ORF JM16280

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01159989.1
Annotathon code: ORF_JM16280
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : princess
Annotated on : 2008-03-19 18:52:37
  • PRUDENT elsa
  • WARTEL morgane

Synopsis

Genomic Sequence

>AACY01159989.1 ORF_JM16280 genomic DNA
GCCCCGTATTCGCTAGAATGACAAAAAATGGCCCTGCAGTTCAAGTGGGCGACATGGATAAAGACGAAAAGCTTGAGTGGGCTGCTATAAAAGAAGGTCA
GTCGTTGTTTTCGATTGATCTTGAGATTGCTTGTGAGCTTCTCAATAAGCCGAGTGAAAACATACTTGGTTACCATCCTGAAACAAACGAACCAGTGATT
GTCAGAGAGGCAAGGTACGGTCCGACTGTTCAACTTGGGTCGAAGGAAGGCGGCAATAAACCAAGGTATGTTGGCTTACTGAAAACAGATTCTATTGAAG
AAATCACATTTGAAAGGGCTTTAGATTATTTAAGCTTGCCAAAAGAGTTGGGGCTTGATCCTGAATCAGGGGAAAAGGTTCTTGTGACTATCGGTCCTTA
TGGTCCGTATTTCAAACGTGGTTCAAAAAACTTTAGGGGGCGAAAAGGGCTTGATCCTTTTTCAGTTGAGCTTGAGGAAGCTCTTTTAAGCATATCAAGC
TCTAAAGGTTCTGGCGCTCTTAAAACCTTTGATGACAGCTCCGTTAAAATTGTTGATGGAAGATGGGGTGCCTATGTCACAGACGGTAAAAAGAATGCCT
CGGTACCCAAAGACAAAGACCCGGAGAGCCTAGAACTTCAAGATTGTCTGGAACTACTAGAAAAGGCTCCTGCCAAAAAAAGAGGTAAGAGAAAATCAAA
GAAAGCAGCCAAGTAGTTAAGATACTTGGGTCAGGAGGTATAATTGCATACCCAACCGATACTGTTTATGGAATGGGTTGTGATCCAAAAAACAAAGAGG
CGGTTCAGAGGCTTCTTGAG

Translation

[3 - 713/820]   direct strand
>ORF_JM16280 Translation [3-713   direct strand]
PVFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPSENILGYHPETNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEE
ITFERALDYLSLPKELGLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEALLSISSSKGSGALKTFDDSSVKIVDGRWGAYVTDGKKNAS
VPKDKDPESLELQDCLELLEKAPAKKRGKRKSKKAAK

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

  +-----------------------------------------Terythraeu (cyanobactérie)
  !  
 13                                      +--Mtuberculo (Actinobacteria)
  !  +----------------------------------12  
  !  !                                   +--Rbalticapl (planctomycete)
  +-11  
     !     +--------------------------------Bbacillifo (Alphaproteobacteria)
     !     !  
     +-----9  +-----------------------------Mflagellat (Betaproteobacteria)
           !  !  
           !  !                          +--ORF_JM1628
           +--8  +----------------------14  
              !  !                       +--Tcrunogena (Gammaproteobacteria)
              !  !  
              !  !                 +--------Noceani    (Gammaproteobacteria)
              +-10     +-----------7  
                 !     !           !  +-----Nmobilis   (Gammaproteobacteria)
                 !     !           +--6  
                 !     !              !  +--Hhalophila (Gammaproteobacteria)
                 +-----4              +--5  
                       !                 +--Aehrlichei (Gammaproteobacteria)
                       !  
                       !           +--------Xfastidios (Gammaproteobacteria)
                       +-----------3  
                                   !  +-----Xcampestri (Gammaproteobacteria)
                                   +--1  
                                      !  +--Xoryzae    (Gammaproteobacteria)
                                      +--2  
                                         +--Xaxonopodi (Gammaproteobacteria)

Annotator commentaries

L'étude initiale de l'ORF montre une séquence dont il nous manque la partie initiale (la méthionine). Nous n'avons donc qu'une partie du gène. Le poids moléculaire est donc tronqué car la partie initiale de la protéine est manquante.

Cette séquence semble codante car on obtient de bon résultats blast contre la banque nr (la meilleure E.value est à 5e-34 et les E.value augmentent lentement) avec des Topoisomérases de divers organismes (protéobactérie, actinobactérie, plantomycete, cyanobactérie). Ceci peut s'expliquer car la topoisomérase est une enzyme nécessaire pour le mécanisme de la réplication. On peut donc supposer que cet ORF code pour une topoisomérase. La topoisomérase modifie la topologie de l’ADN en modifiant le degré d’enroulement. La topo I agit en monomère (sur un seul brin) dans le sens d’une relaxation de la chromatine sans besoin d’ATP. La topo II est dimérique et catalyse la coupure puis l’échange des structures double-brin au cours de divers processus (réplication, condensation, transcription), en générant des coupures double-brin transitoires et avec hydrolyse simultanée d’ATP.

On n'obtient aucun domaine protéique avec interpro. Cependant avec blast conserved domaine (NCBI) on observe 2 domaines de topoisomérase. N°accession COG1754.

D'après l'arbre phylogénétique, les orthologues les plus récents sont des séquences de protéobactéries. La séquence orthologue la plus proche appartient à une gammaprotéobactérie(Thiomicrospira crunogena). Nous avons pris comme groupe extérieur une cyanobactérie (Trichodesmium erythraeum). Notre ORF est plus similaire aux séquences des gammaprotéobactéries, qu'aux séquences des alphaprotéobactéries et des betaprotéobactéries. Cependant l'ORF est relié au noeud extérieur des gammaprotéobactéries. L'ORF pourrait donc provenir de protéobactéries.

Pour trouver le symbole de gène, nous avons chercher dans les fiches swiss prot, et un symbole de gène revient quasiment tout le temps: topA. Nous supposons donc que le symbole de gène de notre ORF est topA.


Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Aehrlicheigamma                ---------------------------------MSKNLVIVESPAKAKTI
Hhalophilagamma                MAAAPRRGGRFYGPAPPSGRHPTSRPYIRERLFMGKSLVIVESPAKARTI
Nmobilisgamma                  ---------------------------------MAKNLVIVESPAKARTI
Noceanigamma                   ---------------------------------MSKNVVVVESPAKAKTI
Xaxonopodisgamma               ---------------------------------MPKHLLIVESPAKAKTI
Xcampestrisgamma               ---------------------------------MPKHLLIVESPAKAKTI
Xoryzaegamma                   ---------------------------------MPKHLLIVESPAKAKTI
Xfastidiosagamma               ---------------------------------MPKHLLIVESPAKAKTI
Mflagellatusbeta               ----------------------------------MSKLLIVESPSKAKTL
Rbalticaplanctomycete          -----MSDKPESRTSETPIFPPRIGSFLLMAKSTSKSLVIVESPAKARTI
Terythraeumcyanobacterie       ----------------------------------MSTLVIVESPTKARTI
Mtuberculosismycobacterie      ------------------MADPKTKGRGSGGNGSGRRLVIVESPTKARKL
Bbacilliformisalpha            -----------------------------------MDIVIVESPAKAKTI
Tcrunogenagamma                ----------------------------------MTNLVIVESPAKAKTI
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                NKYLGKDYKVLASYGHVRDLVP--------------KEGAVDPEHGFAMK
Hhalophilagamma                NKYLGSDYEVMASYGHVRDLVP--------------KEGAVDPSSGFAMK
Nmobilisgamma                  NKYLGTDFEVLASYGHVRDLVP--------------KEGAVDTECDFAMK
Noceanigamma                   KKYLGKNFEVLASYGHVRDLMP--------------KEGAVDPEHGFKMK
Xaxonopodisgamma               NKYLGKDFTVLASYGHVRDLVP--------------KEGAVDPDNGFAMR
Xcampestrisgamma               NKYLGKDFTVLASYGHVRDLVP--------------KEGAVDPDNGFAMR
Xoryzaegamma                   NKYLGKDFTVLASYGHVRDLVP--------------KEGAVDPDNSFAMR
Xfastidiosagamma               NKYLGKDFTVLASYGHVRDLVP--------------KEGAVDPENGFAMR
Mflagellatusbeta               KKYLGKDFEVLASYGHVRDLVP--------------KTGAVDPDHDFAMK
Rbalticaplanctomycete          SKFLGSGYQVEASVGHVRDLPGGAKDIPKKFKKEPWAYLGVNVEKDFEPV
Terythraeumcyanobacterie       RNYLPSDYRVEASMGHVRDLPPSAEEIPEKFKGEKWAQLGVNVESDFEPI
Mtuberculosismycobacterie      ASYLGSGYIVESSRGHIRDLPRAASDVPAKYKSQPWARLGVNVDADFEPL
Bbacilliformisalpha            NKYLGSQYKVIASFGHVRDLSAK--------------DGSVLPDKDFSMK
Tcrunogenagamma                EKYLGKGFTVRSSYGHIRDIQK--------------KGMGIDIENGFMPN
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                YTTIDKNAKHVDTIAKAMKQADALYLATDPDREGEAISWHLYELLKEKGA
Hhalophilagamma                YAPIDKNQKHVDAIAKAARKADALYLATDPDREGEAISWHLVELLRDKGT
Nmobilisgamma                  YTTIERNAKHVDAIAKAIRKIDTVYLATDPDREGEAISWHLSELLKERGV
Noceanigamma                   YQAIEKNGRHVNAIAKALKSADFLLLATDPDREGEAISWHLLELLKEEGV
Xaxonopodisgamma               YDLIEKNEKHVEAIARAAKGADDIFLATDPDREGEAISWHIAEILKERGL
Xcampestrisgamma               YDLIEKNEKHVEAIARAAKSADDIFLATDPDREGEAISWHIAEILKERGL
Xoryzaegamma                   YDLIEKNEKHVEAIARAAKGADDIFLATDPDREGEAISWHIAEILKERGL
Xfastidiosagamma               YDLIDKNEKHVEAITKAAKTADSIYLATDPDREGEAISWHISEILKERGL
Mflagellatusbeta               YEVIDRNARHVDAIAKAVKTADAIYLATDPDREGEAISWHIAEILKSKKL
Rbalticaplanctomycete          YIVPADKKKQVDKLKAALKDADSLYLATDEDREGEAISWHLFELLKPK--
Terythraeumcyanobacterie       YVVPKDKKKTVKELKDALKEVDELLLATDEDREGESISWHLLQLLKPK--
Mtuberculosismycobacterie      YIISPEKRSTVSELRGLLKDVDELYLATDGDREGEAIAWHLLETLKPR--
Bbacilliformisalpha            WDVDTASAKRLNEIAKAVKEANSLILATDPDREGEAISWHILDVLNQKKI
Tcrunogenagamma                YEISPDKKKTVTELRKLTKEAETVWLATDEDREGEAIAWHLAEALKLDVN
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                LKDKPVYRVVFHEITPRAIREAMEHPRELSTPLINAQQARRALDYLVGFN
Hhalophilagamma                LDDKPVYRVVFHEITKGAIQEAMNNPRDISEELVNAQQARRALDYLVGFN
Nmobilisgamma                  LEGKPIHRVVFYEITQRAIQAAMAHPRGLSTDLVNAQQARRALDYLVGFK
Noceanigamma                   LEDKAIQRVVFYEITSQAVNEAVAHPRDISLDLVNAQQARRALDYLVGFN
Xaxonopodisgamma               LKDKPMQRVVFTEITPRAIKEAMAKPRMIAGDLVDAQQARRALDYLVGFN
Xcampestrisgamma               LKDKPMQRVVFTEITPRAIKEAMAKPRMIAGDLVDAQQARRALDYLVGFN
Xoryzaegamma                   LKDKPMQRVVFTEITPRAIKEAMLKPRAIAADLVDAQQARRALDYLVGFN
Xfastidiosagamma               LKDKPMQRIVFTEITPRAIKEAIQKPRMIASDLVDAQQARRALDYLVGFN
Mflagellatusbeta               LKDKLIKRVVFHEITKNAVQNAIEEPRDISMPLVNAQQARRALDYLVGFN
Rbalticaplanctomycete          ---VPVHRLVFHEITKEAIQHALEDPREIDDGLVRAQETRRILDRLYGYD
Terythraeumcyanobacterie       ---VPTKRMVFHEITPEAIRRAIDNCRNIDEQLVRAQETRRILDRLYGYT
Mtuberculosismycobacterie      ---IPVKRMVFHEITEPAIRAAAEHPRDLDIDLVDAQETRRILDRLYGYE
Bbacilliformisalpha            LNDKPVKRVVFNAITKQSVLDAMNNPRDIDVSLVDAYLARRALDYLVGFT
Tcrunogenagamma                ----DTKRIVFHEITKTAIQKAIAEPRKVDMDLVEAQQARRILDRIVGFE
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                LSPLLWKKIATGLSAGRVQSPALRMIVEREEEIEKFISREYWTVEADLAR
Hhalophilagamma                LSPLLWRKITSGLSAGRVQSPALRMICERETEIEQFEPQEYWSVEADAAK
Nmobilisgamma                  LSPLLWKKITSGLSAGRVQSPALRLIVEREQEIEAFTPREYWTIEADLEQ
Noceanigamma                   LSPLLWKKIRRGLSAGRVQSPALRLICEREKEIDAFKVREYWTLEADAAA
Xaxonopodisgamma               LSPVLWRKVQRGLSAGRVQSPALRMIVEREEEIEAFIPREYWSIDAHCRH
Xcampestrisgamma               LSPVLWRKVQRGLSAGRVQSPALRMIVEREEEIEAFIPREYWSIDAHCRH
Xoryzaegamma                   LSPVLWRKVQRGLSAGRVQSPALRMIVEREEEIEAFIAREYWSIDAHCRH
Xfastidiosagamma               LSPVLWRKVQRGLSAGRVQSPALRMIVEREEEIEAFITREYWSIHAECTH
Mflagellatusbeta               LSPLLWKKIRRGLSAGRVQSPALRLIVERELEIEAFKSQEYWTIHLESAK
Rbalticaplanctomycete          VSQLLWKKVGRGLSAGRVQSVAVRLIVQRERERIAFHDATYWDLEAIFTT
Terythraeumcyanobacterie       LSPVLWKKIARGLSAGRVQSVAVRLLVNRERQRQAFKRGGYWDLKASLEQ
Mtuberculosismycobacterie      VSPVLWKKVAPKLSAGRVQSVATRIIVARERDRMAFRSAAYWDILAKLDA
Bbacilliformisalpha            LSPVLWRKLPGARSAGRVQSVALRIICDRESEREHFVKEDYWSITTYLKT
Tcrunogenagamma                LSPILWKKIRTGLSAGRVQSVAVRLIVEREREIDAFESDYVYRLQGALDI
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                NGE-------AFPGRLHTLDGQRVKQFDIDNGERAREVEHQLARAAGMAL
Hhalophilagamma                AQQ-------PFMAKLSQLHGEKVRQFTITDETHAQEVDRTLREAARAQP
Nmobilisgamma                  SQQ-------RFIARLSTLAGERVEQFSINTGTQATEVTVRLGQAADG--
Noceanigamma                   SKQ-------EFVAKLTHLDGKKLAQFDIESKDQALALVDRLTKAASG--
Xaxonopodisgamma               PSQ-------AFNARLIKLDGQKFEQFTVTDGDTAEAARLRIQQAAQG--
Xcampestrisgamma               PSQ-------AFNARLIKLDGQKFEQFTVTDGDTAEAARLRIQQAAQG--
Xoryzaegamma                   PSQ-------AFNARLIKLDGQKFEQFTVTDGDTAEAARLRIQQAAQG--
Xfastidiosagamma               PAQ-------HFSAKLIKLDGKKFEQFTITDSDTAAAAQRRIQQAAQG--
Mflagellatusbeta               HQH-------VFDAKLVQLEGKKVEQFTITNQAQQQEVVGKLLAVSAG--
Rbalticaplanctomycete          DNG------DSLPAMLATVDGRKIPTGKDFDSTNGQLIN-PELLQMDEQQ
Terythraeumcyanobacterie       EK-------TPFESKLVTLGGTKIATGNDFDENTGKIVEGRNVILLDEAH
Mtuberculosismycobacterie      SVSDPDAAPPTFSARLTAVAGRRVATGRDFDSLGTLRKG-DEVIVLDEGS
Bbacilliformisalpha            PRN------DVFQARLIEFNQKKLSKLDIQSQEQANQIRLMLEEAEYCT-
Tcrunogenagamma                LDE--------SQQVVGAVEVKRSAAFKTEEEAQAYLEQVKEAALTVS--
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                SKSHIDAGEGESPVQSPGTVQVTQVEKKQRRRNPAAPFTTSTLQQEAARK
Hhalophilagamma                DPARIGP-TGDGETEVIGTLRVASVERKQRRRNPAAPFITSTLQQEASRK
Nmobilisgamma                  ------------------CLRVAKVERKQRRRNPAAPFITSTLQQEASRK
Noceanigamma                   ------------------ELRVIKVERKQRRRNPAAPFITSTLQQEASRK
Xaxonopodisgamma               ------------------VLHVTDVASKERKRRPAPPFTTSTLQQEASRK
Xcampestrisgamma               ------------------VLHVTDVASKERKRRPAPPFTTSTLQQEASRK
Xoryzaegamma                   ------------------VLHVTDVASKERKRRPAPPFTTSTLQQEASRK
Xfastidiosagamma               ------------------RLHITDVTNKERKRRPAPPFITSTLQQEASRK
Mflagellatusbeta               ------------------KTTVSRVEKKQRSRSPAAPFTTSTLQQEAVRK
Rbalticaplanctomycete          AKELKQKLEKE-------NFRVAKVEVKPFTERPKAPFTTSTLQQEANRK
Terythraeumcyanobacterie       AEALKEQLQHK-------PWTVNSFDERAVRRKPSPPFTTSTLQQEANRK
Mtuberculosismycobacterie      ATALAAGLDGT-------QLTVASAEEKPYARRPYPPFMTSTLQQEASRK
Bbacilliformisalpha            ----------------------LSVEAKPTKRNPSPPFTTSTLQQASSSK
Tcrunogenagamma                -----------------------QLEEKPAKKSPKAPFTTSTLQQEASSK
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                LGFTANRTMRVAQQLYEGIDIG-GGVTGLITYMRTDSVNLSQEAVADLRD
Hhalophilagamma                LGFTASRTMRIAQQLYEGIDVGEGSAVGLITYMRTDSVNLSGEAITEMRQ
Nmobilisgamma                  LRFSTQKTMRVAQQLYEGIDTG-SGAIGLITYMRTDSVNLAQEAVANIQE
Noceanigamma                   LGFSTKRTMSVAQQLYEGVDIG-DGAIGLITYMRTDSVNLANEAVGEIRN
Xaxonopodisgamma               LGFTTRKTMQVAQKLYEGVALGDEGSVGLISYMRTDSVNLSQDALAEIRD
Xcampestrisgamma               LGFTTRKTMQVAQKLYEGVALGDEGSVGLISYMRTDSVNLSQDALAEIRD
Xoryzaegamma                   LGFTTRKTMQVAQKLYEGVALGDEGSVGLISYMRTDSVNLSQDALSEIRD
Xfastidiosagamma               LGFTTRKTMQIAQKLYEGIALGEEGSVGLITYMRTDSVNLSLDALSEIRD
Mflagellatusbeta               LGFTTSRTMRVAQQLYEGIDIG-SGTMGLITYMRTDSFSLATEAVMQIRD
Rbalticaplanctomycete          LGFTARRCMQAAQRLYE---------NGYITYMRTDSTTLSKEAINAARD
Terythraeumcyanobacterie       LRMGARQTMRTAQNLYE---------QGFITYMRTDSVHLSDEAIAAARS
Mtuberculosismycobacterie      LRFSAERTMSIAQRLYE---------NGYITYMRTDSTTLSESAINAART
Bbacilliformisalpha            LGFSASRTMQIAQKLYEGVEMN-GETAGLITYMRTDGVQIAPEAIDSARR
Tcrunogenagamma                LGFSVKQTMMIAQRLYE---------SGKITYMRTDSVNLSEEAIQKAHD
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                TIAKRYGEDRLPKAPQVYRTKSKNAQEAHEAIRPT-GAFRLPEEVRGKLS
Hhalophilagamma                AITDRYGADKLPGQAQVYKTRSKNAQEAHEAIRPT-SASRHPDDVRAYLN
Nmobilisgamma                  VIAERYGRDKLPERPHRYRTRAKNAQEAHEAIRPT-DAWRLPDELKAFLT
Noceanigamma                   FITERFGQSGLPAKPRTFKTRAKNAQEAHEAVRPT-SVYRVPEALKPHLK
Xaxonopodisgamma               VIARDFGTASLPDQPNAYTTKSKNAQEAHEAVRPT-SALRTPAQVARFLS
Xcampestrisgamma               VIARDFGTASLPDQPNAYTTKSKNAQEAHEAVRPT-SALRTPAQVARFLS
Xoryzaegamma                   VIARDYGTASLPDQPNAYTTKSKNAQEAHEAVRPT-SALRTPAQVARFLS
Xfastidiosagamma               IIARDYGTNALPDKPNVYTTKSKNAQEAHEAVRPT-SALRTPTQVAPYLS
Mflagellatusbeta               YIKQNFAAEYLPKSPIMYKTKAKNAQEAHEAIRPT-DISRTPASMRAFLT
Rbalticaplanctomycete          LVRSEYGEKFLHDSVRVYKGKVKNAQEAHEAIRPAGTPFRVPGAVQNE--
Terythraeumcyanobacterie       CVEKMYGPEYLSSEPRQYTTKSKGAQEAHEAIRPAGKTFRTPQETG----
Mtuberculosismycobacterie      QARQLYGDEYVAPAPRQYTRKVKNAQEAHEAIRPAGETFATPDAVRRELD
Bbacilliformisalpha            AISNSFGNNYLPEKPRFYSTKAKNAQEAHEAIRPT-DFKRHPDQVRNFLD
Tcrunogenagamma                EIVSEFGESYS--TTRRYKTKNADAQEAHEAIRPTDFSVKSVTGERNEQR
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                ---DDQFRLYELIWKRAVACQMIPALINTVAVDLACGEGN----------
Hhalophilagamma                ---EEQRKLYDLIWKRAVASQMKHATIHTVAVDLAADADAR--------H
Nmobilisgamma                  ---QDQYRLYELIWKRSVACQMIHATINTVAVDLACGSEG----------
Noceanigamma                   ---PEQFKLYQLIWRRTIACQMKHATIDTVAVDLNTQKLAPEGGNSASGH
Xaxonopodisgamma               ---EDERRLYELIWRRAVACQMIPATLNTVSVDLSAGSEH----------
Xcampestrisgamma               ---EDERRLYELIWRRAVACQMIPATLNTVSVDLSAGSEH----------
Xoryzaegamma                   ---DDERRLYELIWRRAVACQMIPATLNTVSVDLSAGSEH----------
Xfastidiosagamma               ---NEEHRLYELVWKRTVASQMIPAILNTTSVDLAAGNEH----------
Mflagellatusbeta               ---DEQFRLYEMIWKRALACQMTQAKFDAVSIDLAVGSDAN---------
Rbalticaplanctomycete          -LDRDQFRLFELIWKRTVACQMADAKKQRISVTIEGGG-----------T
Terythraeumcyanobacterie       -LKNQEFALYDLIWKRTVACQMADSRQTHITVNLQVED-----------A
Mtuberculosismycobacterie      GPNIDDFRLYELIWQRTVASQMADARGMTLSLRITGMSGHQE-------V
Bbacilliformisalpha            ---NDQAKLYELIWKRAIASQMRSAEIERTTVEIKAVQEEN-------YA
Tcrunogenagamma                --------LYQLIWRRAIASQMADAQLKRTNVDIALEGMP--------AE
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                SFRATGSTIAEPGFMAVYLEGTDDRK-PDVGSSERILPPLKEGDKVALER
Hhalophilagamma                LLRATGSTVADPGFMVVYREGNDEGK-DDSG--EKFLPELEEGEQVDLHA
Nmobilisgamma                  VFRATGSTIADPGFMAVYSEGTDDAN-AAEDN-ERTLPSMQVGDEIKLWE
Noceanigamma                   IFRATGSTVVDPGFMAVYQEGRDDIK-GEEEQ--RKLPPMKEGDRVTLLQ
Xaxonopodisgamma               VFRASGTTVVVPGFLAVYEEGKDTKS-SEDEDEGRKLPLMKAGDNVPLDR
Xcampestrisgamma               VFRASGTTVVVPGFLAVYEEGKDTKS-SEDEDEGRKLPLMKAGDNVPLDR
Xoryzaegamma                   VFRASGTTVVVPGFLAVYEEGKDTKS-SEDEDEGRKLPLMKAGDNIPLDR
Xfastidiosagamma               VFRATGTTVVVQGFLAVYEEGKDNKN-AEDDDEGRKLPVMKTGENVPLER
Mflagellatusbeta               LFRATGQTLIFPGFIAVYMEGVDDEE-EEGES---KLPHLETGEVLAVQK
Rbalticaplanctomycete          TFTASGTSILFEGFLRAYVEGSDDPE-AELADKERLLPAVNENDGLSVAT
Terythraeumcyanobacterie       GFRSNGKRIDFPGFLRAYVEGSDDPE-VSLENQEVPLPAIKQGDHPACTE
Mtuberculosismycobacterie      VFSATGRTLTFPGFLKAYVETVDELVGGEADDAERRLPHLTPGQRLDIVE
Bbacilliformisalpha            NLRATGSVTRFDGFIAVYTDQRDETN--GDEDDLARLPPINVNEILTKEK
Tcrunogenagamma                KLVAKGEVITFDGFLKVYNLDDDAKE--------GQLPPLKVGQALKLGE
ORF_JM16280                    -------------------------------------------------P
                                                                                 

