ORF IZ16570

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160029.1
Annotathon code: ORF_IZ16570
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : adonis
Annotated on : 2008-03-19 18:52:37
  • VALENTE michael
  • ZEPPONI Vanessa

Synopsis

Genomic Sequence

>AACY01160029.1 ORF_IZ16570 genomic DNA
TTATCCAGGAAAAAGATATTATAATGGTTGTGAACATGTTGACGTGGCTGAAAAATTAGCACTGGAGAGAATTAAAAAACTTTTTAATTGTAAATATGCC
AATGTTCAACCTCATTCAGGTGCACAAGCAAATGGAGCAGTGTTTTTAGCGCTACTTAAACCGAACGATACATTTATGGGTATGAGCTTAAATTCTGGTG
GTCATATAACACATGGTCTTAAAATATCTATGTCTGGGAAATGGTTTAATGCAATAAGCTATGATGTTGATAAAAAATCTGAATTAATTGATTACGATAA
TGTTGAAAAATTAGCTTTAGAACACAAACCAAAATTAATCATCGCTGGTGGAAGTGCTTATTCAAGAGTTATTAATTTTAAAAGATTTAGAGAAATTGCA
GATAAAGTTGGAGCATATTTAATGGTTGATATGGCACATTTCTCAGGATTAGTTGCAGGTAAAGGATATCCAAACCCGTGTGATTATGCGCATGTTGTAA
CTTCAACTACGCATAAAGTTTTTAGAAGTGCCAGAGGTGGTATAATCTTATCTAACAATGAAGACCTAGGAAAAAAATTTGATACAGCTGTTTTTCCTGG
TTATCAAGGTGGACCTTTAATGCATATTATTGCAGCTAAAGCAGCAGGTTTTTATGAGGCACTAAAGCCAGAGTTTCAGACATATATTAAAAACGTTTTA
GCAAATGCAAAAATATTGGCTGAAACTTTAAAAAATAATGGCTTTAAAATTTATTCAGGTGGAACAGATACTCATTTAATGTTAGTGGATTTAAGACCTT
TTAATGTGAAAGGAA

Translation

[2 - 814/815]   direct strand
>ORF_IZ16570 Translation [2-814   direct strand]
YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMGMSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDN
VEKLALEHKPKLIIAGGSAYSRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGGIILSNNEDLGKKFDTAVFPG
YQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILAETLKNNGFKIYSGGTDTHLMLVDLRPFNVKG

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

           +----------Sulfitobacter (alpha protéobactérie)
     +-----5 
     !     +--------------Rdenitrificans (alpha protéobactérie)
     ! 
  +--9       +------------Nhamburgensis (alpha protéobactérie)
  !  !    +-10  
  !  !    !  +-------------Xautotrophicus (alpha protéobacétérie)
  !  !    !  
  !  +---11        +-------Babortus (alpha protéobactérie) 
  !       !     +-14  
  !       !  +-15  +---------Rhizobium etli (alpha protéobactérie)
  !       !  !  !  
  !       +-13  +---------Mesorhizobium (alpha protéobactérie)
  !          !  
  !          !  +------------Obatsensis (alpha protéobactérie)
  !          +-12  
  !             +-------------------Naromaticicans (alpha protéobactérie)
  ! 
  !                   +--------CPelagibacter (alpha protéobactérie)*
  ! +-----------------3 
  ! !                 +--ORF   
  ! ! 
  8-7                      +---Rfelis    (alpha protéobactérie)*
  ! !                    +-1 
  ! ! +------------------2 +---Rakari   (alpha protéobactérie) *
  ! ! !                  ! 
  ! +-6                  +---Rbellii   (alpha protéobactérie)*
  !   ! 
  !   !       +--------------------Wolbacchia (alpha protéobactérie) *
  !   +-------4 
  !           +--------------------Ecanis (alpha protéobactérie) *   
  ! 
  +-----------------------Vcholerae (gamma protéobactérie)

Annotator commentaries

Nous pensons que la séquence obtenue est codante. En effet, l'orf obtenu par sms est satisfaisant (270 acides aminés). De plus les bons résultats eus sur blastp et la recherche de domaines protéiques permettent de dire que cette séquence code pour une glycine/serine hydroxyméthyltransferase. Cette protéine (homotetramère) permet de faire l'interconversion entre la glycine et la serine. Elle catalyse, dans le cytoplasme, la réaction suivante : 5,10-methylenetetrahydrofolate + glycine + H2O _

tetrahydrofolate + L-serine.

Grâce à la consultation de plusieurs fiches swissprot, nous avons décidé de donner un symbôle à ce gène : glyA. Pour finir, en phylogénie nous avons pu faire une construction très précise en prenant comme groupe d'études les alpha protéobactéries et comme groupe extérieur une gamma protéobactérie. Ces résultats nous permettent de penser que notre séquence provient d'une alpha protéobactérie. On peut préciser ce résultat en disant que les 7 premiers orthologues sont des rickettsiales (* sur l'arbre) ce qui nous suggèrent que l'organisme dont est issu notre ORF fait partie de cette famille.

Multiple Alignement

                           10        20        30        40        50        60
                            |         |         |         |         |         |
Rakari             -----------------------------MNIFNNNLHETDKEINEIIKHEKLRQSSVIE
Rfelis             -----------------------------MNIFNNHLHETDKEIDEIIKHEKLRQNSVIE
Rbellii            -----------------------------MNIFNNKLQEIDKGIFEIIKHEKTRQNSVIE
ORFxxx0            ------------------------------------------------------------
CPelagibacter      -----------------MSSEKNYLNENYKSFFDDSLSVTDPELHKAISDELKRQQQHIE
Babortus           -----------------MSQANAATKAYSDVFFNASLEDIDPEIFGAIRNELGRQRHEIE
Rhizobium          -----------------------MTNASTESFFNRSLADVDPEIFGAIGKELGRQRHEIE
Mesorhizobium      -----------------MAQAS-TVAAETETFFSRPLEETDSEIFSAIRSELGRQRHEIE
Obatsensis         -----------------------MKDIKDAGFFTEALETRDPEIFGAIRNELGRQRDEIE
Naromaticivorans   -----------------MTTATAAPEIRKAGFFTEHLETADAEVFAAIRGELKRQQTKIE
Nhamburgensis      --------------MNSSAKTASAP----DSFFTATLAEADPEIAAAIKGELGRQRHEIE
Xautotrophicus     MRPAGVPRHYRRPAMASQDANRSSISEEMNRFFTAPLAESDPEIAGAVKAELGRQRDEIE
Sulfitobacter      ----------------------------MSGFFTTPLSEADPEIFGSITDELGRQRNEIE
Rdenitrificans     ---------------------MNALDRNTSTFFTSSLAQTDPEIASAVALELKRQRDEIE
Vcholerae          ---------------MNANLNKAYPNVSLENFFSTPLAATNDAVFAAIQAEYTRQNEQIE
Wolbacchia         ----------------------MMSVLKKICGSKNSLKSFDNEVYQSIEKELQRQKSQLQ
Ecanis             -------------------------MVRYILDHN--LQDIDVEVFDCISGELNRQNSQLQ
                                                                               
