALAIEMLSAIGGAEV  244

Query  241  PGFLAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
               + G     +        +AI  + F+   +FK  +D+LL+
Sbjct  245  GTKVKGTANPEERCTKGDLFIAINPEFFMGKEEFKRKVDELLD  287


>gi|17367959|sp|O34736|YJMC_BACSU  Hypothetical oxidoreductase yjmC
Length=337

 Score =  141 bits (355),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 134/282 (47%), Gaps = 21/282 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G++E DA    DVL+ +DLR   SHGV +   +YV    A  +NP  +       PV+  
Sbjct  23   GLNERDAEKVADVLVHADLRNVHSHGVLHT-EHYVNRLLAGGINPGAQPVFKETGPVTGV  81

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
             D D G G      AM  AI+ A+  G+G V   N  H G L+Y+   A    +IG+ M 
Sbjct  82   LDGDDGFGHVNCDMAMDHAIDMAKKKGVGMVTAVNSSHCGALSYFVQKAADEKLIGMAMT  141

Query  124  SAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
                 + VP  G   + GT+PIA+G PA  + PF+ D+AT++VA  K++  R  G ++  
Sbjct  142  HTDS-IVVPFGGRTPILGTNPIAYGVPAKHKKPFILDMATSKVAFGKILQAREEGKEIPE  200

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN--GP  241
            GW  D  G  + DP    +   F           GG KGYG + +VD+ SG+L+G   GP
Sbjct  201  GWGVDENGEAVTDPDKVVSLSTF-----------GGPKGYGLSIVVDVFSGLLAGAAFGP  249

Query  242  GF------LAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                    L    K   +V AI    F D   F   MD +++
Sbjct  250  HIAKMYNGLDQKRKLGHYVCAINPSFFTDWDTFLEQMDAMID  291


>gi|126908|sp|P16142|MDH_METFE  Malate/L-sulfolactate dehydrogenase ((R)-2-hydroxyacid dehydrogenase)
Length=339

 Score =  132 bits (331),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 96/282 (34%), Positives = 146/282 (51%), Gaps = 19/282 (6%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            +G+SEE A I  DV++ +DL+G  SHG+      YV   +   +     ++  +ET   A
Sbjct  19   LGVSEEHAKITADVIVDADLKGFTSHGIGR-FPQYVEGIKLGTIKTSGNIEIEKETDSVA  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              + +  LG  V  K MKLAIEKA+ TG+G V I +  H G+  YY  MA+++DMIGI M
Sbjct  78   LINGNHLLGQVVAYKGMKLAIEKAKNTGVGIVGIHDSNHFGIAGYYSDMAMKNDMIGITM  137

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +    +  P+ G   V GT+PIA   P+++    V D++T  VA  KL+   R   ++ 
Sbjct  138  TNTEPAV-APLGGKIPVLGTNPIAISIPSNEYYVAV-DMSTAAVARGKLLEAARKNEKIP  195

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
             G   D  GNP  DP ++ N     +LPF      GGHKGY    +++I++G L     G
Sbjct  196  EGIAVDKNGNPTTDPNEALNGS---ILPF------GGHKGYALCFMIEILAGPLVKAEFG  246

Query  243  F-LAGDNKHSQ------FVMAIKIDLFLDAVDFKSDMDKLLE  277
              + G    SQ       ++AI    F D  +FK ++D+ ++
Sbjct  247  SKVKGTVDPSQMCTKGDLLIAIDPSKFYDIEEFKRNVDEFVK  288


>gi|17366164|sp|O27273|COMC_METTH  L-sulfolactate dehydrogenase ((R)-sulfolactate dehydrogenase)
Length=341

 Score =  122 bits (306),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 86/282 (30%), Positives = 141/282 (50%), Gaps = 19/282 (6%)

Query  3    MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA  62
            M + EE + I  DV + +DL+G  SHG+      YV   +   +    ++   RET  +A
Sbjct  19   MNVPEESSDIVADVTLDADLKGFSSHGIGR-FPQYVDGLRHGTIRADGDITIERETESTA  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
              + +   G  V  +AM+LAIEKA  TG+G V + +  H G+  YY  MA+ +DMIG+ +
Sbjct  78   LINGNHIFGHVVAYRAMELAIEKARNTGVGLVGVHDSNHFGVAGYYSDMAVMNDMIGVVI  137

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             +    +  P+ G + + GT+P+A G P+++    V D+AT+  A  KL+   R G  + 
Sbjct  138  ANTEPAV-APIGGRKPILGTNPVAIGIPSNRYYVSV-DMATSASARGKLLEAARKGESIP  195

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG  242
                 D EG P  DP  +       +LPF      GGHKGY  + +++I++G L G   G
Sbjct  196  ENVALDAEGKPTTDPEMALKGS---ILPF------GGHKGYALSFMIEILAGPLVGAAFG  246