Aehrlicheigamma                IKPEQHFTEPPPRYTEASLVRALEEYGIGRPSTYAAIISTLQQRKYVELD
Hhalophilagamma                IRAEQHFTEPPPRYTEASLVRALEEYGIGRPSTYASIISTLQNRNYVEMD
Nmobilisgamma                  IRPEQHFTEPPPRYSEASLVRALEERGIGRPSTYAAILSTLQQRNYVVLE
Noceanigamma                   IRPEQHFTEPPPRYTEASLVRALEEFGIGRPSTYATIISTLQQRDYAVLE
Xaxonopodisgamma               IVTDQHFTQPPPRFTEAALVKALEEYGIGRPSTYASIIQTLQFRKYVEME
Xcampestrisgamma               IVTDQHFTQPPPRFTEAALVKALEEYGIGRPSTYASIIQTLQFRKYVEME
Xoryzaegamma                   IVTDQHFTQPPPRFTEAALVKALEEYGIGRPSTYASIIQTLQFRKYVEME
Xfastidiosagamma               ILTEQHFTQPPPRYTEAALVKALEEYGIGRPSTYASIIQTLLFRKYVDME
Mflagellatusbeta               IYGDQHFTEPPPRYSEASLVKALEEYGIGRPSTYASIISTLQDREYVVLD
Rbalticaplanctomycete          LDPKSHTTQPPSRFSEASLTRTLEEKGIGRPSTYASIIDTIQRRDYVYKK
Terythraeumcyanobacterie       IEVVGHETQPPARFTEASLVKTLESEGIGRPSTYATVIGTIVDRGYAKLQ
Mtuberculosismycobacterie      LTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTIQDRGYVHKK
Bbacilliformisalpha            IETAQHTTDPPPRYSEASLIKKLEELGIGRPSTYASTLATLCDRGYIIID
Tcrunogenagamma                LLVRQSFSRPPARYNEASLVRTLEEMGIGRPSTYAPTIDTIQQRGYVVKE
ORF_JM16280                    VFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPS
                               :      . *. :  :    . **  .* . .:  .    :  .     .

Aehrlicheigamma                GK-------------------------------RFRPTDIGRVVNRFLTD
Hhalophilagamma                GK-------------------------------RFIPTDIGRTVNKFLTE
Nmobilisgamma                  NR-------------------------------RFRPTDTGRVVIKFLKE
Noceanigamma                   NK-------------------------------RFQPTDVGRVVNRFLTE
Xaxonopodisgamma               GR-------------------------------SFRPTDVGRAVSKFLSG
Xcampestrisgamma               GR-------------------------------SFRPTDVGRAVSKFLSG
Xoryzaegamma                   GR-------------------------------SFRPTDVGRAVSKFLSG
Xfastidiosagamma               GR-------------------------------SFRPTDIGRAVSKFLSS
Mflagellatusbeta               KK-------------------------------RFIPTDVGRVVNKFLTE
Rbalticaplanctomycete          GN-------------------------------ALVPSWTAFSVIRLMET
Terythraeumcyanobacterie       SN-------------------------------ALVPTFTAFAVTTLLEK
Mtuberculosismycobacterie      GS-------------------------------ALVPSWVAFAVTGLLEQ
Bbacilliformisalpha            KR-------------------------------QLTPDAKGRIVTAFLEN
Tcrunogenagamma                DREGRQRDYRQLSLTVDGIDASTLTETTGTEKNKLFPTDIAGIVTDFLVK
ORF_JM16280                    EN------------------------------------------------
                                                                                 

Aehrlicheigamma                HFDRYVDYDFTARLEDDLDAVSRGERDWVPLLEEFWQPFKDKVDEKA-TI
Hhalophilagamma                HFDRYVDYDFTARLEDDLDAISRGEQDWVPVLEAFWEPFRERVEEKK-NV
Nmobilisgamma                  HFDRYVDYDFTARMEDDLDAISRGERDWIPVLRAFWEPFKERIEDKS-KV
Noceanigamma                   HFNSYVDYDFTARLEDELDAVSRGEKVWIPVLEEFWGPFSARIQEKEQNV
Xaxonopodisgamma               HFTRYVDYDFTANLEDDLDAVSRGEAEWIPLMEKFWGPFKELVEDKKDSL
Xcampestrisgamma               HFTRYVDYDFTANLEDDLDAVSRGEAEWIPLMEKFWGPFKELVEDKKDSL
Xoryzaegamma                   HFTRYVDYDFTAKLEDDLDAVSRGEAEWIPLMEKFWGPFKELVEDKKDSL
Xfastidiosagamma               HFTQYVDYDFTAHLEDELDAISRGEEEWIPLMKKFWVPFKELVEDKKDSL
Mflagellatusbeta               HFTRYVDYGFTANLENELDDIAEGEREWIPVLNEFWQGFNNQIHEKSNVE
Rbalticaplanctomycete          HFEPLVDYDFTAQMEDFLDTISRQEAESLQYLKRFYFGDETEPTGDEKAA
Terythraeumcyanobacterie       HFPEFVDVKFTARMEQTLDDISMGEAQWVPYLKKFYFGESGLDTQIKEQE
Mtuberculosismycobacterie      HFGRLVDYDFTAAMEDELDEIAAGNERRTNWLNNFYFGGDHGVPDSVARS
Bbacilliformisalpha            FFNRYVEYGFTANLEEKLDLISDGKLFWKDVLRDFWDEFNASVTNIQELR
Tcrunogenagamma                HFGDVLDYKFTALVESEFDTIAQGKESWQEMLTKFYQQFHPRVDAAEDVS
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                SREEVMQ-------------------------------------------
Hhalophilagamma                SRQEAVQ-------------------------------------------
Nmobilisgamma                  SRGEVMQ-------------------------------------------
Noceanigamma                   SREEAVQ-------------------------------------------
Xaxonopodisgamma               DKTDAGS-------------------------------------------
Xcampestrisgamma               DKTDAGS-------------------------------------------
Xoryzaegamma                   DKTDAGS-------------------------------------------
Xfastidiosagamma               DKTDAGS-------------------------------------------
Mflagellatusbeta               RPGVEMLDEACPKCGKPLQSRLGRFGKFIGCSGYPECDYIR---------
Rbalticaplanctomycete          IGLKPRLESKIEEIDPRVTAKFSLGIPTEGENREEVFVRVGKYGPFLEQG
Terythraeumcyanobacterie       NQIDPKLARTIELDN--------LDANSEMTYRICIGKFGAYIEAENGEN
Mtuberculosismycobacterie      GGLKKLVGINLEGIDAREVNSIKLFDDTHGRPIYVRVGKNGPYLERLVAG
Bbacilliformisalpha            ITNVLDVLNTTLAPLAFPTREDSSDPRSCSLCKHGQLSLKLGRYGAFVGC
Tcrunogenagamma                REEAGQS-------------------------------------------
ORF_JM16280                    --------------------------------------------------
                                                                                 

Aehrlicheigamma                ------------------------------------SRDLGTDPKTGKPV
Hhalophilagamma                ------------------------------------ARELGTDPKTGKPV
Nmobilisgamma                  ------------------------------------ARELGVDPISGRPV
Noceanigamma                   ------------------------------------ARELGIDPQSSRPV
Xaxonopodisgamma               ------------------------------------VRVLGTDPVSGKEV
Xcampestrisgamma               ------------------------------------VRVLGTDPKSGKEV
Xoryzaegamma                   ------------------------------------VRVLGTDPVSGKEV
Xfastidiosagamma               ------------------------------------VRLLGIDPTSGKEV
Mflagellatusbeta               --------------------------NPNANANNNEPTVIGQEPESGKDI
Rbalticaplanctomycete          ER------KAPILEGMAPDEMTLARAMELFEDAAREDEPLGVHPETGKPI
Terythraeumcyanobacterie       IV------KASIPEDLTPSDLDPEQIEKLLKQKTEGPQELGIHPEEDKSI
Mtuberculosismycobacterie      DTGEPTPQRANLSDSITPDELTLQVAEELFATPQQG-RTLGLDPETGHEI
Bbacilliformisalpha            SN---------YPECKYTKQLGTDAGEEREAAHNDEPVILGVDPETGKDI
Tcrunogenagamma                -------------------------------------RALGNDPKTGKPM
ORF_JM16280                    --------------------------------------ILGYHPETNEPV
                                                                      :* .*  .. :