Prim.cons.         MRPAGVPRHYRRPAM3SM2QAKAAPNA5T2NFF2NSLAETDPEIFGAIK2ELGRQRSEIE

                           70        80        90       100       110       120
                            |         |         |         |         |         |
Rakari             LIASENFVSPAVLEAQGSILTNKYAEGYSGKRFYNGCEEVDKAENLAIERVKKLFNCKYA
Rfelis             LIASENFVSPAVLEAQGSILTNKYAEGYSGKRFYNGCEEVDKAENLAIERVKKLFNCKYA
Rbellii            LIASENFVSPAVLEAQGSVLTNKYAEGYSGKRFYNGCEEVDKAENLAIERAKKLFNCKYA
ORFxxx0            ---------------------------YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYA
CPelagibacter      LIASENIVSQAVLEAQGSVLTNKYAEGYPGKRYYNGCEHVDVAENLAIERLKKIFDCKFA
Babortus           LIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFA
Rhizobium          LIASENIVSRAVLEAQGSIMTNKYAEGYPGKRYYGGCQFVDIAEELAIERAKKLFGVNFA
Mesorhizobium      LIASENIVSRAVLEAQGTVLTNKYAEGYPGKRYYGGCQFVDVVEQLAIDRAKKLFNCQFA
Obatsensis         LIASENIVSAAVLEAQGSVMTNKYAEGYPGKRYYGGCQFVDVAEELAIERAKQLFGAGFA
Naromaticivorans   LIASENITSLAVLEATGSVFTNKYAEGYPGKRYYGGCEYADVVENLAIERAKKLFGCNFA
Nhamburgensis      LIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAETLAIERAKKLFGAQFA
Xautotrophicus     LIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCQFVDVAENLAIERAKKLFGCGFA
Sulfitobacter      LIASENIVSAAVMAAQGSVMTNKYAEGYPGRRYYGGCDFVDVAENLAIERACKLFNCDFA
Rdenitrificans     LIASENIVSQAVIEAQGSVMTNKYAEGYPGRRYYGGCQHVDVAENLAIERACKLFGCDFA
Vcholerae          LIASENIVSKAVMQAQGTCLTNKYAEGYPGRRYYGGCEHVDSVEQIAIERAKMLFQCQYA
Wolbacchia         LIASENFASKAVMEAQGSFLTNKYAEGYPGKRYYCGCEHVDKIESLAIERLCKLFGVKFA
Ecanis             LIASENFVSKAVLEAQGSIFTNKYAEGYPGKRYYCGCHFADIVENIAIERLCKLFGCKFA
                                              *.* *:* **. .*  * :*::*   :*   :*
Prim.cons.         LIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCEFVDVAENLAIERAKKLFGCKFA

                          130       140       150       160       170       180
                            |         |         |         |         |         |
Rakari             NVQPHSGSQANQAVYLTLLQPGDTILGMSLDSGGHLTHGASPNMSGKWFNAVSYGVNKKT
Rfelis             NVQSHSGSQANQAVYLALLQPGDTILGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKET
Rbellii            NVQPHSGSQANQAVYLALMQPGDTVLGMSLDSGGHLTHGSTANMSGKWFNAVSYSVDKET
ORFxxx0            NVQPHSGAQANGAVFLALLKPNDTFMGMSLNSGGHITHGLKISMSGKWFNAISYDVDKKS
CPelagibacter      NAQPHSGAQANGAVFLALLNPGDTFMGMSLNSGGHITHGLKISMSGKWFNPIGYDVDKES
Babortus           NVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDD
Rhizobium          NVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVREGD
Mesorhizobium      NVQPHSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRRDD
Obatsensis         NVQPNSGSQMNQAVFLALLRPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRQQD
Naromaticivorans   NVQPNSGSQMNQAVFLALLQPGDSFMGLDLNSGGHLTHGSPVNMSGKWFKPIPYGVRADD
Nhamburgensis      NVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGAPVNMSGKWFKAAHYTVRRDD
Xautotrophicus     NVQPNSGSQANQGVFFALLQPGDTFLGLNLAAGGHLTHGSPVNMSGKWFKPVPYTVREDD
Sulfitobacter      NVQPNSGSQANQGVFTALLQPGDTILGMSLDAGGHLTHGAKPNQSGKWFNAIQYGVRKQD
Rdenitrificans     NVQPNSGSQANQGVFQAVLKPGDTILGMSLDAGGHLTHGAAPNQSGKWFNAVQYGVRKDT
Vcholerae          NVQPHSGAQANGAVMLALLQPGDTIMGMSLDAGGHLTHGARPALSGKWFNAVQYGVDRQT
Wolbacchia         NVQPHSGSQANQAVFASLLTPGDTILGLSLSCGGHLTHGAAPSLSGKWFKSIQYTVNKDT
Ecanis             NVQPHSGSQANQGVFAALLKPGDTVVGLSLDCGGHLTHGSAPSISGKWFNAVQYQVDRNT
                   *.*.:**:* * .*  ::: *.*:.:*:.* .***:***     *****:   * *    
Prim.cons.         NVQPHSGSQANQAVFLALLQPGDTFMGLSL2SGGHLTHGSP2NMSGKWFNAVSYGVRKDD

                          190       200       210       220       230       240
                            |         |         |         |         |         |
Rakari             YLIDYDEIERLAVLHKPKLLIAGFSAYPRNIDFTRFREIADKVGAYFMADIAHIAGLVAT
Rfelis             YLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFARFREIADKVGAYFMADIAHIAGLVAT
Rbellii            YLIDYDEVERLAILHKPKLLIAGFSAYPRNLDFAKFREIADKVGAYLMADIAHIAGLVAA
ORFxxx0            ELIDYDNVEKLALEHKPKLIIAGGSAYSRVINFKRFREIADKVGAYLMVDMAHFSGLVAG
CPelagibacter      ELIDYDNVEKLALEHKPKLIICGGSAYSRVIDFKRFREIADKVGAYLMVDMAHFSGLVAG
Babortus           HLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAG
Rhizobium          NLLDMDEVARKAEEHKPKVIIAGGTAYSRIWDWKRFREIADSVGAYLMVDMAHIAGLVAG
Mesorhizobium      NLLDMDEVERLATEHKPKLILAGGTAYSRIWDWKRFREIADSVGAYLMVDMAHIAGLVAG
Obatsensis         ELLDMEEVRAKAREHRPKLILAGGTAYSRVWDWQAFREIADEVGAWLMVDMAHIAGLVAG
Naromaticivorans   HLIDMDEVARLARENKPKLIIAGGTAYSRVWDFKRFREIADEVGAWLLVDMSHFSGLVAG
Nhamburgensis      HLIDMDEVARRAEEVKPKLIIAGGSAYSRPWDFKRFREIADSVGAYLMVDMAHFAGLVAG
Xautotrophicus     QRIDYDEVARLADEHKPKLIVAGGSAYPRVIDFPKMRAIADSVGAKLMVDMAHFAGLVAG
Sulfitobacter      NQLDYDQVEALAKEHQPKLIIAGGSAIPRQIDFKRMREIADMVGAYLQVDMAHFAGLVAA
Rdenitrificans     LDVDYDQLEALALEHKPQMIIAGGSAIPRTLDFARFRAIADKVGAYLLADIAHYAGLIAT
Vcholerae          LEINYDSVRALALEHKPKMIIAGGSAIPRTIDFAQFRSIADEVGALLMVDMAHIAGLVAT
Wolbacchia         YLLNMDEIEKLALEHKPKLIIAGASAYPRKMDFKRFREIADKVGAYLLADIAHYAGLIAA
Ecanis             GLLDMDEIEKLVLEHKPTLLIAGSSAYPRTIDFKRFREIADKVGAYLLADIAHYAGLIAA
                     :: :.:   .   :* :::.* :* .*  ::  :* *** *** : .*::* :**:* 
Prim.cons.         YLIDYDEVERLALEHKPKLIIAGGSAYPRVIDFKRFREIADKVGAYLMVDMAHIAGLVAG