Query  243  FLAGDNKHSQ-------FVMAIKIDLFLDAVDFKSDMDKLLE  277
                   + +        +MAI     +D  +F++ +D+ +E
Sbjct  247  TAVTGTANPEEMCTKGDLMMAIDPSKMVDPDEFRAQVDEFIE  288


>gi|2506851|sp|P30178|YBIC_ECOLI  Hypothetical oxidoreductase ybiC
Length=361

 Score =  116 bits (291),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 110/238 (46%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      KT++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKTVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|17368294|sp|P58409|YBIC_ECO57  Hypothetical oxidoreductase ybiC
Length=361

 Score =  114 bits (285),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +MG  E++A +  D LI ++L G +SHG+  M+ +YV  +    +      K ++E   +
Sbjct  22   QMGSEEQEAKLVADHLIAANLAGHDSHGIG-MIPSYVRSWSQGHLQINHHAKIVKEAGAA  80

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
             T D D   G     +AM L IEKA   GI AVA+ N  H+G + Y+         + I 
Sbjct  81   VTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIH  140

Query  122  MVSAGG-RLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ  180
             VS  G  +  P  G ++ FGT+P     P     P + D AT+ +A  K  +    G  
Sbjct  141  FVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDDFPLLLDYATSAIAFGKTRVAWHKGVP  200

Query  181  LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
            + PG + D+ G P  +P            P G       HKGY  A + +I+ G LSG
Sbjct  201  VPPGCLIDVNGVPTTNPAVMQES------PLGSLLTFAEHKGYALAAMCEILGGALSG  252


>gi|17366364|sp|P58408|ALLD_ECO57  Ureidoglycolate dehydrogenase
Length=349

 Score =  114 bits (285),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 108/237 (45%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            + G+  E A    +VL+ +D RG  SHG    +  Y         N  PE +     P S
Sbjct  18   QAGLKREHAATVAEVLVYADARGIHSHGAVR-VEYYAERISKGGTNREPEFRLEETGPCS  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A   AD   G       M+ AI+ A+  G+  V I   GH G ++Y+   A +  +IGI 
Sbjct  77   AILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGLIGIS  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M  +   + VP  G+E  +GT+P+A+ AP +      FD+ATT  A  K++  R     +
Sbjct  137  MCQSD-PMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSI  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
               W  D  G P  DP     +    +LP  G       KGYG   ++D++SG+L G
Sbjct  196  PDTWAVDKNGAPTTDP-----FAVHALLPAAGP------KGYGLMMMIDVLSGVLLG  241


>gi|2497861|sp|P77555|ALLD_ECOLI  Ureidoglycolate dehydrogenase
Length=349

 Score =  113 bits (282),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 107/237 (45%), Gaps = 13/237 (5%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            + G+  E A    +VL+ +D RG  SHG    +  Y         N  PE +     P S
Sbjct  18   QAGLKREHAATVAEVLVYADARGIHSHGAVR-VEYYAERISKGGTNREPEFRLEETGPCS  76

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
            A   AD   G       M+ AI+ A+  G+  V I   GH G ++Y+   A +   IGI 
Sbjct  77   AILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGIS  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
            M  +   + VP  G+E  +GT+P+A+ AP +      FD+ATT  A  K++  R     +
Sbjct  137  MCQSD-PMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSI  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSG  238
               W  D  G P  DP     +    +LP  G       KGYG   ++D++SG+L G
Sbjct  196  PDTWAVDKNGVPTTDP-----FAVHALLPAAGP------KGYGLMMMIDVLSGVLLG  241


>gi|729928|sp|Q07251|LDH_RALEU  L-lactate dehydrogenase
Length=349

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 108/237 (45%), Gaps = 13/237 (5%)

Query  10   AVIATDV---LITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDA  66
            A IA DV   L+ SD  G  SHG+S +L NY        +NP+   K + +      +D 
Sbjct  23   ADIADDVAEHLVESDRCGYISHGLS-ILPNYRTALDGHSVNPQGRAKCVLDQGTLMVFDG  81

Query  67   DTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAG  126
            D G G  VG   M+ AIE+    G   V ++   H+G + +Y  MA     + +   +  
Sbjct  82   DGGFGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMGHYGEMAAAAGFVLLSFTNVI  141

Query  127  GRLQV--PVFGSETVFGTHPIAWGAP-ADKQPPFVFDVATTQVAANKLMLTRRIGSQLEP  183
             R  V  P  G      T+P+ +  P  + +PP V D+AT+ +A NK  +    G     
Sbjct  142  NRAPVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIATSAIAINKARVLAEKGEPAPE  201

Query  184  GWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG  240
            G I   +GNP  D           +LPF      GGHKGY    + ++++G+LSG G
Sbjct  202  GSIIGADGNPTTDASTMFGEHPGALLPF------GGHKGYALGVVAELLAGVLSGGG  252