Aehrlicheigamma                SVRVGRFGPFVQLGT------------------KDDEEKPRFAGLRPGQS
Hhalophilagamma                TVRIGRYGPFAQLGS------------------RDDDEKPRFAGLRPGQS
Nmobilisgamma                  TARLGRYGPYAQIGS------------------ANDAEKPSFAGLVQGQS
Noceanigamma                   SVRMGRYGPYIQIGS------------------KEDEEKPRFAGLQPGQK
Xaxonopodisgamma               SARIGRFGPMVQIGT------------------VEDEDKPTFASLRPGQS
Xcampestrisgamma               SARIGRFGPMVQIGT------------------VEDEDKPTFASLRPGQS
Xoryzaegamma                   SARIGRFGPMVQIGS------------------VEDEDKPTFASLRPGQS
Xfastidiosagamma               SARIGRFGPMVQIGT------------------VDDEEKPRFASLRPNQS
Mflagellatusbeta               LLLNGPYGPYLQIGLP----------------EADSKKKPKRVSIPKEIP
Rbalticaplanctomycete          YIKAGRFGPYVQMG----------------EKDDEEK---KNASILKTIA
Terythraeumcyanobacterie       YIMTGRYGPYVQLG----------------DDSEGSKRKPKRASLPKGVN
Mtuberculosismycobacterie      VAREGRFGPYVTEILPEPAADAAAAAQGVKKRQKAAGPKPRTGSLLRSMD
Bbacilliformisalpha            FLRNGRFGPYIQLGE---------------------GKEAKRSGLPKGWK
Tcrunogenagamma                FVKIGRFGPYVQLGD------------------GENEEKPTFASLMPGQK
ORF_JM16280                    IVREARYGPTVQLGS------------------KEGGNKPRYVGLLKTDS
                                   . :**                                  .:     

Aehrlicheigamma                MDKITLEEALELFKLPRDMGETPEGEPMQVN----------------IGR
Hhalophilagamma                IDTITLDEALQLFKLPRDMGETDEGEDVQVS----------------IGR
Nmobilisgamma                  IDTITLEEALALFKLPRELGETPQGEKLVVG----------------IGR
Noceanigamma                   MDAITLEEALTLFKLPRELGFTPGGEQVSVN----------------VGR
Xaxonopodisgamma               IYSISLEDALELFKMPRALGQD-KDQDVSVG----------------IGR
Xcampestrisgamma               IYSISLEDALELFKMPRLLGQD-QDQDVSVG----------------IGR
Xoryzaegamma                   IYSISIEDALELFKMPRALGQD-KDQDVSVG----------------IGR
Xfastidiosagamma               IYSISLEEAIELFKMPRVLGED-QSQQVSVG----------------IGR
Mflagellatusbeta               VSSLDMETALKLIALPRDLGQHPETGKKVVAN---------------IGR
Rbalticaplanctomycete          VEDVDLEMACKLLSLPRDLGEHPEMKEPILAH---------------DGR
Terythraeumcyanobacterie       MEDVTLDLAVGLLSLPRTLGTHPETGCKIQAN---------------LGR
Mtuberculosismycobacterie      LQTVTLEDALRLLSLPRVVGVDPASGEEITAQ---------------NGR
Bbacilliformisalpha            TENVNLDKALSLLSLPREVGIHPETGQMITAT---------------IGR
Tcrunogenagamma                MDTLKLEEALELFKLPREVGQMPESFSAKAVDGTEFAVEKGQIIIAKQGP
ORF_JM16280                    IEEITFERALDYLSLPKELGLDPESGEKVLVT---------------IGP
                                  : :: *   : :*: :*                            * 

Aehrlicheigamma                FGPYVRFG------NKFVSIK-DDDPYTISRERCLELVEEKKR-------
Hhalophilagamma                FGPYVRYG------KKFVSIPKDEDPYTITKERAHELVREKKQ-------
Nmobilisgamma                  YGPYVRYG------SKFVSLKRDDDPYTITRERALERVAEKKE-------
Noceanigamma                   FGPYVKYD------NKYVSLR-GEDPHTISLERALALIEEKKQ-------
Xaxonopodisgamma               FGPFARRG------STYASLKKEDDPYTIDLARAIFLIEEKEE-------
Xcampestrisgamma               FGPFARRG------STYASLKKEDDPYTIDLARAVFLIEEKEE-------
Xoryzaegamma                   FGPFARRG------SVYASLKKEDDPYTIDLARAVFLIEEKEE-------
Xfastidiosagamma               FGPFAKRG------STYVSLKSEDDPYTIDLARATLLINEKEE-------
Mflagellatusbeta               FGPYVNHD------GKFKSIPKSESVFDIDLARAIELLAQANAG------
Rbalticaplanctomycete          YGPYVKCG------KETRSLPADKSPLDVTFDEAIELLKQPKTRGRAAPK
Terythraeumcyanobacterie       FGPYIVHDQGKEDGKDYRSLKVKDDVLTITLERALELLAQPKRSRRGSAK
Mtuberculosismycobacterie      YGPYLKRG------NDSRSLVTEDQIFTITLDEALKIYAEPKRRGRQS-A
Bbacilliformisalpha            YGPYLTHD------RKYAALSNVDDVFDIGINRAVTVLAEQKENKANRGK
Tcrunogenagamma                FGPYLEYG------PKMYAPIKGFDPLSIELEDAVALIESKIVT------
ORF_JM16280                    YGPYFKRG------SKNFRGRKGLDPFSVELEEALLSISSSKG-------
                               :**:   .                .   :    .     .          

Aehrlicheigamma                ---IERERTIRDFEGSDIRILKGRYGPYITNG--KKNARIPKDREPESLG
Hhalophilagamma                ---ADANRIIHDFGDG-IQILRGRYGPYITNG--EKNAKVPKDREPDSLT
Nmobilisgamma                  ---AEANRLIRRFDGAEIEILRGRFGPYITDG--KKNARIPKGREPDELD
Noceanigamma                   ---ADANRVIKVFPDSGIQVLNGRYGPYVTDG--ERNARVPKEQAPEALS
Xaxonopodisgamma               ---IARNRVIKEFDGSDIQVLNGRFGPYISDG--KLNGKIPKDREPASLT
Xcampestrisgamma               ---IARNRVIKEFDGSDIQVLNGRFGPYISDG--KLNGKIPKDREPASLT
Xoryzaegamma                   ---IARNRVIKDFEGSDIQVLNGRFGPYISDG--KLNGKIPRDREPASLT
Xfastidiosagamma               ---IARNRIIKDFENSQIQVLNGRFGPYISDG--KLNGKIPKDREPASLT
Mflagellatusbeta               -AAPIKELGNHPDGTGNIAIYAGRFGPYVQHG--KLRATLPKGQEPETLT
Rbalticaplanctomycete          EPIKKFEK-PSPVTENEIKILEGRFGPYATDG--ETNASIPRGTDPKEMT
Terythraeumcyanobacterie       AVLPLKDLGKHPEDGETVGVYDGRYGLYVKHG--KVNASLPKDMSVEDVT
Mtuberculosismycobacterie      SAPPLRELGTDPASGKPMVIKDGRFGPYVTDG--ETNASLRKGDDVASIT
Bbacilliformisalpha            TVSSVLAALGDHPDGGSITVRDGRYGSYVNWG--KINATLPKDKDPANIT
Tcrunogenagamma                ----EAEKIIKVFPGTDVKILKGRWGPYITDVTTKKNAKIKKDEDALDLS
ORF_JM16280                    ------SGALKTFDDSSVKIVDGRWGAYVTDG--KKNASVPKDKDPESLE
                                                : :  **:* *      : .. : :      : 

Aehrlicheigamma                LEECEELIAKAPERKGRRRTGGTGRK--RSTKA-----------------
Hhalophilagamma                HEECQDLIAKAPARKGRRGGAAKGGR--GRSKATS---------------
Nmobilisgamma                  LEECRQLLDKVPERKSGRRGGGHRRK--SG--------------------
Noceanigamma                   LEQAQALINEAPVKRARRKAGTRKKA--KG--------------------
Xaxonopodisgamma               FEEVQQLLADTGKPVRKGFGAKKATL--KKNTVKDSAPKKPAVKKTATKT
Xcampestrisgamma               FEEVQQLLADTGKPVRKGFGAKKATL--KKNTVKDSAPKKPAVKKTATKT
Xoryzaegamma                   FEEVQQLLADTGKPVRKGFGAKKATL--KKNAVKDSAPKKPAAKKTATKT
Xfastidiosagamma               LEEAQQLLINTGKPARKNFSTKKTAT--KNETRKQTTKKRTTDAKATKKV
Mflagellatusbeta               MEQALELLSAKAAKDAPAKKAKTTTA--KKTSSTKKAATTTRRKKASAGE
Rbalticaplanctomycete          FESVLDLLAERAAKGPTKKKKKKKAV--KKKTAKKAAKKKTAKKKAAKKK
Terythraeumcyanobacterie       WEKALELLHAKASSKKSARGRKSTKS--KAENN-----------------
Mtuberculosismycobacterie      DERAAELLADRRARGPAKRPARKAAR--KVPAKKAAKRD-----------
Bbacilliformisalpha            LSEALELLSAKTSAPSKTRKVAAKKT--APKKNTTVKKASSTIKKAK---
Tcrunogenagamma                LEECQKRLDEAPEPKKRGRVAAKKKAPAKKAAAKKTTAKKPAAKKPAAKK
ORF_JM16280                    LQDCLELLEKAPAKKRGKRKSKKAAK------------------------
                                .     :                                          

Aehrlicheigamma                ----------------------------------
Hhalophilagamma                ----------------------------------
Nmobilisgamma                  ----------------------------------
Noceanigamma                   ----------------------------------
Xaxonopodisgamma               AASKTAVKKAPAKKTATKKAAKRVVKKTVSKAAG
Xcampestrisgamma               AASKTAVKKAPAKKTAAKTAAKRVVKKTVSKAAG
Xoryzaegamma                   AASKTAAKKAPAKKAAAEKGTKRVVKKTVSKAAD
Xfastidiosagamma               SDKPVKKQIKKRIAPNITQ---------------
Mflagellatusbeta               SE--------------------------------
Rbalticaplanctomycete          TAKAAAKKKGIIKKSS------------------
Terythraeumcyanobacterie       ----------------------------------
Mtuberculosismycobacterie      ----------------------------------
Bbacilliformisalpha            ----------------------------------
Tcrunogenagamma                APAKKTTRKTPAKKTSDKS---------------
ORF_JM16280                    ----------------------------------
                                                                 