                          250       260       270       280       290       300
                            |         |         |         |         |         |
Rakari             GEHQSPISYAHVVTSTTHKTLRGPRGGLVLSDDEEIGKKINSALFPGLQGGPLMHIVAAK
Rfelis             GEHQSPIPYTHAVTSTTHKTLRGPRGGLILSNDEEIGKKINSALFPGLQGGPLMHIIAAK
Rbellii            GEHQSPIPHAHIVTSTTNKTLRGPRGGLILSNDEEIGKKINSALFPGLQGGPLMHIIAAK
ORFxxx0            KGYPNPCDYAHVVTSTTHKVFRSARGGIILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAK
CPelagibacter      KGYPNPCEHAHVVTSTTHKVFRSARGGIILTNHEDLAKKFNTAVFPGYQGGPLMHVIAGK
Babortus           GQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGK
Rhizobium          GQHPSPFPHCHVATTTTHKSLRGPRGGVILTNEEDLAKKFNSAVFPGLQGGPLMHIIAAK
Mesorhizobium      GAHPSPLPHAHVVTTTTHKSLRGPRGGMVLTNDEDIAKKVNSAVFPGLQGGPLMHVIAAK
Obatsensis         GAHPSPVGIADVVTTTTHKSLRGPRGGMILTNDESIAKKVNSAVFPGLQGGPLMHVVAAK
Naromaticivorans   GAHPSPFPHAHVVTSTTHKSLRGPRSGIILTNDEDLAKKFNMAVFPGMQGGPLVHVIAAK
Nhamburgensis      GVHASPVPHAHVTTTTTHKSLRGPRGGLILCNDEALAKKFNSAIFPGLQGGPLMHVIAAK
Xautotrophicus     GAHPSPFPHAHVVTTTTHKTLRGPRGGMILTNDEDLAKKINSAIFPGIQGGPLMHVIAAK
Sulfitobacter      GEHPSPFPHAHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGIQGGPLMHVIAAK
Rdenitrificans     GHYPSPFPHVHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGIQGGPLMHVIAAK
Vcholerae          GAHPSPLPHAHVVTTTTHKTLRGPRGGMILTNSEEIHKKINSAVFPGLQGGPLMHVIAAK
Wolbacchia         GEYPSPAEYAHVMTSTTHKTLRGPRGGIVMTNDEALHKKIQSAVFPGLQGGPLMHVIAAK
Ecanis             GEFPSPFEYAHVVTSTTHKTLRGPRGAVIMTNYEDIHKKIQSSIFPGMQGGPLMHVIAAK
                     . .*    .  *:**:* :*..*..::: :   : **.: ::*** *****:*::*.*
Prim.cons.         GEHPSPFPHAHVVTTTTHKTLRGPRGGMILTNDEDLAKKINSAVFPGLQGGPLMHVIAAK

                          310       320       330       340       350       360
                            |         |         |         |         |         |
Rakari             AVAFLESLQPEYKSYIKQIISNAKALASSLQERGYDILTGGTDNHIVLVDLRKNGITGKL
Rfelis             AVAFLENLQPEYKSYIKQVISNAKALASSLQERGYDILTGGTDNHIVLVDLCKDGITGKL
Rbellii            AVAFLESLQPEYKSYIKQVIINAKALAGSLQERGYDILTGGTDNHIVLVDLRKDGITGKI
ORFxxx0            AAGFYEALKPEFQTYIKNVLANAKILAETLKNNGFKIYSGGTDTHLMLVDLRPFNVK---
CPelagibacter      AAGFLEALRPDFKDYIKSVLANAKILSETLKNNGFKIYSGGTDTHLMLVDLRPFNVKGNA
Babortus           AVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKR
Rhizobium          AVAFGEALQPEFKEYAAQIVKNARALAETLIAGGLDVVSGGTDNHLMLVDLRKKNATGKR
Mesorhizobium      AVALGEALQPEFKAYAHQVVANARALAASLQETGLEIVSGGTDNHLMLVDLRPKNATGKR
Obatsensis         AVAFGEALRPEFKGYAAQVVANARAMADQLMKGGIDVVSGGTDNHLCLADLRPKKVTGKA
Naromaticivorans   AVAFGEALRPEFKAYAAQIVANARALAEAVKDAGLSVVSGGTDNHLMLVDLSAKDVTGKA
Nhamburgensis      AVAFGEALRPDFKIYAKNVVENAKALAESLRGNGFDIISGGTDNHLMLVDLRPKGLRGNV
Xautotrophicus     AVAFGEALRPEFKLYAKNVVENAKALAETLKGHGFNIVSGGTDTHLMLVDLRPKRLTGKT
Sulfitobacter      AVAFGEALKPEFKTYIQQVIKNAQALSDQLIKGGLDTITHGTDTHLLLVDLRPKGVKGND
Rdenitrificans     AVAFGEALEPDFERYQAQVIKNAQAMADELIKGGLDIVTGGTDTHLMLVDLRPKGVKGNV
Vcholerae          AVAFGEALGPEFRTYIDSVIDNAKVLAEVLQTRGCDIVTGGTDTHLMLVDLRPKGLKGNQ
Wolbacchia         AVAFKEALAPEFKTYSKKVVENAKVLAQELQKHGLDIITGGTDSHIVLVDLRSQKLTGKD
Ecanis             AVAFGEALKPDFKDYAKQIIKNSRVLVEVFKERGLNIVTDGTDSHIVLVDLRPKGVTGKD
                   *..: * * *::. *  .:: *:: :   .   * .  : ***.*: *.**         
Prim.cons.         AVAFGEAL2PEFKTYAKQVVANAKALAESL2ERGLDIVSGGTDNHLMLVDLRPKGVTGK3

                          370       380       390       400       410       420
                            |         |         |         |         |         |
Rakari             AANSLDNAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEQDFVSVGHMVADILDG
Rfelis             AANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDG
Rbellii            AANSLDRAGITCNKNAIPFDKTSPFITSGIRLGTPACTTRGFKEKDFVLVGHLIADILDG
ORFxxx0            ------------------------------------------------------------
CPelagibacter      AAESLSNANITCNKNGIPFDSEKPMITSGIRLGTQAATTRGFGLKEFEKVGELITKVVKG
Babortus           AEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDG
Rhizobium          AEAALGRAYITCNKNGIPFDPEKPFVTSGVRLGAPAGTTRGFKEAEFREIGNLIVEVLDG
Mesorhizobium      AEAALGRANITCNKNGIPFDPEKPFVTSGIRLGTPAGTTRGFGVAEFSQIGQLIAEVLDG
Obatsensis         AEAALGRAHITCNKNGVPFDPEKPFVTSGIRLGTPAGTTRGFGEDEFRQIADWIVEVVDG
Naromaticivorans   AEKGLDRAWLTCNKNGVPFDKRSPFVTSGIRLGTPAGTTRGFREEEFRKIGALIGEVVDG
Nhamburgensis      SEKALVRAAITCNKNGIPFDPEKPFVTSGLRLGTPAATTRGFGVAEFKQVGGLIAEVLNA
Xautotrophicus     SEGALGRAHITTNKNGIPFDPEKPFVTSGIRLGTPACTTRGFGVAEFQQVGDFIAEVLDV
Sulfitobacter      TEKALGRAHITCNKNGVPFDPEKPMVTSGIRLGSPAATTRGFGEDEFRQIADWIIEVVDG
Rdenitrificans     AEKALGRAHITCNKNGIPFDTEKPMITSGLRLGSPAGTTRGFTETEFRQIAGWIVEVVDG
Vcholerae          VEQALERAGITCNKNGIPFDEEKPMITSGIRLGTPAGTSRGFGREEFKLIGEWIGDVLDG
Wolbacchia         VVDSLERAGITCNKNSVPFDTAKPTITSGLRFGTAAETTRGLEAENFKEIAGLINEVIQG
Ecanis             AVLALERLGIICNKNAIPFDTEKPFVTSGLRFGSAAETSRGLQESEFREIGNMVCDVIDN
                                                                               