>gi|17369019|sp|Q9I492|Y1252_PSEAE  Hypothetical oxidoreductase PA1252
Length=334

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 107/238 (44%), Gaps = 11/238 (4%)

Query  2    KMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVS  61
            +   SE       D L+  +   C SHG+  +L   +A  +A +++   E +     P  
Sbjct  19   RHAFSEAHVQAVADTLVAGERDECASHGIWRLL-GCIATLKAGKVSADAEPELHDIAPGL  77

Query  62   ATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGIC  121
               DA  G         +   +EKA + GI A+A+  C H   L +  + AL    +   
Sbjct  78   LRVDAHGGFSQCAFRLGLPHLLEKARSQGIAAMAVNRCVHFSAL-WVEVEALTEAGLVAL  136

Query  122  MVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
              +       P  G + +FGT+PIA+G P    PPFVFD AT+ VA  ++ L  R G  +
Sbjct  137  ATTPSHAWVAPAGGRKPIFGTNPIAFGWPRPDGPPFVFDFATSAVARGEIQLHERAGKPI  196

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGN  239
              GW  D +G P  D   S    G  ML F      GGHKG   A +V++++G L G+
Sbjct  197  PLGWGVDEQGEPTTDA--SAALRG-AMLTF------GGHKGSALAAMVELLAGPLIGD  245


>gi|2506852|sp|P37672|DLGD_ECOLI  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 122/281 (43%), Gaps = 21/281 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+  E A    ++   +   G  SHGV+   R ++   +   + P  + K +        
Sbjct  20   GVDSETADACAEMFARTTESGVYSHGVNRFPR-FIQQLENGDIIPDAQPKRITSLGAIEQ  78

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
            WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC  
Sbjct  79   WDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWT  138

Query  124  SAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            ++   +  P +G+ E   GT+P+    P+   P  + D++ +  +   L + R  G QL 
Sbjct  139  NSIAVM--PPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGRQLP  194

Query  183  PGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GNG  240
                 D EGN   +P V   N     +LP       G  KG G + ++D+++ +LS G  
Sbjct  195  VDGGFDDEGNLTKEPGVIEKNR---RILPM------GYWKGSGMSIVLDMIATLLSDGAS  245

Query  241  PGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
               +  DN      SQ  +AI++D  +D     + + ++++
Sbjct  246  VAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMD  286


>gi|81724058|sp|Q83PQ6|DLGD_SHIFL  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 122/281 (43%), Gaps = 21/281 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+  E A    ++   +   G  SHGV+   R ++   +   + P  + K +        
Sbjct  20   GVDSETADACAEMFARTTESGVYSHGVNRFPR-FIQQLENGDIIPDAQPKRITSLGAIEQ  78

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
            WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC  
Sbjct  79   WDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWT  138

Query  124  SAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            ++   +  P +G+ E   GT+P+    P+   P  + D++ +  +   L + R  G QL 
Sbjct  139  NSIAVM--PPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGRQLP  194

Query  183  PGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GNG  240
                 D EGN   +P V   N     +LP       G  KG G + ++D+++ +LS G  
Sbjct  195  VDGGFDDEGNLTKEPGVIEKNR---RILPM------GYWKGSGMSIVLDMIATLLSDGAS  245

Query  241  PGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
               +  DN      SQ  +AI++D  +D     + + ++++
Sbjct  246  VAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMD  286


>gi|81473775|sp|Q8FCD6|DLGD_ECOL6  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 122/281 (43%), Gaps = 21/281 (7%)

Query  4    GMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSAT  63
            G+  E A    ++   +   G  SHGV+   R ++   +   + P  + K +        
Sbjct  20   GVDNETADACAEMFARTTESGVYSHGVNRFPR-FIQQLENGDIIPDAQPKRITSLGAIEQ  78

Query  64   WDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMV  123
            WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC  
Sbjct  79   WDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWT  138

Query  124  SAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
            ++   +  P +G+ E   GT+P+    P+   P  + D++ +  +   L + R  G QL 
Sbjct  139  NSIAVM--PPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGRQLP  194

Query  183  PGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GNG  240
                 D EGN   +P V   N     +LP       G  KG G + ++D+++ +LS G  
Sbjct  195  VDGGFDDEGNLTKEPGVIEKNR---RILPM------GYWKGSGMSIVLDMIATLLSDGAS  245

Query  241  PGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
               +  DN      SQ  +AI++D  +D     + + ++++
Sbjct  246  VAEVTEDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMD  286


>gi|1176297|sp|P44995|DLGD_HAEIN  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 123/281 (43%), Gaps = 27/281 (9%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATW  64
            ++EE A   TD    +   G  SHG++   R    + Q D +      K L    +   W
Sbjct  25   LAEECATAFTD----TTQAGAYSHGINRFPRFIQQLEQGDIVPNAIPTKVLSLGSIE-QW  79