BLAST

Résultat de la séquence contre la banque nr. blast p sur le site ncbi 

                                                                Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|77166457|ref|YP_344982.1|  DNA topoisomerase III [Nitrosoco...   147    5e-34  Gene info
gi|88811388|ref|ZP_01126643.1|  DNA topoisomerase III [Nitroco...   145    1e-33
gi|114321779|ref|YP_743462.1|  DNA topoisomerase I [Alkalilimn...   140    6e-32  Gene info
gi|88949193|ref|ZP_01151811.1|  DNA topoisomerase I [Halorhodo...   132    1e-29
gi|78484541|ref|YP_390466.1|  DNA topoisomerase [Thiomicrospir...   127    4e-28  Gene info
gi|32475123|ref|NP_868117.1|  DNA topoisomerase I [Rhodopirell...   119    1e-25  Gene info
gi|60683637|ref|YP_213781.1|  putative DNA topoisomerase I [Ba...   116    7e-25  Gene info
gi|29348236|ref|NP_811739.1|  DNA topoisomerase I [Bacteroides...   116    7e-25  Gene info
gi|53715699|ref|YP_101691.1|  DNA topoisomerase I [Bacteroides...   116    7e-25  Gene info
gi|28199638|ref|NP_779952.1|  DNA topoisomerase III [Xylella f...   116    1e-24  Gene info
gi|83751448|ref|ZP_00947861.1|  COG0550: Topoisomerase IA [Barton   115    1e-24
gi|110638734|ref|YP_678943.1|  DNA topoisomerase type I (omega...   114    3e-24  Gene info
gi|15610782|ref|NP_218163.1|  DNA topoisomerase I [Mycobacteri...   114    3e-24  Gene info
gi|76782586|ref|ZP_00769790.1|  COG0550: Topoisomerase IA [Mycoba   114    3e-24
gi|71898889|ref|ZP_00681056.1|  DNA topoisomerase I [Xylella f...   114    3e-24
gi|71276453|ref|ZP_00652729.1|  DNA topoisomerase I [Xylella f...   114    3e-24
gi|15837522|ref|NP_298210.1|  DNA topoisomerase III [Xylella f...   114    4e-24  Gene info
gi|21244531|ref|NP_644113.1|  DNA topoisomerase III [Xanthomon...   113    7e-24  Gene info
gi|78049488|ref|YP_365663.1|  DNA topoisomerase III [Xanthomon...   113    7e-24  Gene info
gi|41406523|ref|NP_959359.1|  DNA topoisomerase I [Mycobacteri...   113    9e-24  Gene info
gi|21233183|ref|NP_639100.1|  DNA topoisomerase III [Xanthomon...   112    1e-23  Gene info
gi|118165053|gb|ABK65950.1|  DNA topoisomerase I [Mycobacterium a   112    1e-23
gi|114799315|ref|YP_760971.1|  DNA topoisomerase I [Hyphomonas...   112    2e-23  Gene info
gi|58580202|ref|YP_199218.1|  DNA topoisomerase III [Xanthomon...   110    4e-23  Gene info
gi|113473962|ref|YP_720023.1|  DNA topoisomerase I [Trichodesm...   110    7e-23  Gene info
gi|94986100|ref|YP_605464.1|  DNA topoisomerase I [Deinococcus...   108    2e-22  Gene info
gi|49475581|ref|YP_033622.1|  DNA topoisomerase I [Bartonella ...   108    3e-22  Gene info
gi|49474247|ref|YP_032289.1|  DNA topoisomerase I [Bartonella ...   107    4e-22  Gene info
gi|89360950|ref|ZP_01198767.1|  DNA topoisomerase I [Xanthobac...   106    7e-22
gi|87310458|ref|ZP_01092588.1|  DNA topoisomerase I [Blastopir...   106    9e-22
gi|15806391|ref|NP_295097.1|  DNA topoisomerase I [Deinococcus...   106    1e-21  Gene info
gi|17230272|ref|NP_486820.1|  DNA topoisomerase I [Nostoc sp. ...   105    1e-21  Gene info
gi|15827005|ref|NP_301268.1|  DNA topoisomerase I [Mycobacteri...   105    2e-21  Gene info
gi|22299424|ref|NP_682671.1|  DNA topoisomerase I [Thermosynec...   104    3e-21  Gene info
gi|75906255|ref|YP_320551.1|  DNA topoisomerase I [Anabaena va...   104    4e-21  Gene info
gi|16330456|ref|NP_441184.1|  DNA topoisomerase I [Synechocyst...   103    5e-21  Gene info
gi|56750148|ref|YP_170849.1|  DNA topoisomerase I [Synechococc...   103    5e-21  Gene info
gi|86605277|ref|YP_474040.1|  DNA topoisomerase I [Synechococc...   102    1e-20  Gene info
gi|86131576|ref|ZP_01050174.1|  putative DNA topoisomerase I [...   102    1e-20
gi|90417727|ref|ZP_01225639.1|  DNA topoisomerase I [Aurantimo...   102    2e-20
gi|46204907|ref|ZP_00209620.1|  COG1754: Uncharacterized C-ter...   101    2e-20
gi|92906889|ref|ZP_01275669.1|  DNA topoisomerase [Mycobacteri...   101    4e-20
gi|86143889|ref|ZP_01062257.1|  DNA topoisomerase I [Flavobact...   100    5e-20
gi|17989011|ref|NP_541644.1|  DNA topoisomerase I [Brucella me...   100    5e-20  Gene info
gi|62317539|ref|YP_223392.1|  DNA topoisomerase I [Brucella ab...   100    6e-20  Gene info
gi|83269520|ref|YP_418811.1|  DNA topoisomerase I:DNA topoisom...   100    8e-20  Gene info
gi|110633707|ref|YP_673915.1|  DNA topoisomerase I [Mesorhizob...   100    8e-20  Gene info
gi|117579493|emb|CAL67962.1|  DNA topoisomerase I [Gramella forse  99.8    9e-20
gi|23500348|ref|NP_699788.1|  DNA topoisomerase I [Brucella su...  99.4    1e-19  Gene info
gi|92117958|ref|YP_577687.1|  DNA topoisomerase [Nitrobacter h...  98.2    3e-19  Gene info
gi|21221962|ref|NP_627741.1|  probable DNA topoisomerase I [St...  98.2    3e-19  Gene info
gi|68229183|ref|ZP_00568380.1|  DNA topoisomerase I [Frankia s...  98.2    3e-19
gi|94497603|ref|ZP_01304172.1|  DNA topoisomerase [Sphingomona...  97.4    5e-19
gi|67922040|ref|ZP_00515556.1|  DNA topoisomerase I [Crocospha...  97.4    5e-19
gi|83855564|ref|ZP_00949093.1|  DNA topoisomerase I [Croceibac...  97.4    5e-19
gi|86357272|ref|YP_469164.1|  DNA topoisomerase I protein [Rhi...  96.7    7e-19  Gene info
gi|103486699|ref|YP_616260.1|  DNA topoisomerase [Sphingopyxis...  96.3    9e-19  Gene info
gi|114707185|ref|ZP_01440083.1|  DNA topoisomerase I [Fulvimar...  96.3    1e-18
gi|91774583|ref|YP_544339.1|  DNA topoisomerase [Methylobacill...  96.3    1e-18  Gene info
gi|75675904|ref|YP_318325.1|  DNA topoisomerase I [Nitrobacter...  96.3    1e-18  Gene info
gi|88856426|ref|ZP_01131084.1|  DNA topoisomerase I [marine ac...  96.3    1e-18
gi|29831164|ref|NP_825798.1|  DNA topoisomerase I [Streptomyce...  95.9    1e-18  Gene info
gi|69285289|ref|ZP_00616855.1|  DNA topoisomerase I [Kineococc...  95.5    2e-18
gi|56552089|ref|YP_162928.1|  DNA topoisomerase I [Zymomonas m...  95.5    2e-18  Gene info
gi|4511993|gb|AAD21553.1|  topoisomerase I [Zymomonas mobilis]     95.1    2e-18
gi|118168690|gb|ABK69586.1|  DNA topoisomerase I [Mycobacterium s  94.7    3e-18
gi|83596004|gb|ABC25363.1|  DNA topoisomerase I [uncultured marin  94.0    5e-18
gi|116251501|ref|YP_767339.1|  putative DNA topoisomerase I [R...  93.2    9e-18  Gene info
gi|86609798|ref|YP_478560.1|  DNA topoisomerase I [Synechococc...  92.8    1e-17  Gene info
gi|85373789|ref|YP_457851.1|  DNA topoisomeraseI [Erythrobacte...  92.4    1e-17  Gene info
gi|39936187|ref|NP_948463.1|  DNA topoisomerase I [Rhodopseudo...  92.0    2e-17  Gene info
gi|113943951|ref|ZP_01429652.1|  DNA topoisomerase [Salinispor...  92.0    2e-17
gi|111225912|ref|YP_716706.1|  DNA topoisomerase I (Omega-prot...  91.7    3e-17  Gene info
gi|71367216|ref|ZP_00657745.1|  DNA topoisomerase I [Nocardioi...  91.7    3e-17
gi|117929179|ref|YP_873730.1|  DNA topoisomerase I [Acidotherm...  91.3    3e-17
gi|15888629|ref|NP_354310.1|  DNA topoisomerase I [Agrobacteri...  91.3    4e-17  Gene info
gi|114327468|ref|YP_744625.1|  DNA topoisomerase I [Granulibac...  91.3    4e-17  Gene info
gi|90206677|ref|ZP_01209307.1|  DNA topoisomerase [Mycobacteri...  90.9    4e-17
gi|50954226|ref|YP_061514.1|  DNA topoisomerase I [Leifsonia x...  90.9    4e-17  Gene info
gi|115525380|ref|YP_782291.1|  DNA topoisomerase I [Rhodopseud...  90.9    5e-17  Gene info
gi|85715463|ref|ZP_01046444.1|  DNA topoisomerase I [Nitrobact...  90.5    5e-17
gi|83814718|ref|YP_445245.1|  DNA topoisomerase I [Salinibacte...  90.5    6e-17  Gene info
gi|84704086|ref|ZP_01017914.1|  DNA topoisomerase I [Parvularc...  90.5    6e-17
gi|91977501|ref|YP_570160.1|  DNA topoisomerase [Rhodopseudomo...  90.1    7e-17  Gene info
gi|84518521|ref|ZP_01005870.1|  DNA topoisomerase I [Prochloro...  90.1    8e-17
gi|34540543|ref|NP_905022.1|  DNA topoisomerase I [Porphyromon...  89.7    9e-17  Gene info
gi|88804979|ref|ZP_01120499.1|  DNA topoisomerase I [Robiginit...  89.7    1e-16
gi|28572856|ref|NP_789636.1|  DNA topoisomerase I [Tropheryma ...  89.4    1e-16  Gene info
gi|28493663|ref|NP_787824.1|  DNA topoisomerase I [Tropheryma ...  89.4    1e-16  Gene info
gi|86749539|ref|YP_486035.1|  DNA topoisomerase [Rhodopseudomo...  89.0    2e-16  Gene info
gi|91216869|ref|ZP_01253833.1|  DNA topoisomerase I [Psychrofl...  89.0    2e-16
gi|89340505|ref|ZP_01192762.1|  DNA topoisomerase I:TOPRIM [My...  88.6    2e-16
gi|83945521|ref|ZP_00957868.1|  DNA topoisomerase I [Oceanicau...  88.6    2e-16
gi|15965053|ref|NP_385406.1|  DNA topoisomerase I [Sinorhizobi...  88.6    2e-16  Gene info
gi|87199820|ref|YP_497077.1|  DNA topoisomerase [Novosphingobi...  88.6    2e-16  Gene info
gi|85708362|ref|ZP_01039428.1|  DNA topoisomerase I [Erythroba...  87.4    5e-16
gi|74316028|ref|YP_313768.1|  DNA topoisomerase I [Thiobacillu...  86.7    7e-16  Gene info
gi|113875431|ref|ZP_01415556.1|  DNA topoisomerase [Sinorhizob...  86.7    9e-16
gi|13470988|ref|NP_102557.1|  DNA topoisomerase I [Mesorhizobi...  86.7    9e-16  Gene info
gi|88801431|ref|ZP_01116959.1|  DNA topoisomerase I [Polaribac...  85.5    2e-15