Prim.cons.         AE2ALGRAGITCNKNGIPFDPEKPFVTSGIRLGTPAGTTRGFGEAEFRQIG3LIAEVLDG

                          430       440       450
                            |         |         |
Rakari             L---KNNKDNTKAEQQVLHKVTKLIKLFPFYD---
Rfelis             L---KNNEDNGKAEQKVLTEVTKLIKLFPFYTR--
Rbellii            L---KNSEDNSKAEQKVLSEVTKLIKLFPFYD---
ORFxxx0            -----------------------------------
CPelagibacter      L--SENPEDNGKIEEEVRNEVIDLTSNFPIYKNLK
Babortus           LKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG
Rhizobium          LKVANSDDGNAAVEAAVRGKVVNLTDRFPMYDYMG
Mesorhizobium      LRAVNSDDGNIAVEEAVKKKVIALTERFPLYSYLD
Obatsensis         L-AANGEDGNAEVEAKVKSEVAGLCARFPLYAGI-
Naromaticivorans   L-ARNGEEGDGQVEQRVRDRVAELCAQFPIYPEL-
Nhamburgensis      I-AQADDGKAPLVEAAVKEKVKALTNRFPIYQD--
Xautotrophicus     L-SQKGVDEDSLVEATVREKVSGLLARFPIYP---
Sulfitobacter      L-AANGADGNAEVEAKVKAEVEALCARFPIYPNL-
Rdenitrificans     I-ARHGPEENGEVEAGVRAKVQALCDAFPIY----
Vcholerae          L--VASPEGNPDVEQQVRKQVKALCQRFPLYQ---
Wolbacchia         LISGN----SSSVEKAVKAKVERICSNFPIY----
Ecanis             LKASDIV--KASVEQDVIKKVKELTFAFIS-----
                                                                               
Prim.cons.         LKAANGDEGNAKVEQAV23KV3AL2ARFPIY2YLG                         



--------------------------------------------------------------------------------
Alignment data :
Alignment length : 455
Identity (*) : 86 is 18.90 %
Strongly similar (:) : 57 is 12.53 %
Weakly similar (.) : 32 is 7.03 %
Different : 280 is 61.54 %
Sequence 0001 : Rakari ( 420 residues).
Sequence 0002 : Rfelis ( 421 residues).
Sequence 0003 : Rbellii ( 420 residues).
Sequence 0004 : ORFxxx0 ( 270 residues).
Sequence 0005 : CPelagibacter ( 436 residues).
Sequence 0006 : Babortus ( 438 residues).
Sequence 0007 : Rhizobium ( 432 residues).
Sequence 0008 : Mesorhizobium ( 437 residues).
Sequence 0009 : Obatsensis ( 430 residues).
Sequence 0010 : Naromaticivorans ( 436 residues).
Sequence 0011 : Nhamburgensis ( 434 residues).
Sequence 0012 : Xautotrophicus ( 451 residues).
Sequence 0013 : Sulfitobacter ( 425 residues).
Sequence 0014 : Rdenitrificans ( 429 residues).
Sequence 0015 : Vcholerae ( 435 residues).
Sequence 0016 : Wolbacchia ( 425 residues).
Sequence 0017 : Ecanis ( 421 residues).
   