Query  65   DADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVS  124
            DA   +G     K M  AIE A   G+G +A++N  H      Y   A +   IGIC  +
Sbjct  80   DAHQAIGNLTAKKMMDRAIELASQHGVGVIALRNANHWMRGGSYGWQAAEKGYIGICWTN  139

Query  125  AGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ--L  181
            A   +  P +G+ E   GT+P+    P    P  + D++ +  +   L + R  G Q  +
Sbjct  140  ALAVM--PPWGAKECRIGTNPLIIAVPT--TPITMVDMSCSMYSYGMLEVHRLAGRQTFV  195

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
            + G+  D EGN   DP  S       +LP       G  KG G + ++D+++ +LS    
Sbjct  196  DAGF--DDEGNLTRDP--SIVEKNRRLLPM------GFWKGSGLSIVLDMIATLLSNGES  245

Query  242  GFLAGDNKH-----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                 ++K+     SQ  +AI++D  +D       ++++++
Sbjct  246  TVAVTEDKNDEYCVSQVFIAIEVDRLIDGKSKDEKLNRIMD  286


>gi|81512557|sp|Q8Z2C5|DLGD_SALTI  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 73/282 (25%), Positives = 126/282 (44%), Gaps = 25/282 (8%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA--  62
            ++E+ A    ++   +   G  SHGV+   R    + Q D  +  P+ K  R T + A  
Sbjct  21   IAEDTADACAEMFARTTESGVYSHGVNRFPR---FIQQLDNGDIIPDAKPQRVTSLGAIE  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC 
Sbjct  78   QWDAQRAIGNLTAKKMMDRAIELASDHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICW  137

Query  123  VSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             ++   +  P +G+ E   GT+P+    P+   P  + D++ +  +   L + R  G +L
Sbjct  138  TNSIAVM--PPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGREL  193

Query  182  EPGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GN  239
                  D  G    +P V   N+    +LP       G  KG G + ++D+++ +LS G+
Sbjct  194  PVDGGFDDNGQLTKEPGVIEKNH---RILPM------GYWKGSGLSIVLDMIATLLSNGS  244

Query  240  GPGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                +  +N      SQ  +AI++D  +D     + + ++++
Sbjct  245  SVAEVTQENSDEYGVSQIFIAIEVDKLIDGATRDAKLQRIMD  286


>gi|81361634|sp|Q5PLN6|DLGD_SALPA  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 73/282 (25%), Positives = 125/282 (44%), Gaps = 25/282 (8%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA--  62
            ++E+ A    ++   +   G  SHGV+   R    + Q D  +  P+ K  R T + A  
Sbjct  21   IAEDTADACAEMFARTTESGVYSHGVNRFPR---FIQQLDNGDIIPDAKPQRVTSLGAIE  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC 
Sbjct  78   QWDAQRAIGNLTAKKMMDRAIELASDHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICW  137

Query  123  VSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             ++   +  P +G+ E   GT+P+    P+   P  + D++ +  +   L + R  G +L
Sbjct  138  TNSIAVM--PPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGREL  193

Query  182  EPGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GN  239
                  D  G    +P V   N     +LP       G  KG G + ++D+++ +LS G+
Sbjct  194  PVDGGFDDNGQLTKEPGVIEKNR---RILPM------GYWKGSGLSIVLDMIATLLSNGS  244

Query  240  GPGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                +  +N      SQ  +AI++D  +D     + + ++++
Sbjct  245  SVAEVTQENSDEYGVSQIFIAIEVDKLIDGATRDAKLQRIMD  286


>gi|75408999|sp|Q93Q64|DLGD_KLEOX  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 70/280 (25%), Positives = 120/280 (42%), Gaps = 21/280 (7%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA--  62
            ++ E A    ++   +   G  SHGV+   R    + Q D  +  PE +  R T + A  
Sbjct  21   VARETADACAEMFARTTESGVYSHGVNRFPR---FIQQLDNGDIIPEAQPQRVTTLGAIE  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC 
Sbjct  78   QWDAQRSIGNLTAKKMMDRAIELASDHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICW  137

Query  123  VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE  182
             ++   +  P    E   GT+P+    P+   P  + D++ +  +   L + R  G +L 
Sbjct  138  TNSIA-VMAPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGRELP  194

Query  183  PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GNGP  241
                 D +G    +P          +LP       G  KG G + ++D+++ +LS G+  
Sbjct  195  VDGGFDDDGRLTKEPGTIEK--NRRILPM------GYWKGSGLSIVLDMIATLLSNGSSV  246

Query  242  GFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
              +  +N      SQ  +AI++D  +D     + + ++++
Sbjct  247  AEVTQENSDEYGVSQIFIAIEVDKLIDGATRDAKLQRIMD  286