gi|69935081|ref|ZP_00630061.1|  DNA topoisomerase I [Paracoccu...  85.1    2e-15
gi|54022331|ref|YP_116573.1|  DNA topoisomerase I [Nocardia fa...  84.7    3e-15  Gene info
gi|114569832|ref|YP_756512.1|  DNA topoisomerase I [Maricaulis...  84.7    3e-15  Gene info
gi|86742980|ref|YP_483380.1|  DNA topoisomerase [Frankia sp. C...  84.3    4e-15  Gene info
gi|88713418|ref|ZP_01107501.1|  DNA topoisomerase I [Flavobact...  84.3    4e-15
gi|1395205|gb|AAC44599.1|  topoisomerase I                         84.0    5e-15
gi|84495041|ref|ZP_00994160.1|  putative DNA topoisomerase I [...  84.0    5e-15
gi|33239884|ref|NP_874826.1|  DNA topoisomerase I [Prochloroco...  83.6    6e-15  Gene info
gi|113934579|ref|ZP_01420479.1|  DNA topoisomerase [Caulobacte...  83.6    7e-15
gi|72163183|ref|YP_290840.1|  bacterial DNA topoisomerase I [T...  83.6    7e-15  Gene info
gi|91070430|gb|ABE11342.1|  prokaryotic DNA topoisomerase [unc...  83.2    8e-15
gi|42522529|ref|NP_967909.1|  DNA topoisomerase I [Bdellovibri...  82.8    1e-14  Gene info
gi|83370550|ref|ZP_00915388.1|  DNA topoisomerase I [Rhodobact...  82.8    1e-14
gi|85666261|ref|ZP_01028485.1|  hypothetical protein Badol_010...  82.4    1e-14
gi|90423742|ref|YP_532112.1|  DNA topoisomerase [Rhodopseudomo...  81.6    3e-14  Gene info
gi|111021329|ref|YP_704301.1|  DNA topoisomerase I [Rhodococcu...  80.5    5e-14  Gene info
gi|25026863|ref|NP_736917.1|  DNA topoisomerase I [Corynebacte...  80.5    6e-14  Gene info
gi|62424654|ref|ZP_00379797.1|  COG0550: Topoisomerase IA [Brevib  80.5    6e-14
gi|110679406|ref|YP_682413.1|  DNA topoisomerase I, putative [...  80.5    7e-14  Gene info
gi|89891818|ref|ZP_01203320.1|  DNA  topoisomerase I [Flavobac...  79.7    9e-14
gi|77462727|ref|YP_352231.1|  DNA topoisomerase I [Rhodobacter...  79.7    1e-13  Gene info
gi|83373894|ref|ZP_00918671.1|  DNA topoisomerase I [Rhodobact...  79.7    1e-13
gi|58039716|ref|YP_191680.1|  DNA topoisomerase I [Gluconobact...  79.7    1e-13  Gene info
gi|78695404|ref|ZP_00859916.1|  DNA topoisomerase I [Bradyrhiz...  79.3    1e-13
gi|116073493|ref|ZP_01470755.1|  DNA topoisomerase I [Synechoc...  79.3    1e-13
gi|38232948|ref|NP_938715.1|  DNA topoisomerase I [Corynebacte...  79.0    2e-13  Gene info
gi|116671897|ref|YP_832830.1|  DNA topoisomerase I [Arthrobact...  78.6    2e-13  Gene info
gi|78778820|ref|YP_396932.1|  DNA topoisomerase I [Prochloroco...  78.6    2e-13  Gene info
gi|78212147|ref|YP_380926.1|  DNA topoisomerase I [Synechococc...  77.4    4e-13  Gene info
gi|16126690|ref|NP_421254.1|  DNA topoisomerase I [Caulobacter...  77.4    5e-13  Gene info
gi|83943947|ref|ZP_00956404.1|  DNA topoisomerase I [Sulfitoba...  77.4    5e-13
gi|83954520|ref|ZP_00963231.1|  DNA topoisomerase I [Sulfitoba...  77.4    5e-13
gi|19551559|ref|NP_599561.1|  DNA topoisomerase I [Corynebacte...  77.0    6e-13  Gene info
gi|88657600|ref|YP_507548.1|  DNA topoisomerase I [Ehrlichia c...  75.9    1e-12  Gene info
gi|68171244|ref|ZP_00544647.1|  DNA topoisomerase I [Ehrlichia...  75.9    1e-12
gi|68537048|ref|YP_251753.1|  DNA topoisomerase I [Corynebacte...  75.9    2e-12  Gene info
gi|50841733|ref|YP_054960.1|  DNA topoisomerase I [Propionibac...  74.7    3e-12  Gene info
gi|33860993|ref|NP_892554.1|  DNA topoisomerase I [Prochloroco...  74.7    3e-12  Gene info
gi|88941916|ref|ZP_01147304.1|  DNA topoisomerase I [Acidiphil...  74.3    4e-12
gi|84516626|ref|ZP_01003985.1|  DNA topoisomerase I [Loktanell...  74.3    4e-12
gi|89055651|ref|YP_511102.1|  DNA topoisomerase [Jannaschia sp...  73.9    5e-12  Gene info
gi|97581|pir||S25617  hypothetical protein 209 - Synechococcus sp  73.9    5e-12
gi|83594532|ref|YP_428284.1|  DNA topoisomerase [Rhodospirillu...  73.6    7e-12  Gene info
gi|89071022|ref|ZP_01158239.1|  DNA topoisomerase I [Oceanicol...  73.6    7e-12
gi|87123723|ref|ZP_01079573.1|  DNA topoisomerase I [Synechoco...  73.6    7e-12
gi|113954641|ref|YP_731316.1|  DNA topoisomerase I [Synechococ...  73.6    7e-12  Gene info
gi|91763193|ref|ZP_01265157.1|  DNA topoisomerase I [Candidatu...  72.8    1e-11
gi|71083771|ref|YP_266491.1|  DNA topoisomerase I [Candidatus ...  72.4    1e-11  Gene info
gi|58584298|ref|YP_197871.1|  Topoisomerase IA, TopA [Wolbachi...  70.9    4e-11  Gene info
gi|72383604|ref|YP_292959.1|  DNA topoisomerase I [Prochloroco...  70.5    7e-11  Gene info
gi|83950057|ref|ZP_00958790.1|  DNA topoisomerase I [Roseovari...  70.1    7e-11
gi|85705144|ref|ZP_01036244.1|  DNA topoisomerase I [Roseovari...  70.1    8e-11
gi|58696782|ref|ZP_00372316.1|  DNA topoisomerase I [Wolbachia...  69.7    1e-10
gi|46190552|ref|ZP_00121375.2|  COG0550: Topoisomerase IA [Bifido  69.3    1e-10
gi|23465075|ref|NP_695678.1|  DNA topoisomerase I [Bifidobacte...  69.3    1e-10  Gene info
gi|42520935|ref|NP_966850.1|  DNA topoisomerase I [Wolbachia e...  68.9    2e-10  Gene info
gi|33863620|ref|NP_895180.1|  DNA topoisomerase I [Prochloroco...  68.9    2e-10  Gene info
gi|83309781|ref|YP_420045.1|  DNA topoisomerase I [Magnetospir...  68.6    2e-10  Gene info
gi|73666949|ref|YP_302965.1|  DNA topoisomerase I [Ehrlichia c...  68.6    3e-10  Gene info
gi|84501685|ref|ZP_00999857.1|  DNA topoisomerase I [Oceanicol...  68.2    3e-10
gi|84685605|ref|ZP_01013502.1|  DNA topoisomerase I [Rhodobact...  67.8    4e-10
gi|57239068|ref|YP_180204.1|  DNA topoisomerase I [Ehrlichia r...  67.0    6e-10  Gene info
gi|67458922|ref|YP_246546.1|  DNA topoisomerase I [Rickettsia ...  67.0    7e-10  Gene info
gi|33866404|ref|NP_897963.1|  DNA topoisomerase I [Synechococc...  67.0    7e-10  Gene info
gi|58617070|ref|YP_196269.1|  DNA topoisomerase I [Ehrlichia r...  67.0    8e-10  Gene info
gi|86135283|ref|ZP_01053864.1|  DNA topoisomerase I [Tenacibac...  66.6    8e-10
gi|114770408|ref|ZP_01447946.1|  DNA topoisomerase I [alpha pr...  66.6    9e-10
gi|56416713|ref|YP_153787.1|  DNA topoisomerase [Anaplasma mar...  66.6    1e-09  Gene info
gi|99082179|ref|YP_614333.1|  DNA topoisomerase I [Silicibacte...  65.9    1e-09  Gene info
gi|87303038|ref|ZP_01085842.1|  DNA topoisomerase I [Synechoco...  65.9    2e-09
gi|90590416|ref|ZP_01246063.1|  DNA topoisomerase [Flavobacter...  65.1    2e-09
gi|116072788|ref|ZP_01470054.1|  DNA topoisomerase I [Synechoc...  63.9    5e-09
gi|78185331|ref|YP_377766.1|  DNA topoisomerase I [Synechococc...  63.5    8e-09  Gene info
gi|55819100|ref|YP_142575.1|  topoisomerase I (bacterial type)...  63.2    9e-09  Gene info
gi|53732001|ref|ZP_00153491.2|  COG0550: Topoisomerase IA [Ricket  62.8    1e-08
gi|46200755|ref|ZP_00056434.2|  COG0550: Topoisomerase IA [Mag...  62.8    1e-08
gi|34580624|ref|ZP_00142104.1|  DNA topoisomerase I [Rickettsi...  62.0    2e-08
gi|15892372|ref|NP_360086.1|  DNA topoisomerase I [Rickettsia ...  62.0    2e-08  Gene info
gi|88807568|ref|ZP_01123080.1|  DNA topoisomerase I [Synechoco...  61.6    3e-08
gi|52698750|ref|ZP_00340158.1|  COG0550: Topoisomerase IA [Ricket  61.6    3e-08
gi|2827516|emb|CAA16524.1|  DNA topoisomerase like-protein [Ar...  61.6    3e-08
gi|56697911|ref|YP_168282.1|  DNA topoisomerase I [Silicibacte...  61.2    4e-08  Gene info
gi|27380222|ref|NP_771751.1|  DNA topoisomerase I [Bradyrhizob...  60.8    5e-08  Gene info
gi|88608699|ref|YP_506474.1|  DNA topoisomerase I [Neoricketts...  60.1    7e-08  Gene info
gi|51473522|ref|YP_067279.1|  DNA topoisomerase I [Rickettsia ...  59.7    1e-07  Gene info
gi|114763468|ref|ZP_01442875.1|  DNA topoisomerase I [Roseovar...  58.9    2e-07
gi|88607358|ref|YP_505187.1|  DNA topoisomerase I [Anaplasma p...  58.2    3e-07  Gene info
gi|15604194|ref|NP_220709.1|  DNA topoisomerase I [Rickettsia ...  58.2    3e-07  Gene info
gi|86137985|ref|ZP_01056561.1|  DNA topoisomerase I [Roseobact...  58.2    3e-07
gi|42567296|ref|NP_194849.2|  DNA binding / DNA topoisomerase/...  57.8    4e-07  UniGene infoGene info
gi|68171243|ref|ZP_00544646.1|  DNA topoisomerase I [Ehrlichia...  54.3    5e-06
gi|91205527|ref|YP_537882.1|  DNA topoisomerase I [Rickettsia ...  53.1    1e-05  Gene info
gi|109728703|ref|ZP_01380114.1|  hypothetical protein RbelO_01...  53.1    1e-05
gi|116058312|emb|CAL53501.1|  unnamed protein product [Ostreococc  53.1    1e-05
gi|102191964|ref|ZP_01347776.1|  hypothetical protein RcanM_01...  51.6    3e-05
gi|288126|emb|CAA51086.1|  Topoisomerase I [Synechococcus elongat  51.2    4e-05
gi|58699462|ref|ZP_00374201.1|  DNA topoisomerase I [Wolbachia...  48.1    4e-04
gi|99036020|ref|ZP_01315059.1|  hypothetical protein Wendoof_0...  44.7    0.003
gi|91219924|ref|ZP_01256432.1|  DNA topoisomerase I [Psychrofl...  41.2    0.039
gi|15595173|ref|NP_212962.1|  DNA topoisomerase I (topA) [Borr...  38.1    0.34   Gene info
gi|97580|pir||S25616  hypothetical protein 150 - Synechococcus sp  37.0    0.84 
gi|51599079|ref|YP_073267.1|  DNA topoisomerase I [Borrelia ga...  35.4    2.2    Gene info
gi|47222460|emb|CAG12980.1|  unnamed protein product [Tetraodon n  34.7    3.8  