BLAST

résultats obtenus par blast p sur la banque nr


                                                                  Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|71083738|ref|YP_266458.1|  glycine hydroxymethyltransferase...   507    2e-142  Gene info
gi|91763226|ref|ZP_01265190.1|  glycine hydroxymethyltransfera...   506    4e-142
gi|91218939|ref|ZP_01255761.1|  glycine hydroxymethyltransfera...   415    9e-115
gi|110633487|ref|YP_673695.1|  glycine hydroxymethyltransferas...   393    4e-108  Gene info
gi|114704834|ref|ZP_01437742.1|  serine hydroxymethyltransfera...   388    1e-106
gi|62289717|ref|YP_221510.1|  serine hydroxymethyltransferase ...   380    5e-104  Gene info
gi|54303000|ref|YP_132993.1|  serine hydroxymethyltransferase ...   380    5e-104  Gene info
gi|13476935|ref|NP_108504.1|  serine hydroxymethyltransferase ...   379    6e-104  Gene info
gi|52699332|ref|ZP_00340740.1|  COG0112: Glycine/serine hydrox...   379    7e-104
gi|87200254|ref|YP_497511.1|  Glycine hydroxymethyltransferase...   377    2e-103  Gene info
gi|84514428|ref|ZP_01001792.1|  serine hydroxymethyltransferas...   377    3e-103
gi|38257713|sp|Q8YGG7|GLYA_BRUME  Serine hydroxymethyltransferase   376    5e-103
gi|91977142|ref|YP_569801.1|  Glycine hydroxymethyltransferase...   376    5e-103  Gene info
gi|23501652|ref|NP_697779.1|  serine hydroxymethyltransferase ...   376    6e-103  Gene info
gi|91206123|ref|YP_538478.1|  Glycine/serine hydroxymethyltran...   375    9e-103  Gene info
gi|17548276|ref|NP_521616.1|  serine hydroxymethyltransferase ...   375    1e-102  Gene info
gi|15888503|ref|NP_354184.1|  serine hydroxymethyltransferase ...   375    2e-102  Gene info
gi|49475525|ref|YP_033566.1|  serine hydroxymethyltransferase ...   374    2e-102  Gene info
gi|90424158|ref|YP_532528.1|  Glycine hydroxymethyltransferase...   374    2e-102  Gene info
gi|91778521|ref|YP_553729.1|  Glycine hydroxymethyltransferase...   374    3e-102  Gene info
gi|118055141|ref|ZP_01523658.1|  Glycine hydroxymethyltransfer...   374    3e-102
gi|73538647|ref|YP_299014.1|  serine hydroxymethyltransferase ...   373    4e-102  Gene info
gi|53732337|ref|ZP_00349463.1|  COG0112: Glycine/serine hydrox...   373    4e-102
gi|83593162|ref|YP_426914.1|  Glycine hydroxymethyltransferase...   373    6e-102  Gene info
gi|17935072|ref|NP_531862.1|  serine hydroxymethyltransferase ...   372    9e-102  Gene info
gi|86749751|ref|YP_486247.1|  Glycine hydroxymethyltransferase...   372    1e-101  Gene info
gi|118040046|ref|ZP_01511443.1|  glycine hydroxymethyltransfer...   372    1e-101
gi|113875535|ref|ZP_01415660.1|  Glycine hydroxymethyltransfer...   372    1e-101
gi|67459580|ref|YP_247204.1|  serine hydroxymethyltransferase ...   372    1e-101  Gene info
gi|114799314|ref|YP_760758.1|  serine hydroxymethyl transferas...   371    2e-101  Gene info
gi|15893069|ref|NP_360783.1|  serine hydroxymethyltransferase ...   371    2e-101  Gene info
gi|27380144|ref|NP_771673.1|  serine hydroxymethyltransferase ...   371    2e-101  Gene info
gi|34581254|ref|ZP_00142734.1|  serine hydroxymethyltransferas...   371    2e-101
gi|90419408|ref|ZP_01227318.1|  serine hydroxymethyltransferas...   371    2e-101
gi|37676353|ref|NP_936749.1|  serine hydroxymethyltransferase ...   370    3e-101  Gene info
gi|86357146|ref|YP_469038.1|  serine hydroxymethyltransferase ...   370    3e-101  Gene info
gi|116251386|ref|YP_767224.1|  putative serine hydroxymethyltr...   370    4e-101  Gene info
gi|42520844|ref|NP_966759.1|  serine hydroxymethyltransferase ...   370    4e-101  Gene info
gi|27366644|ref|NP_762171.1|  serine hydroxymethyltransferase ...   370    4e-101  Gene info
gi|15604577|ref|NP_221095.1|  serine hydroxymethyltransferase ...   370    4e-101  Gene info
gi|85706837|ref|ZP_01037928.1|  serine hydroxymethyltransferas...   370    5e-101
gi|46576392|sp|Q7MEH7|GLYA2_VIBVY  Serine hydroxymethyltransferas   370    5e-101
gi|83854787|ref|ZP_00948317.1|  serine hydroxymethyltransferas...   370    5e-101
gi|115524814|ref|YP_781725.1|  Glycine hydroxymethyltransferas...   369    6e-101  Gene info
gi|116186457|ref|ZP_01476352.1|  hypothetical protein VEx2w_02001   369    8e-101
gi|51473910|ref|YP_067667.1|  serine hydroxymethyltransferase ...   369    8e-101  Gene info
gi|83751281|ref|ZP_00947695.1|  COG0112: Glycine/serine hydrox...   369    1e-100
gi|102192120|ref|ZP_01347932.1|  hypothetical protein RcanM_01...   368    1e-100
gi|39531|emb|CAA38450.1|  glycine hydroxymethyltransferase [Brady   368    2e-100
gi|114769508|ref|ZP_01447134.1|  serine hydroxymethyltransfera...   368    2e-100
gi|73667306|ref|YP_303322.1|  Glycine hydroxymethyl transferas...   368    2e-100  Gene info
gi|57239411|ref|YP_180547.1|  serine hydroxymethyltransferase ...   368    2e-100  Gene info
gi|49474159|ref|YP_032201.1|  serine hydroxymethyltransferase ...   367    3e-100  Gene info
gi|116218920|ref|ZP_01484478.1|  hypothetical protein VchoV5_0200   367    3e-100
gi|15964961|ref|NP_385314.1|  serine hydroxymethyltransferase ...   367    3e-100  Gene info
gi|118032051|ref|ZP_01503502.1|  glycine hydroxymethyltransfer...   367    3e-100
gi|114570087|ref|YP_756767.1|  Glycine hydroxymethyltransferas...   367    4e-100  Gene info
gi|28900658|ref|NP_800313.1|  serine hydroxymethyltransferase ...   367    4e-100  Gene info
gi|78061421|ref|YP_371329.1|  serine hydroxymethyltransferase ...   367    4e-100  Gene info
gi|69938802|ref|ZP_00633186.1|  Glycine hydroxymethyltransfera...   366    5e-100
gi|15643483|ref|NP_228529.1|  serine hydroxymethyltransferase ...   366    6e-100  Gene info
gi|89068548|ref|ZP_01155945.1|  serine hydroxymethyltransferas...   366    6e-100
gi|99081420|ref|YP_613574.1|  Glycine hydroxymethyltransferase...   366    6e-100  Gene info
gi|67809818|gb|AAY81978.1|  serine hydroxymethyltransferase [Wolb   366    7e-100
gi|68165178|gb|AAY87549.1|  serine hydroxymethyltransferase [Vibr   365    8e-100
gi|58584266|ref|YP_197839.1|  Glycine/serine hydroxymethyltran...   365    8e-100  Gene info
gi|15601045|ref|NP_232675.1|  serine hydroxymethyltransferase ...   365    8e-100  Gene info
gi|91225431|ref|ZP_01260553.1|  serine hydroxymethyltransferas...   365    2e-99 
gi|39935791|ref|NP_948067.1|  serine hydroxymethyltransferase ...   364    2e-99   Gene info
gi|85715450|ref|ZP_01046431.1|  glycine hydroxymethyltransfera...   364    2e-99 
gi|68165176|gb|AAY87548.1|  serine hydroxymethyltransferase [Vibr   364    2e-99 
gi|92117359|ref|YP_577088.1|  Glycine hydroxymethyltransferase...   364    2e-99   Gene info