>gi|81521290|sp|Q8ZL83|DLGD_SALTY  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 73/282 (25%), Positives = 125/282 (44%), Gaps = 25/282 (8%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA--  62
            ++E+ A    ++   +   G  SHGV+   R    + Q D  +  P+ K  R T + A  
Sbjct  21   IAEDTADECAEMFARTTESGVYSHGVNRFPR---FIQQLDNGDIIPDAKPQRVTSLGAIE  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             WDA   +G     K M  AIE A   GIG VA++N  H      Y   A +   IGIC 
Sbjct  78   QWDAQRAIGNLTAKKMMDRAIELASDHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICW  137

Query  123  VSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             ++   +  P +G+ E   GT+P+    P+   P  + D++ +  +   L + R  G +L
Sbjct  138  TNSIAVM--PPWGAKECRIGTNPLIVAIPS--TPITMVDMSMSMFSYGMLEVNRLAGREL  193

Query  182  EPGWITDLEGNPIMDP-VDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILS-GN  239
                  D  G    +P V   N     +LP       G  KG G + ++D+++ +LS G+
Sbjct  194  PVDGGFDDNGQLTKEPGVIEKNR---RILPM------GYWKGSGLSIVLDMIATLLSNGS  244

Query  240  GPGFLAGDNKH----SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
                +  +N      SQ  +AI++D  +D     + + ++++
Sbjct  245  SVAEVTQENSDEYGVSQIFIAIEVDKLIDGATRDAKLQRIMD  286


>gi|84028901|sp|Q65WJ9|DLGD_MANSM  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 72/282 (25%), Positives = 124/282 (43%), Gaps = 29/282 (10%)

Query  5    MSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA--  62
            ++EE A +  D    +   G  SHGV+   R    + Q +  + +PE +  +   + A  
Sbjct  25   IAEECATVFAD----TTQAGAYSHGVNRFPR---FIQQLENGDIKPEAQPTKVLSLGAIE  77

Query  63   TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM  122
             WDA   +G     K M  A+E A   G+G VA++N  H      Y   A +   IGIC 
Sbjct  78   QWDAHQAIGNLTAKKMMDRAMELASQNGVGIVALRNANHWMRGGSYGWQAAEKGYIGICW  137

Query  123  VSAGGRLQVPVFGS-ETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQL  181
             +A   +  P +G+ E   GT+P+    P    P  + D++ +  +   L + R  G Q 
Sbjct  138  TNALAVM--PPWGAKECRIGTNPLIVAVPT--TPITMVDMSCSMYSYGMLEVHRLQGRQT  193

Query  182  EPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGP  241
                  D   NP  DP          ++P       G  KG G + ++D+++ +LS NG 
Sbjct  194  FVDAGFDDNNNPTRDPATVEK--NRRLMPM------GFWKGSGLSIVLDMIATLLS-NGE  244

Query  242  GFLA----GDNKH--SQFVMAIKIDLFLDAVDFKSDMDKLLE  277
               A     D+++  SQ  +AI++D  +D       ++++++
Sbjct  245  STAAVTEDKDDEYCVSQVFIAIEVDRLIDGKTKDEKLNRIMD  286


>gi|17368767|sp|Q9CLH5|DLGD_PASMU  2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase)
Length=332

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 68/261 (26%), Positives = 114/261 (43%), Gaps = 21/261 (8%)

Query  24   GCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSATWDADTGLGIQVGPKAMKLAI  83
            G  SHGV+   R +++  +   + P  E   +        WDA   +G     K M  A+
Sbjct  40   GVYSHGVNRFPR-FISQLEKGDIVPDAEPTKVLSLGAIEQWDAHQAIGNLTAKKMMDRAM  98

Query  84   EKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSAGGRLQVPVFGS-ETVFGT  142
            E A+  GIG VA++N  H      Y   A +   IGIC  ++   +  P +G+ E   GT
Sbjct  99   EIADQFGIGVVALKNANHWMRGGGYGWQAAEKGYIGICWTNSIAVM--PPWGAKECRIGT  156

Query  143  HPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLEPGWITDLEGNPIMDPVDSPN  202
            +P+    P    P  + D++ +  +   L + R  G Q       D EGN   DP     
Sbjct  157  NPLIIAVPT--TPITMVDMSCSMYSYGMLEVHRLAGRQTFVDAGFDDEGNLTRDPGTVEK  214

Query  203  YGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPGFL----AGDNKH--SQFVMA  256
                 +LP       G  KG G + ++D+++ +LS NG          D+++  SQ  +A
Sbjct  215  --NRRLLPM------GFWKGSGLSIVLDMIATLLS-NGLSVAEVTEEKDDEYCVSQIFIA  265

Query  257  IKIDLFLDAVDFKSDMDKLLE  277
            I++D  +D       ++K+++
Sbjct  266  IEVDRLIDGNTKDEKLNKIMD  286


>gi|2495662|sp|Q46839|GLCA_ECOLI  Glycolate permease glcA
Length=560

 Score = 30.8 bits (68),  Expect = 4.8, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 12/75 (16%)