Alignments

gi|77166457|ref|YP_344982.1|  DNA topoisomerase III [Nitrosococcus oceani ATCC 19707]
 gi|76884771|gb|ABA59452.1|  DNA topoisomerase [Nitrosococcus oceani ATCC 19707]
Length=783

 Score =  147 bits (370),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 82/187 (43%), Positives = 118/187 (63%), Gaps = 6/187 (3%)

Query  55   LGYHPETNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPK  114
            LG  P+++ PV VR  RYGP +Q+GSKE   KPR+ GL     ++ IT E AL    LP+
Sbjct  598  LGIDPQSSRPVSVRMGRYGPYIQIGSKEDEEKPRFAGLQPGQKMDAITLEEALTLFKLPR  657

Query  115  ELGLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEALLSISSSKGSGA--  172
            ELG  P  GE+V V +G +GPY K  +K +   +G DP ++ LE AL  I   K + A  
Sbjct  658  ELGFTP-GGEQVSVNVGRFGPYVKYDNK-YVSLRGEDPHTISLERALALIEEKKQADANR  715

Query  173  -LKTFDDSSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEKAPAKK-RGKR  230
             +K F DS +++++GR+G YVTDG++NA VPK++ PE+L L+    L+ +AP K+ R K 
Sbjct  716  VIKVFPDSGIQVLNGRYGPYVTDGERNARVPKEQAPEALSLEQAQALINEAPVKRARRKA  775

Query  231  KSKKAAK  237
             ++K AK
Sbjct  776  GTRKKAK  782

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 59/166 (35%), Positives = 84/166 (50%), Gaps = 19/166 (11%)

Query  1    PVFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPSENILGYHPE  60
            PV  RM + GP +Q+G  + +EK  +A ++ GQ + +I LE A  L   P E  LG+ P 
Sbjct  607  PVSVRMGRYGPYIQIGSKEDEEKPRFAGLQPGQKMDAITLEEALTLFKLPRE--LGFTP-  663

Query  61   TNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPKE-----  115
              E V V   R+GP V+  +K       YV L   D    I+ ERAL  +   K+     
Sbjct  664  GGEQVSVNVGRFGPYVKYDNK-------YVSLRGEDP-HTISLERALALIEEKKQADANR  715

Query  116  -LGLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEA  160
             + + P+SG +VL   G YGPY   G +N R  K   P ++ LE+A
Sbjct  716  VIKVFPDSGIQVLN--GRYGPYVTDGERNARVPKEQAPEALSLEQA  759


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 60/115 (52%), Gaps = 10/115 (8%)

Query  114  KELGLDPESGEKVLVTIGPYGPYFKRGSKNFRGR---KGLDPF----SVELEEALLSISS  166
            +ELG+DP+S   V V +G YGPY + GSK    +    GL P     ++ LEEAL     
Sbjct  596  RELGIDPQSSRPVSVRMGRYGPYIQIGSKEDEEKPRFAGLQPGQKMDAITLEEALTLFKL  655

Query  167  SKGSGALKTFDDSSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEK  221
             +  G     +  SV +  GR+G YV    K  S+ + +DP ++ L+  L L+E+
Sbjct  656  PRELGFTPGGEQVSVNV--GRFGPYVKYDNKYVSL-RGEDPHTISLERALALIEE  707


gi|88811388|ref|ZP_01126643.1|  DNA topoisomerase III [Nitrococcus mobilis Nb-231]
 gi|88791277|gb|EAR22389.1|  DNA topoisomerase III [Nitrococcus mobilis Nb-231]
Length=774

 Score =  145 bits (367),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 74/172 (43%), Positives = 110/172 (63%), Gaps = 4/172 (2%)

Query  55   LGYHPETNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPK  114
            LG  P +  PV  R  RYGP  Q+GS     KP + GL++  SI+ IT E AL    LP+
Sbjct  588  LGVDPISGRPVTARLGRYGPYAQIGSANDAEKPSFAGLVQGQSIDTITLEEALALFKLPR  647

Query  115  ELGLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEALLSISSSKGSGA--  172
            ELG  P+ GEK++V IG YGPY + GSK    ++  DP+++  E AL  ++  K + A  
Sbjct  648  ELGETPQ-GEKLVVGIGRYGPYVRYGSKFVSLKRDDDPYTITRERALERVAEKKEAEANR  706

Query  173  -LKTFDDSSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEKAP  223
             ++ FD + ++I+ GR+G Y+TDGKKNA +PK ++P+ L+L++C +LL+K P
Sbjct  707  LIRRFDGAEIEILRGRFGPYITDGKKNARIPKGREPDELDLEECRQLLDKVP  758


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 60/163 (36%), Positives = 86/163 (52%), Gaps = 14/163 (8%)

Query  1    PVFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPSENILGYHPE  60
            PV AR+ + GP  Q+G  +  EK  +A + +GQS+ +I LE A  L   P E  LG  P+
Sbjct  597  PVTARLGRYGPYAQIGSANDAEKPSFAGLVQGQSIDTITLEEALALFKLPRE--LGETPQ  654

Query  61   TNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPKELGLDP  120
              E ++V   RYGP V+ GSK       +V L + D    IT ERAL+ ++  KE   + 
Sbjct  655  -GEKLVVGIGRYGPYVRYGSK-------FVSLKRDDDPYTITRERALERVAEKKEAEANR  706

Query  121  E----SGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEE  159
                  G ++ +  G +GPY   G KN R  KG +P  ++LEE
Sbjct  707  LIRRFDGAEIEILRGRFGPYITDGKKNARIPKGREPDELDLEE  749


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 55/111 (49%), Gaps = 9/111 (8%)

Query  114  KELGLDPESGEKVLVTIGPYGPYFKRGSKN------FRGR-KGLDPFSVELEEALLSISS  166
            +ELG+DP SG  V   +G YGPY + GS N      F G  +G    ++ LEEAL     
Sbjct  586  RELGVDPISGRPVTARLGRYGPYAQIGSANDAEKPSFAGLVQGQSIDTITLEEALALFKL  645

Query  167  SKGSGALKTFDDSSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLE  217
             +  G     +   V I  GR+G YV  G K  S+ +D DP ++  +  LE
Sbjct  646  PRELGETPQGEKLVVGI--GRYGPYVRYGSKFVSLKRDDDPYTITRERALE  694



gi|114321779|ref|YP_743462.1|  DNA topoisomerase I [Alkalilimnicola ehrlichei MLHE-1]
 gi|114228173|gb|ABI57972.1|  DNA topoisomerase I [Alkalilimnicola ehrlichei MLHE-1]
Length=797

 Score =  140 bits (352),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 76/172 (44%), Positives = 112/172 (65%), Gaps = 5/172 (2%)

Query  55   LGYHPETNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPK  114
            LG  P+T +PV VR  R+GP VQLG+K+   KPR+ GL    S+++IT E AL+   LP+
Sbjct  609  LGTDPKTGKPVSVRVGRFGPFVQLGTKDDEEKPRFAGLRPGQSMDKITLEEALELFKLPR  668

Query  115  ELGLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEALLSISSSKG---SG  171
            ++G  PE GE + V IG +GPY + G+K F   K  DP+++  E  L  +   K      
Sbjct  669  DMGETPE-GEPMQVNIGRFGPYVRFGNK-FVSIKDDDPYTISRERCLELVEEKKRIERER  726

Query  172  ALKTFDDSSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEKAP  223
             ++ F+ S ++I+ GR+G Y+T+GKKNA +PKD++PESL L++C EL+ KAP
Sbjct  727  TIRDFEGSDIRILKGRYGPYITNGKKNARIPKDREPESLGLEECEELIAKAP  778


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 58/163 (35%), Positives = 84/163 (51%), Gaps = 15/163 (9%)

Query  1    PVFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPSENILGYHPE  60
            PV  R+ + GP VQ+G  D +EK  +A ++ GQS+  I LE A EL   P +  +G  PE
Sbjct  618  PVSVRVGRFGPFVQLGTKDDEEKPRFAGLRPGQSMDKITLEEALELFKLPRD--MGETPE  675

Query  61   TNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLS----LPKEL  116
              EP+ V   R+GP V+ G+K       +V  +K D    I+ ER L+ +     + +E 
Sbjct  676  -GEPMQVNIGRFGPYVRFGNK-------FVS-IKDDDPYTISRERCLELVEEKKRIERER  726

Query  117  GLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEE  159
             +    G  + +  G YGPY   G KN R  K  +P S+ LEE
Sbjct  727  TIRDFEGSDIRILKGRYGPYITNGKKNARIPKDREPESLGLEE  769


gi|88949193|ref|ZP_01151811.1|  DNA topoisomerase I [Halorhodospira halophila SL1]
 gi|88927492|gb|EAR46454.1|  DNA topoisomerase I [Halorhodospira halophila SL1]
Length=832

 Score =  132 bits (332),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 71/171 (41%), Positives = 106/171 (61%), Gaps = 3/171 (1%)

Query  55   LGYHPETNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPK  114
            LG  P+T +PV VR  RYGP  QLGS++   KPR+ GL    SI+ IT + AL    LP+
Sbjct  642  LGTDPKTGKPVTVRIGRYGPFAQLGSRDDDEKPRFAGLRPGQSIDTITLDEALQLFKLPR  701