gi|71277781|ref|YP_270506.1|  serine hydroxymethyltransferase ...   364    2e-99   Gene info
gi|68165172|gb|AAY87546.1|  serine hydroxymethyltransferase [Vibr   364    2e-99 
gi|56696456|ref|YP_166813.1|  serine hydroxymethyltransferase ...   364    2e-99   Gene info
gi|115359243|ref|YP_776381.1|  Glycine hydroxymethyltransferas...   364    3e-99   Gene info
gi|68165170|gb|AAY87545.1|  serine hydroxymethyltransferase [Vibr   363    3e-99 
gi|89358047|ref|ZP_01195869.1|  glycine hydroxymethyltransfera...   363    4e-99 
gi|116693178|ref|YP_838711.1|  Glycine hydroxymethyltransferas...   363    4e-99   Gene info
gi|85373957|ref|YP_458019.1|  glycine hydroxymethyltransferase...   363    4e-99   Gene info
gi|15890668|ref|NP_356340.1|  hypothetical protein AGR_L_1099 ...   363    5e-99   Gene info
gi|68165162|gb|AAY87541.1|  serine hydroxymethyltransferase [V...   363    5e-99 
gi|89068493|ref|ZP_01155890.1|  hypothetical protein OG2516_13...   363    6e-99 
gi|114327672|ref|YP_744829.1|  serine hydroxymethyltransferase...   363    7e-99   Gene info
gi|68165174|gb|AAY87547.1|  serine hydroxymethyltransferase [Vibr   362    7e-99 
gi|83369772|ref|ZP_00914623.1|  Glycine hydroxymethyltransfera...   362    9e-99 
gi|89094816|ref|ZP_01167749.1|  serine hydroxymethyltransferas...   362    1e-98 
gi|107025640|ref|YP_623151.1|  Glycine hydroxymethyltransferas...   362    1e-98   Gene info
gi|84683846|ref|ZP_01011749.1|  serine hydroxymethyltransferas...   362    1e-98 
gi|110678495|ref|YP_681502.1|  serine hydroxymethyltransferase...   362    1e-98   Gene info
gi|83952385|ref|ZP_00961116.1|  serine hydroxymethyltransferas...   362    1e-98 
gi|77464399|ref|YP_353903.1|  serine hydroxymethyltransferase ...   362    1e-98   Gene info
gi|53721583|ref|YP_110568.1|  serine hydroxymethyltransferase ...   361    2e-98   Gene info
gi|84352699|ref|ZP_00977648.1|  COG0112: Glycine/serine hydrox...   361    2e-98 
gi|91976779|ref|YP_569438.1|  Glycine hydroxymethyltransferase...   361    2e-98   Gene info
gi|83373665|ref|ZP_00918443.1|  Glycine hydroxymethyltransfera...   361    2e-98 
gi|67734800|ref|ZP_00485879.1|  COG0112: Glycine/serine hydrox...   360    3e-98 
gi|110681120|ref|YP_684127.1|  serine hydroxymethyltransferase...   360    3e-98   Gene info
gi|16125606|ref|NP_420170.1|  serine hydroxymethyltransferase ...   360    4e-98   Gene info
gi|86138536|ref|ZP_01057109.1|  serine hydroxymethyltransferas...   360    4e-98 
gi|53717126|ref|YP_105243.1|  serine hydroxymethyltransferase ...   360    5e-98   Gene info
gi|100062141|ref|ZP_01323842.1|  hypothetical protein BpseP_03...   360    5e-98 
gi|75675919|ref|YP_318340.1|  serine hydroxymethyltransferase ...   359    7e-98   Gene info
gi|84499533|ref|ZP_00997821.1|  serine hydroxymethyltransferas...   359    7e-98 
gi|90414871|ref|ZP_01222837.1|  serine hydroxymethyltransferas...   359    8e-98 
gi|58040735|ref|YP_192699.1|  Serine hydroxymethyl transferase...   359    8e-98   Gene info
gi|67543282|ref|ZP_00421215.1|  Glycine hydroxymethyltransfera...   359    9e-98 
gi|83717733|ref|YP_440062.1|  serine hydroxymethyltransferase ...   359    9e-98   Gene info
gi|67543532|ref|ZP_00421464.1|  Glycine hydroxymethyltransfera...   358    1e-97 
gi|84514729|ref|ZP_01002093.1|  hypothetical protein SKA53_109...   358    2e-97 
gi|84520659|ref|ZP_01007796.1|  COG0112: Glycine/serine hydrox...   358    2e-97 
gi|47574264|ref|ZP_00244300.1|  COG0112: Glycine/serine hydrox...   358    2e-97 
gi|84702723|ref|ZP_01017298.1|  serine hydroxymethyltransferas...   356    5e-97 
gi|61213497|sp|Q72IH2|GLYA_THET2  Serine hydroxymethyltransferase   355    9e-97 
gi|118031243|ref|ZP_01502698.1|  glycine hydroxymethyltransfer...   355    9e-97 
gi|46199462|ref|YP_005129.1|  serine hydroxymethyltransferase ...   355    1e-96   Gene info
gi|83858223|ref|ZP_00951745.1|  serine hydroxymethyltransferas...   355    1e-96 
gi|55981493|ref|YP_144790.1|  serine hydroxymethyltransferase ...   355    1e-96   Gene info
gi|20385599|gb|AAM21349.1|  serine hydroxymethyltransferase [Sino   354    3e-96 
gi|78695327|ref|ZP_00859839.1|  Glycine hydroxymethyltransfera...   354    3e-96 
gi|68171816|ref|ZP_00545154.1|  Glycine hydroxymethyltransfera...   353    3e-96 
gi|85708544|ref|ZP_01039610.1|  probable serine hydroxymethylt...   353    4e-96 
gi|21230165|ref|NP_636082.1|  serine hydroxymethyltransferase ...   352    7e-96   Gene info
gi|94497533|ref|ZP_01304102.1|  glycine/serine hydroxymethyltr...   352    7e-96 
gi|89897673|ref|YP_521160.1|  hypothetical protein DSY4927 [De...   352    9e-96   Gene info
gi|42518350|ref|NP_964280.1|  serine hydroxymethyltransferase ...   352    9e-96   Gene info
gi|83592478|ref|YP_426230.1|  Glycine hydroxymethyltransferase...   351    2e-95   Gene info
gi|16263616|ref|NP_436409.1|  probable GlyA2 serine hydroxymet...   351    2e-95   Gene info
gi|83311438|ref|YP_421702.1|  Glycine/serine hydroxymethyltran...   350    3e-95   Gene info
gi|81299093|ref|YP_399301.1|  Glycine hydroxymethyltransferase...   350    3e-95   Gene info
gi|88607134|ref|YP_504778.1|  serine hydroxymethyltransferase ...   350    5e-95   Gene info
gi|109648012|ref|ZP_01371915.1|  glycine hydroxymethyltransfer...   349    6e-95 
gi|21241514|ref|NP_641096.1|  serine hydroxymethyltransferase ...   349    8e-95   Gene info
gi|56751240|ref|YP_171941.1|  serine hydroxymethyltransferase ...   349    8e-95   Gene info
gi|116628930|ref|YP_814102.1|  Glycine/serine hydroxymethyltra...   348    1e-94   Gene info
gi|71737346|ref|YP_276850.1|  serine hydroxymethyltransferase ...   348    1e-94   Gene info
gi|88608618|ref|YP_506113.1|  serine hydroxymethyltransferase ...   348    1e-94   Gene info
gi|88938706|ref|ZP_01144159.1|  Glycine/serine hydroxymethyltr...   348    2e-94 
gi|39935863|ref|NP_948139.1|  serine hydroxymethyltransferase ...   347    3e-94   Gene info
gi|103486283|ref|YP_615844.1|  Glycine hydroxymethyltransferas...   347    3e-94   Gene info
gi|90415717|ref|ZP_01223651.1|  serine hydroxymethyltransferas...   347    3e-94 
gi|78778645|ref|YP_396757.1|  Glycine hydroxymethyltransferase...   347    3e-94   Gene info
gi|16329716|ref|NP_440444.1|  serine hydroxymethyltransferase ...   347    4e-94   Gene info
gi|56552097|ref|YP_162936.1|  glycine/serine hydroxymethyltran...   346    5e-94   Gene info
gi|56416482|ref|YP_153556.1|  glycine/serine hydroxymethyltran...   346    6e-94   Gene info
gi|28867691|ref|NP_790310.1|  serine hydroxymethyltransferase ...   346    7e-94   Gene info