Query  90   GIGA-VAIQNCGHVGMLAYYPLMALQHDMIGICMVS-----AGGRLQVPVFGSETVFGTH  143
            G GA VAI     VG L + PL A      G+C+++     A G L VP+  +  V G  
Sbjct  134  GFGAPVAITGALLVG-LGFKPLYA-----AGLCLIANTAPVAFGALGVPILVAGQVTGID  187

Query  144  PIAWGAPADKQPPFV  158
            P   GA A +Q PF+
Sbjct  188  PFHIGAMAGRQLPFL  202


>gi|22096202|sp|Q97AH7|SYA_THEVO  Alanyl-tRNA synthetase (Alanine--tRNA ligase) (AlaRS)
Length=876

 Score = 30.8 bits (68),  Expect = 5.2, Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 0/55 (0%)

Query  71   GIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICMVSA  125
            G+ + PK   + IE  +  G G   ++N   +G+L    + A+Q ++  I  V+ 
Sbjct  674  GVPLSPKVRVVEIEGVDAEGCGGTHLKNISSIGVLKIKKIEAIQENIYRITFVAG  728



ORF finding

Recherche ORF dans les 3 cadres de lectures, sur le sens direct, avec ATG comme codon d'initiation : 

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


-----------------------------------------------------------------------------
Recherche ORF dans les 3 cadres de lectures, sur le sens indirect, avec ATG comme codon d'initiation : 


No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 8 to base 832.
ATGGGTATGTCCGAGGAAGATGCCGTTATCGCTACGGACGTGTTGATCACAAGTGATCTC
CGAGGTTGTGAGAGTCATGGTGTCTCGAATATGTTGCGAAACTATGTCGCGATGTACCAA
GCGGATCGGATGAATCCGCGACCGGAAGTCAAAACACTGAGGGAAACGCCCGTTAGCGCA
ACATGGGATGCGGATACAGGTTTGGGCATACAGGTGGGTCCTAAAGCGATGAAGCTAGCG
ATAGAAAAAGCCGAAACCACGGGAATCGGAGCTGTAGCGATTCAAAACTGTGGTCATGTA
GGCATGCTTGCATATTACCCACTCATGGCCCTACAACACGATATGATTGGAATATGCATG
GTATCGGCCGGAGGCAGATTGCAGGTCCCTGTATTTGGCTCGGAAACCGTATTTGGTACC
CATCCCATCGCTTGGGGGGCTCCTGCGGATAAGCAACCTCCATTCGTGTTTGATGTCGCG
ACTACCCAGGTAGCTGCGAACAAGCTGATGTTGACACGTCGTATTGGGTCTCAACTTGAA
CCGGGATGGATTACAGATTTAGAAGGAAATCCCATAATGGATCCTGTCGATTCCCCCAAC
TATGGTGGTTTCTACATGTTGCCTTTTGGCGGGACAAGAGAAAATGGAGGTCACAAGGGA
TACGGATTTGCAACCATAGTCGACATTATGTCTGGAATTCTCTCAGGTAATGGTCCTGGA
TTTCTTGCTGGTGACAATAAACATTCTCAATTTGTTATGGCCATTAAGATTGACTTGTTT
TTGGATGCGGTCGATTTTAAATCGGATATGGACAAATTGTTAGAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA
TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM
VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE
PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG
FLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE

No ORFs were found in reading frame 3.



-------------------------------------------------------------------------
_________________________________________________________________________
Recherche ORF dans les 3 cadres de lectures, sur le sens direct, avec ATG,GTG,CTG,TTG comme codons d'initiation :

>ORF number 1 in reading frame 1 on the direct strand extends from base 325 to base 513.
TTGTTCGCAGCTACCTGGGTAGTCGCGACATCAAACACGAATGGAGGTTGCTTATCCGCA
GGAGCCCCCCAAGCGATGGGATGGGTACCAAATACGGTTTCCGAGCCAAATACAGGGACC
TGCAATCTGCCTCCGGCCGATACCATGCATATTCCAATCATATCGTGTTGTAGGGCCATG
AGTGGGTAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LFAATWVVATSNTNGGCLSAGAPQAMGWVPNTVSEPNTGTCNLPPADTMHIPIISCCRAM
SG*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 294 to base 497.
TTGAGACCCAATACGACGTGTCAACATCAGCTTGTTCGCAGCTACCTGGGTAGTCGCGAC
ATCAAACACGAATGGAGGTTGCTTATCCGCAGGAGCCCCCCAAGCGATGGGATGGGTACC
AAATACGGTTTCCGAGCCAAATACAGGGACCTGCAATCTGCCTCCGGCCGATACCATGCA
TATTCCAATCATATCGTGTTGTAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
LRPNTTCQHQLVRSYLGSRDIKHEWRLLIRRSPPSDGMGTKYGFRAKYRDLQSASGRYHA
YSNHIVL*