Query  115  ELGLDPESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEALLSISSSKGSGALK  174
            ++G + + GE V V+IG +GPY + G K     K  DP+++  E A   +   K + A +
Sbjct  702  DMG-ETDEGEDVQVSIGRFGPYVRYGKKFVSIPKDEDPYTITKERAHELVREKKQADANR  760

Query  175  TFDD--SSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEKAP  223
               D    ++I+ GR+G Y+T+G+KNA VPKD++P+SL  ++C +L+ KAP
Sbjct  761  IIHDFGDGIQILRGRYGPYITNGEKNAKVPKDREPDSLTHEECQDLIAKAP  811


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 81/162 (50%), Gaps = 13/162 (8%)

Query  1    PVFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPSENILGYHPE  60
            PV  R+ + GP  Q+G  D DEK  +A ++ GQS+ +I L+ A +L   P +  +G   E
Sbjct  651  PVTVRIGRYGPFAQLGSRDDDEKPRFAGLRPGQSIDTITLDEALQLFKLPRD--MGETDE  708

Query  61   TNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPKELGLDP  120
              E V V   R+GP V+ G K       +V + K +    IT ERA + +   K+   + 
Sbjct  709  -GEDVQVSIGRFGPYVRYGKK-------FVSIPKDEDPYTITKERAHELVREKKQADANR  760

Query  121  ---ESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEE  159
               + G+ + +  G YGPY   G KN +  K  +P S+  EE
Sbjct  761  IIHDFGDGIQILRGRYGPYITNGEKNAKVPKDREPDSLTHEE  802


 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 64/115 (55%), Gaps = 9/115 (7%)

Query  114  KELGLDPESGEKVLVTIGPYGPYFKRGSKN------FRG-RKGLDPFSVELEEALLSISS  166
            +ELG DP++G+ V V IG YGP+ + GS++      F G R G    ++ L+EAL     
Sbjct  640  RELGTDPKTGKPVTVRIGRYGPFAQLGSRDDDEKPRFAGLRPGQSIDTITLDEALQLFKL  699

Query  167  SKGSGALKTFDDSSVKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEK  221
             +  G     +D  V I  GR+G YV  GKK  S+PKD+DP ++  +   EL+ +
Sbjct  700  PRDMGETDEGEDVQVSI--GRFGPYVRYGKKFVSIPKDEDPYTITKERAHELVRE  752

ORF finding

>ORF number 1 in reading frame 1 on the direct strand extends from base 91 to base 198.
AAGAAGGTCAGTCGTTGTTTTCGATTGATCTTGAGATTGCTTGTGAGCTTCTCAATAAGC
CGAGTGAAAACATACTTGGTTACCATCCTGAAACAAACGAACCAGTGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
KKVSRCFRLILRLLVSFSISRVKTYLVTILKQTNQ*

>ORF number 2 in reading frame 1 on the direct strand extends from base 388 to base 489.
CTATCGGTCCTTATGGTCCGTATTTCAAACGTGGTTCAAAAAACTTTAGGGGGCGAAAAG
GGCTTGATCCTTTTTCAGTTGAGCTTGAGGAAGCTCTTTTAA

>Translation of ORF number 2 in reading frame 1 on the direct strand.
LSVLMVRISNVVQKTLGGEKGLILFQLSLRKLF*

>ORF number 3 in reading frame 1 on the direct strand extends from base 490 to base 633.
GCATATCAAGCTCTAAAGGTTCTGGCGCTCTTAAAACCTTTGATGACAGCTCCGTTAAAA
TTGTTGATGGAAGATGGGGTGCCTATGTCACAGACGGTAAAAAGAATGCCTCGGTACCCA
AAGACAAAGACCCGGAGAGCCTAG

>Translation of ORF number 3 in reading frame 1 on the direct strand.
AYQALKVLALLKPLMTAPLKLLMEDGVPMSQTVKRMPRYPKTKTRRA*

>ORF number 1 in reading frame 2 on the direct strand extends from base 590 to base 688.
AAAGAATGCCTCGGTACCCAAAGACAAAGACCCGGAGAGCCTAGAACTTCAAGATTGTCT
GGAACTACTAGAAAAGGCTCCTGCCAAAAAAAGAGGTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
KECLGTQRQRPGEPRTSRLSGTTRKGSCQKKR*

>ORF number 2 in reading frame 2 on the direct strand extends from base 689 to base 820.
GAGAAAATCAAAGAAAGCAGCCAAGTAGTTAAGATACTTGGGTCAGGAGGTATAATTGCA
TACCCAACCGATACTGTTTATGGAATGGGTTGTGATCCAAAAAACAAAGAGGCGGTTCAG
AGGCTTCTTGAG

>Translation of ORF number 2 in reading frame 2 on the direct strand.
EKIKESSQVVKILGSGGIIAYPTDTVYGMGCDPKNKEAVQRLLE

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 716.
CCCGTATTCGCTAGAATGACAAAAAATGGCCCTGCAGTTCAAGTGGGCGACATGGATAAA
GACGAAAAGCTTGAGTGGGCTGCTATAAAAGAAGGTCAGTCGTTGTTTTCGATTGATCTT
GAGATTGCTTGTGAGCTTCTCAATAAGCCGAGTGAAAACATACTTGGTTACCATCCTGAA
ACAAACGAACCAGTGATTGTCAGAGAGGCAAGGTACGGTCCGACTGTTCAACTTGGGTCG
AAGGAAGGCGGCAATAAACCAAGGTATGTTGGCTTACTGAAAACAGATTCTATTGAAGAA
ATCACATTTGAAAGGGCTTTAGATTATTTAAGCTTGCCAAAAGAGTTGGGGCTTGATCCT
GAATCAGGGGAAAAGGTTCTTGTGACTATCGGTCCTTATGGTCCGTATTTCAAACGTGGT
TCAAAAAACTTTAGGGGGCGAAAAGGGCTTGATCCTTTTTCAGTTGAGCTTGAGGAAGCT
CTTTTAAGCATATCAAGCTCTAAAGGTTCTGGCGCTCTTAAAACCTTTGATGACAGCTCC
GTTAAAATTGTTGATGGAAGATGGGGTGCCTATGTCACAGACGGTAAAAAGAATGCCTCG
GTACCCAAAGACAAAGACCCGGAGAGCCTAGAACTTCAAGATTGTCTGGAACTACTAGAA
AAGGCTCCTGCCAAAAAAAGAGGTAAGAGAAAATCAAAGAAAGCAGCCAAGTAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
PVFARMTKNGPAVQVGDMDKDEKLEWAAIKEGQSLFSIDLEIACELLNKPSENILGYHPE
TNEPVIVREARYGPTVQLGSKEGGNKPRYVGLLKTDSIEEITFERALDYLSLPKELGLDP
ESGEKVLVTIGPYGPYFKRGSKNFRGRKGLDPFSVELEEALLSISSSKGSGALKTFDDSS
VKIVDGRWGAYVTDGKKNASVPKDKDPESLELQDCLELLEKAPAKKRGKRKSKKAAK*

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 90.
CTCAAGAAGCCTCTGAACCGCCTCTTTGTTTTTTGGATCACAACCCATTCCATAAACAGT
ATCGGTTGGGTATGCAATTATACCTCCTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LKKPLNRLFVFWITTHSINSIGWVCNYTS*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 91 to base 183.
CCCAAGTATCTTAACTACTTGGCTGCTTTCTTTGATTTTCTCTTACCTCTTTTTTTGGCA
GGAGCCTTTTCTAGTAGTTCCAGACAATCTTGA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
PKYLNYLAAFFDFLLPLFLAGAFSSSSRQS*

>ORF number 3 in reading frame 1 on the reverse strand extends from base 250 to base 423.
GCACCCCATCTTCCATCAACAATTTTAACGGAGCTGTCATCAAAGGTTTTAAGAGCGCCA
GAACCTTTAGAGCTTGATATGCTTAAAAGAGCTTCCTCAAGCTCAACTGAAAAAGGATCA
AGCCCTTTTCGCCCCCTAAAGTTTTTTGAACCACGTTTGAAATACGGACCATAA

>Translation of ORF number 3 in reading frame 1 on the reverse strand.
APHLPSTILTELSSKVLRAPEPLELDMLKRASSSSTEKGSSPFRPLKFFEPRLKYGP*

>ORF number 4 in reading frame 1 on the reverse strand extends from base 496 to base 591.
TCTAAAGCCCTTTCAAATGTGATTTCTTCAATAGAATCTGTTTTCAGTAAGCCAACATAC
CTTGGTTTATTGCCGCCTTCCTTCGACCCAAGTTGA

>Translation of ORF number 4 in reading frame 1 on the reverse strand.
SKALSNVISSIESVFSKPTYLGLLPPSFDPS*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 56 to base 244.
ACAGTATCGGTTGGGTATGCAATTATACCTCCTGACCCAAGTATCTTAACTACTTGGCTG
CTTTCTTTGATTTTCTCTTACCTCTTTTTTTGGCAGGAGCCTTTTCTAGTAGTTCCAGAC
AATCTTGAAGTTCTAGGCTCTCCGGGTCTTTGTCTTTGGGTACCGAGGCATTCTTTTTAC
CGTCTGTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
TVSVGYAIIPPDPSILTTWLLSLIFSYLFFWQEPFLVVPDNLEVLGSPGLCLWVPRHSFY
RL*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 530 to base 619.
AATCTGTTTTCAGTAAGCCAACATACCTTGGTTTATTGCCGCCTTCCTTCGACCCAAGTT
GAACAGTCGGACCGTACCTTGCCTCTCTGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
NLFSVSQHTLVYCRLPSTQVEQSDRTLPL*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 104.
CAAGAAGCCTCTGAACCGCCTCTTTGTTTTTTGGATCACAACCCATTCCATAAACAGTAT
CGGTTGGGTATGCAATTATACCTCCTGACCCAAGTATCTTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
QEASEPPLCFLDHNPFHKQYRLGMQLYLLTQVS*

>ORF number 2 in reading frame 3 on the reverse strand extends from base 192 to base 326.
GCTCTCCGGGTCTTTGTCTTTGGGTACCGAGGCATTCTTTTTACCGTCTGTGACATAGGC
ACCCCATCTTCCATCAACAATTTTAACGGAGCTGTCATCAAAGGTTTTAAGAGCGCCAGA
ACCTTTAGAGCTTGA

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
ALRVFVFGYRGILFTVCDIGTPSSINNFNGAVIKGFKSARTFRA*

>ORF number 3 in reading frame 3 on the reverse strand extends from base 546 to base 818.
GCCAACATACCTTGGTTTATTGCCGCCTTCCTTCGACCCAAGTTGAACAGTCGGACCGTA
CCTTGCCTCTCTGACAATCACTGGTTCGTTTGTTTCAGGATGGTAACCAAGTATGTTTTC
ACTCGGCTTATTGAGAAGCTCACAAGCAATCTCAAGATCAATCGAAAACAACGACTGACC
TTCTTTTATAGCAGCCCACTCAAGCTTTTCGTCTTTATCCATGTCGCCCACTTGAACTGC
AGGGCCATTTTTTGTCATTCTAGCGAATACGGG

>Translation of ORF number 3 in reading frame 3 on the reverse strand.
ANIPWFIAAFLRPKLNSRTVPCLSDNHWFVCFRMVTKYVFTRLIEKLTSNLKINRKQRLT
FFYSSPLKLFVFIHVAHLNCRAIFCHSSEYG