gi|66047936|ref|YP_237777.1|  serine hydroxymethyltransferase ...   346    8e-94   Gene info
gi|1707990|sp|P50435|GLYA_METEX  Serine hydroxymethyltransfera...   345    1e-93 
gi|93005149|ref|YP_579586.1|  Glycine hydroxymethyltransferase...   345    2e-93   Gene info
gi|88808022|ref|ZP_01123533.1|  serine hydroxymethyltransferas...   345    2e-93 
gi|78046350|ref|YP_362525.1|  serine hydroxymethyltransferase ...   345    2e-93   Gene info
gi|118028652|ref|ZP_01500114.1|  glycine hydroxymethyltransfer...   344    3e-93 
gi|88950325|ref|ZP_01152932.1|  serine hydroxymethyltransferas...   344    3e-93 
gi|89055482|ref|YP_510933.1|  Glycine hydroxymethyltransferase...   343    4e-93   Gene info
gi|71276436|ref|ZP_00652712.1|  Glycine hydroxymethyltransfera...   343    4e-93 
gi|71064867|ref|YP_263594.1|  putative glycine hydroxymethyltr...   343    4e-93   Gene info
gi|78185658|ref|YP_378092.1|  serine hydroxymethyltransferase ...   343    6e-93   Gene info
gi|33860816|ref|NP_892377.1|  serine hydroxymethyltransferase ...   343    7e-93   Gene info
gi|15605959|ref|NP_213336.1|  serine hydroxymethyl transferase...   342    7e-93   Gene info
gi|118058773|ref|ZP_01527233.1|  glycine hydroxymethyltransfer...   342    9e-93 
gi|116072054|ref|ZP_01469322.1|  serine hydroxymethyltransfera...   342    9e-93 
gi|20138407|sp|Q9PET2|GLYA_XYLFA  Serine hydroxymethyltransferase   342    1e-92 
gi|67874457|ref|ZP_00504243.1|  Glycine hydroxymethyltransfera...   342    1e-92 
gi|113969438|ref|YP_733231.1|  Glycine hydroxymethyltransferas...   342    1e-92   Gene info
gi|58583483|ref|YP_202499.1|  serine hydroxymethyltransferase ...   342    1e-92   Gene info
gi|15837548|ref|NP_298236.1|  serine hydroxymethyltransferase ...   342    1e-92   Gene info
gi|67154318|ref|ZP_00416063.1|  Glycine hydroxymethyltransfera...   342    1e-92 
gi|67921645|ref|ZP_00515163.1|  Glycine hydroxymethyltransfera...   342    1e-92 
gi|26987064|ref|NP_742489.1|  serine hydroxymethyltransferase ...   341    2e-92   Gene info
gi|68546844|ref|ZP_00586388.1|  Glycine hydroxymethyltransfera...   341    2e-92 
gi|33864795|ref|NP_896354.1|  serine hydroxymethyltransferase ...   341    2e-92   Gene info
gi|104784075|ref|YP_610573.1|  serine hydroxymethyltransferase...   341    2e-92   Gene info
gi|54293709|ref|YP_126124.1|  hypothetical protein lpl0762 [Le...   341    2e-92   Gene info
gi|33239742|ref|NP_874684.1|  serine hydroxymethyltransferase ...   341    3e-92   Gene info
gi|78211805|ref|YP_380584.1|  serine hydroxymethyltransferase ...   341    3e-92   Gene info
gi|114046666|ref|YP_737216.1|  Glycine hydroxymethyltransferas...   340    4e-92   Gene info
gi|87125103|ref|ZP_01080950.1|  serine hydroxymethyltransferas...   340    4e-92 
gi|20808520|ref|NP_623691.1|  Glycine hydroxymethyltransferase...   340    4e-92   Gene info
gi|76795719|ref|ZP_00778091.1|  Glycine hydroxymethyltransfera...   340    4e-92 
gi|17232298|ref|NP_488846.1|  serine hydroxymethyltransferase ...   340    4e-92   Gene info
gi|78365737|ref|ZP_00836022.1|  Glycine hydroxymethyltransfera...   340    4e-92 
gi|71898906|ref|ZP_00681073.1|  Glycine hydroxymethyltransfera...   340    4e-92 
gi|52840962|ref|YP_094761.1|  serine hydroxymethyltransferase ...   340    4e-92   Gene info
gi|106895455|ref|ZP_01362548.1|  Glycine hydroxymethyltransfer...   340    5e-92 
gi|86606657|ref|YP_475420.1|  serine hydroxymethyltransferase ...   340    5e-92   Gene info
gi|24374977|ref|NP_719020.1|  serine hydroxymethyltransferase ...   340    5e-92   Gene info
gi|32129565|sp|Q87AS2|GLYA_XYLFT  Serine hydroxymethyltransferase   340    6e-92 
gi|94412668|ref|ZP_01292576.1|  hypothetical protein PaerP_010...   339    6e-92 
gi|28199621|ref|NP_779935.1|  serine hydroxymethyltransferase ...   339    6e-92   Gene info
gi|116050392|ref|YP_790791.1|  serine hydroxymethyltransferase...   339    7e-92   Gene info
gi|84327231|ref|ZP_00975254.1|  COG0112: Glycine/serine hydrox...   339    8e-92 
gi|15600608|ref|NP_254102.1|  serine hydroxymethyltransferase ...   339    8e-92   Gene info
gi|15597640|ref|NP_251134.1|  serine hydroxymethyltransferase ...   339    8e-92   Gene info
gi|33595398|ref|NP_883041.1|  serine hydroxymethyltransferase ...   339    8e-92   Gene info
gi|94417119|ref|ZP_01296938.1|  hypothetical protein PaerP_010...   339    9e-92 
gi|91770355|ref|ZP_01272182.1|  Glycine hydroxymethyltransfera...   339    1e-91 
gi|118060789|ref|ZP_01529232.1|  glycine hydroxymethyltransfer...   339    1e-91 
gi|117618195|ref|YP_857825.1|  serine hydroxymethyltransferase...   339    1e-91 
gi|52082221|ref|YP_081012.1|  serine hydroxymethyltransferase ...   339    1e-91   Gene info
gi|91788735|ref|YP_549687.1|  Glycine hydroxymethyltransferase...   338    1e-91   Gene info
gi|107104517|ref|ZP_01368435.1|  hypothetical protein PaerPA_0...   338    1e-91 
gi|110347069|ref|YP_665887.1|  glycine hydroxymethyltransferas...   338    1e-91   Gene info
gi|113932844|ref|ZP_01418746.1|  Glycine hydroxymethyltransfer...   338    1e-91 
gi|104780039|ref|YP_606537.1|  serine hydroxymethyltransferase...   338    1e-91   Gene info
gi|70733014|ref|YP_262787.1|  serine hydroxymethyltransferase ...   338    1e-91   Gene info
gi|47573109|ref|ZP_00243149.1|  COG0112: Glycine/serine hydrox...   338    2e-91 
gi|68543318|ref|ZP_00583027.1|  Glycine hydroxymethyltransfera...   338    2e-91 
gi|89361961|ref|ZP_01199773.1|  serine hydroxymethyltransferas...   338    2e-91 
gi|113948627|ref|ZP_01434285.1|  Glycine hydroxymethyltransfer...   338    2e-91 
gi|86610234|ref|YP_478996.1|  serine hydroxymethyltransferase ...   338    2e-91   Gene info
gi|33599698|ref|NP_887258.1|  serine hydroxymethyltransferase ...   338    2e-91   Gene info
gi|84324878|ref|ZP_00972930.1|  COG0112: Glycine/serine hydrox...   338    2e-91 
gi|116626059|ref|YP_828215.1|  Glycine hydroxymethyltransferas...   337    2e-91   Gene info
gi|88704439|ref|ZP_01102153.1|  Glycine hydroxymethyltransfera...   337    3e-91 
gi|118031710|ref|ZP_01503163.1|  glycine hydroxymethyltransfer...   337    3e-91 
gi|33864114|ref|NP_895674.1|  serine hydroxymethyltransferase ...   337    3e-91   Gene info
gi|114764222|ref|ZP_01443460.1|  serine hydroxymethyltransfera...   337    3e-91 
gi|118134485|gb|ABK61529.1|  serine hydroxymethyltransferase [Clo   337    3e-91 
gi|77458539|ref|YP_348044.1|  Glycine hydroxymethyltransferase...   337    3e-91   Gene info
gi|104782867|ref|YP_609365.1|  serine hydroxymethyltransferase...   337    4e-91   Gene info