>ORF number 2 in reading frame 3 on the direct strand extends from base 615 to base 833.
CTGTATGCCCAAACCTGTATCCGCATCCCATGTTGCGCTAACGGGCGTTTCCCTCAGTGT
TTTGACTTCCGGTCGCGGATTCATCCGATCCGCTTGGTACATCGCGACATAGTTTCGCAA
CATATTCGAGACACCATGACTCTCACAACCTCGGAGATCACTTGTGATCAACACGTCCGT
AGCGATAACGGCATCTTCCTCGGACATACCCATCTTTTC

>Translation of ORF number 2 in reading frame 3 on the direct strand.
LYAQTCIRIPCCANGRFPQCFDFRSRIHPIRLVHRDIVSQHIRDTMTLTTSEITCDQHVR
SDNGIFLGHTHLF

--------------------------------------------------------------------------

Recherche ORF dans les 3 cadres de lectures, sur le sens indirect, avec ATG,GTG,CTG,TTG comme codons d'initiation :

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 8 to base 832.
ATGGGTATGTCCGAGGAAGATGCCGTTATCGCTACGGACGTGTTGATCACAAGTGATCTC
CGAGGTTGTGAGAGTCATGGTGTCTCGAATATGTTGCGAAACTATGTCGCGATGTACCAA
GCGGATCGGATGAATCCGCGACCGGAAGTCAAAACACTGAGGGAAACGCCCGTTAGCGCA
ACATGGGATGCGGATACAGGTTTGGGCATACAGGTGGGTCCTAAAGCGATGAAGCTAGCG
ATAGAAAAAGCCGAAACCACGGGAATCGGAGCTGTAGCGATTCAAAACTGTGGTCATGTA
GGCATGCTTGCATATTACCCACTCATGGCCCTACAACACGATATGATTGGAATATGCATG
GTATCGGCCGGAGGCAGATTGCAGGTCCCTGTATTTGGCTCGGAAACCGTATTTGGTACC
CATCCCATCGCTTGGGGGGCTCCTGCGGATAAGCAACCTCCATTCGTGTTTGATGTCGCG
ACTACCCAGGTAGCTGCGAACAAGCTGATGTTGACACGTCGTATTGGGTCTCAACTTGAA
CCGGGATGGATTACAGATTTAGAAGGAAATCCCATAATGGATCCTGTCGATTCCCCCAAC
TATGGTGGTTTCTACATGTTGCCTTTTGGCGGGACAAGAGAAAATGGAGGTCACAAGGGA
TACGGATTTGCAACCATAGTCGACATTATGTCTGGAATTCTCTCAGGTAATGGTCCTGGA
TTTCTTGCTGGTGACAATAAACATTCTCAATTTGTTATGGCCATTAAGATTGACTTGTTT
TTGGATGCGGTCGATTTTAAATCGGATATGGACAAATTGTTAGAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPVSA
TWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGICM
VSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQLE
PGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNGPG
FLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE

No ORFs were found in reading frame 3.


--------------------------------------------------------------------------------
_______________________________________________________________________________

Recherche ORF dans les 3 cadres de lectures, sur le sens direct, avec any condon comme codons d'initiation :

>ORF number 1 in reading frame 1 on the direct strand extends from base 298 to base 513.
GACCCAATACGACGTGTCAACATCAGCTTGTTCGCAGCTACCTGGGTAGTCGCGACATCA
AACACGAATGGAGGTTGCTTATCCGCAGGAGCCCCCCAAGCGATGGGATGGGTACCAAAT
ACGGTTTCCGAGCCAAATACAGGGACCTGCAATCTGCCTCCGGCCGATACCATGCATATT
CCAATCATATCGTGTTGTAGGGCCATGAGTGGGTAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
DPIRRVNISLFAATWVVATSNTNGGCLSAGAPQAMGWVPNTVSEPNTGTCNLPPADTMHI
PIISCCRAMSG*

>ORF number 2 in reading frame 1 on the direct strand extends from base 547 to base 726.
ATCGCTACAGCTCCGATTCCCGTGGTTTCGGCTTTTTCTATCGCTAGCTTCATCGCTTTA
GGACCCACCTGTATGCCCAAACCTGTATCCGCATCCCATGTTGCGCTAACGGGCGTTTCC
CTCAGTGTTTTGACTTCCGGTCGCGGATTCATCCGATCCGCTTGGTACATCGCGACATAG


>Translation of ORF number 2 in reading frame 1 on the direct strand.
IATAPIPVVSAFSIASFIALGPTCMPKPVSASHVALTGVSLSVLTSGRGFIRSAWYIAT*


No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 270 to base 497.
ATCTGTAATCCATCCCGGTTCAAGTTGAGACCCAATACGACGTGTCAACATCAGCTTGTT
CGCAGCTACCTGGGTAGTCGCGACATCAAACACGAATGGAGGTTGCTTATCCGCAGGAGC
CCCCCAAGCGATGGGATGGGTACCAAATACGGTTTCCGAGCCAAATACAGGGACCTGCAA
TCTGCCTCCGGCCGATACCATGCATATTCCAATCATATCGTGTTGTAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
ICNPSRFKLRPNTTCQHQLVRSYLGSRDIKHEWRLLIRRSPPSDGMGTKYGFRAKYRDLQ
SASGRYHAYSNHIVL*

>ORF number 2 in reading frame 3 on the direct strand extends from base 594 to base 833.
CTTCATCGCTTTAGGACCCACCTGTATGCCCAAACCTGTATCCGCATCCCATGTTGCGCT
AACGGGCGTTTCCCTCAGTGTTTTGACTTCCGGTCGCGGATTCATCCGATCCGCTTGGTA
CATCGCGACATAGTTTCGCAACATATTCGAGACACCATGACTCTCACAACCTCGGAGATC
ACTTGTGATCAACACGTCCGTAGCGATAACGGCATCTTCCTCGGACATACCCATCTTTTC


>Translation of ORF number 2 in reading frame 3 on the direct strand.
LHRFRTHLYAQTCIRIPCCANGRFPQCFDFRSRIHPIRLVHRDIVSQHIRDTMTLTTSEI
TCDQHVRSDNGIFLGHTHLF

--------------------------------------------------------------------------------
Recherche ORF dans les 3 cadres de lectures, sur le sens indirect, avec any condon comme codons d'initiation :

>ORF number 1 in reading frame 1 on the reverse strand extends from base 232 to base 459.
AGCGATGAAGCTAGCGATAGAAAAAGCCGAAACCACGGGAATCGGAGCTGTAGCGATTCA
AAACTGTGGTCATGTAGGCATGCTTGCATATTACCCACTCATGGCCCTACAACACGATAT
GATTGGAATATGCATGGTATCGGCCGGAGGCAGATTGCAGGTCCCTGTATTTGGCTCGGA
AACCGTATTTGGTACCCATCCCATCGCTTGGGGGGCTCCTGCGGATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SDEASDRKSRNHGNRSCSDSKLWSCRHACILPTHGPTTRYDWNMHGIGRRQIAGPCIWLG
NRIWYPSHRLGGSCG*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 832.
GAAAAGATGGGTATGTCCGAGGAAGATGCCGTTATCGCTACGGACGTGTTGATCACAAGT
GATCTCCGAGGTTGTGAGAGTCATGGTGTCTCGAATATGTTGCGAAACTATGTCGCGATG
TACCAAGCGGATCGGATGAATCCGCGACCGGAAGTCAAAACACTGAGGGAAACGCCCGTT
AGCGCAACATGGGATGCGGATACAGGTTTGGGCATACAGGTGGGTCCTAAAGCGATGAAG
CTAGCGATAGAAAAAGCCGAAACCACGGGAATCGGAGCTGTAGCGATTCAAAACTGTGGT
CATGTAGGCATGCTTGCATATTACCCACTCATGGCCCTACAACACGATATGATTGGAATA
TGCATGGTATCGGCCGGAGGCAGATTGCAGGTCCCTGTATTTGGCTCGGAAACCGTATTT
GGTACCCATCCCATCGCTTGGGGGGCTCCTGCGGATAAGCAACCTCCATTCGTGTTTGAT
GTCGCGACTACCCAGGTAGCTGCGAACAAGCTGATGTTGACACGTCGTATTGGGTCTCAA
CTTGAACCGGGATGGATTACAGATTTAGAAGGAAATCCCATAATGGATCCTGTCGATTCC
CCCAACTATGGTGGTTTCTACATGTTGCCTTTTGGCGGGACAAGAGAAAATGGAGGTCAC
AAGGGATACGGATTTGCAACCATAGTCGACATTATGTCTGGAATTCTCTCAGGTAATGGT
CCTGGATTTCTTGCTGGTGACAATAAACATTCTCAATTTGTTATGGCCATTAAGATTGAC
TTGTTTTTGGATGCGGTCGATTTTAAATCGGATATGGACAAATTGTTAGAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
EKMGMSEEDAVIATDVLITSDLRGCESHGVSNMLRNYVAMYQADRMNPRPEVKTLRETPV
SATWDADTGLGIQVGPKAMKLAIEKAETTGIGAVAIQNCGHVGMLAYYPLMALQHDMIGI
CMVSAGGRLQVPVFGSETVFGTHPIAWGAPADKQPPFVFDVATTQVAANKLMLTRRIGSQ
LEPGWITDLEGNPIMDPVDSPNYGGFYMLPFGGTRENGGHKGYGFATIVDIMSGILSGNG
PGFLAGDNKHSQFVMAIKIDLFLDAVDFKSDMDKLLE

No ORFs were found in reading frame 3.