gi|116052744|ref|YP_793061.1|  Glycine/serine hydroxymethyltra...   337    4e-91   Gene info
gi|88811144|ref|ZP_01126400.1|  Glycine/serine hydroxymethyltr...   337    4e-91 
gi|118038559|ref|ZP_01509963.1|  glycine hydroxymethyltransfer...   337    4e-91 
gi|117923485|ref|YP_864102.1|  Glycine hydroxymethyltransferas...   337    4e-91 
gi|116748816|ref|YP_845503.1|  Glycine hydroxymethyltransferas...   337    4e-91   Gene info
gi|77954130|ref|ZP_00818530.1|  serine hydroxymethyltransferas...   337    4e-91 
gi|77461429|ref|YP_350936.1|  serine hydroxymethyltransferase ...   337    4e-91   Gene info
gi|22299670|ref|NP_682917.1|  serine hydroxymethyltransferase ...   337    5e-91   Gene info
gi|94413094|ref|ZP_01292986.1|  hypothetical protein PaerP_010...   337    5e-91 
gi|15794188|ref|NP_284010.1|  serine hydroxymethyltransferase ...   336    5e-91   Gene info
gi|84317238|ref|ZP_00965690.1|  COG0112: Glycine/serine hydrox...   336    5e-91 
gi|91792500|ref|YP_562151.1|  Glycine hydroxymethyltransferase...   336    6e-91   Gene info
gi|115359945|ref|YP_777083.1|  Glycine hydroxymethyltransferas...   336    7e-91   Gene info
gi|9911088|sp|Q9XAZ1|GLYA_NEIMC  Serine hydroxymethyltransfera...   336    7e-91 
gi|89093487|ref|ZP_01166435.1|  serine hydroxymethyltransferas...   336    7e-91 
gi|84318171|ref|ZP_00966600.1|  COG0112: Glycine/serine hydrox...   336    7e-91 
gi|70732651|ref|YP_262414.1|  serine hydroxymethyltransferase ...   336    8e-91   Gene info
gi|77815295|ref|ZP_00814533.1|  Glycine hydroxymethyltransfera...   335    9e-91 
gi|113476265|ref|YP_722326.1|  Glycine hydroxymethyltransferas...   335    9e-91   Gene info
gi|111611580|ref|ZP_01398669.1|  Glycine hydroxymethyltransfer...   335    9e-91 
gi|50122966|ref|YP_052133.1|  putative serine hydroxymethyltra...   335    9e-91   Gene info
gi|82701139|ref|YP_410705.1|  Glycine hydroxymethyltransferase...   335    1e-90   Gene info
gi|82501023|ref|ZP_00886403.1|  glycine hydroxymethyltransfera...   335    1e-90 
gi|37523938|ref|NP_927315.1|  serine hydroxymethyltransferase ...   335    1e-90   Gene info
gi|22219039|pdb|1KKJ|A  Chain A, Crystal Structure Of Serine H...   335    1e-90   Related structures
gi|107021881|ref|YP_620208.1|  Glycine hydroxymethyltransferas...   335    1e-90   Gene info
gi|83646577|ref|YP_435012.1|  Glycine/serine hydroxymethyltran...   335    1e-90   Gene info
gi|16080743|ref|NP_391571.1|  serine hydroxymethyltransferase ...   335    1e-90   Gene info
gi|116075611|ref|ZP_01472870.1|  serine hydroxymethyltransfera...   335    2e-90 
gi|82740738|ref|ZP_00903474.1|  Glycine hydroxymethyltransfera...   335    2e-90 
gi|56475982|ref|YP_157571.1|  serine hydroxymethyltransferase ...   335    2e-90   Gene info
gi|71279550|ref|YP_269193.1|  serine hydroxymethyltransferase ...   335    2e-90   Gene info
gi|118030213|ref|ZP_01501671.1|  glycine hydroxymethyltransfer...   335    2e-90 
gi|114562211|ref|YP_749724.1|  Glycine hydroxymethyltransferas...   335    2e-90   Gene info
gi|115350737|ref|YP_772576.1|  Glycine hydroxymethyltransferas...   334    2e-90   Gene info
gi|67544530|ref|ZP_00422458.1|  Glycine hydroxymethyltransfera...   334    2e-90 
gi|83591206|ref|YP_431215.1|  Glycine hydroxymethyltransferase...   334    2e-90   Gene info
gi|15599798|ref|NP_253292.1|  serine hydroxymethyltransferase ...   334    2e-90   Gene info
gi|67463727|pdb|1YJS|A  Chain A, K226q Mutant Of Serine Hydrox...   334    3e-90   Related structures
gi|115265596|dbj|BAF32858.1|  Serine hydroxymethyltransferase ...   334    3e-90 
gi|462189|sp|P34895|GLYA_HYPME  Serine hydroxymethyltransferas...   334    3e-90 
gi|28871764|ref|NP_794383.1|  serine hydroxymethyltransferase ...   334    3e-90   Gene info
gi|115360503|ref|YP_777640.1|  Glycine hydroxymethyltransferas...   334    3e-90   Gene info
gi|114331539|ref|YP_747761.1|  Glycine hydroxymethyltransferas...   334    3e-90   Gene info
gi|116669332|ref|YP_830265.1|  Glycine hydroxymethyltransferas...   334    3e-90   Gene info
gi|91781929|ref|YP_557135.1|  Glycine hydroxymethyltransferase...   334    3e-90   Gene info
gi|89901434|ref|YP_523905.1|  Glycine hydroxymethyltransferase...   333    3e-90   Gene info
gi|84715572|ref|ZP_01022601.1|  glyA1, RSc0729; probable serin...   333    3e-90 
gi|84360902|ref|ZP_00985589.1|  COG0112: Glycine/serine hydrox...   333    3e-90 
gi|59801267|ref|YP_207979.1|  GlyA [Neisseria gonorrhoeae FA 1...   333    4e-90   Gene info
gi|62906876|sp|Q9XB01|GLYA_NEIGO  Serine hydroxymethyltransfer...   333    4e-90 
gi|15676940|ref|NP_274089.1|  serine hydroxymethyltransferase ...   333    4e-90   Gene info
gi|71278318|ref|YP_270689.1|  serine hydroxymethyltransferase ...   333    4e-90   Gene info
gi|67548842|ref|ZP_00426722.1|  Glycine hydroxymethyltransfera...   333    4e-90 
gi|83721227|ref|YP_441925.1|  serine hydroxymethyltransferase ...   333    4e-90   Gene info
gi|116688829|ref|YP_834452.1|  Glycine hydroxymethyltransferas...   333    6e-90   Gene info
gi|67463728|pdb|1YJY|A  Chain A, K226m Mutant Of Serine Hydrox...   333    6e-90   Related structures
gi|110799943|ref|YP_696608.1|  serine hydroxymethyltransferase...   333    6e-90   Gene info
gi|26987407|ref|NP_742832.1|  serine hydroxymethyltransferase ...   333    6e-90   Gene info
gi|56421904|ref|YP_149222.1|  serine hydroxymethyltransferase ...   333    6e-90   Gene info
gi|83746176|ref|ZP_00943230.1|  Serine hydroxymethyltransferas...   333    6e-90 
gi|90020066|ref|YP_525893.1|  Glycine hydroxymethyltransferase...   333    7e-90   Gene info
gi|78063601|ref|YP_373509.1|  serine hydroxymethyltransferase ...   333    7e-90   Gene info
gi|71736577|ref|YP_276444.1|  serine hydroxymethyltransferase ...   333    7e-90   Gene info
gi|118058042|ref|ZP_01526504.1|  glycine hydroxymethyltransfer...   332    7e-90 
gi|84356903|ref|ZP_00981735.1|  COG0112: Glycine/serine hydrox...   332    9e-90 
gi|77461098|ref|YP_350605.1|  serine hydroxymethyltransferase ...   332    9e-90   Gene info
gi|76811713|ref|YP_334622.1|  serine hydroxymethyltransferase ...   332    1e-89   Gene info
gi|66047497|ref|YP_237338.1|  serine hydroxymethyltransferase ...   332    1e-89   Gene info
gi|18310911|ref|NP_562845.1|  serine hydroxymethyltransferase ...   332    1e-89   Gene info
gi|20138421|sp|Q9RYB2|GLYA_DEIRA  Serine hydroxymethyltransferase   332    1e-89 
gi|114319535|ref|YP_741218.1|  Glycine hydroxymethyltransferas...   332    1e-89   Gene info
gi|15805079|ref|NP_293764.1|  serine hydroxymethyltransferase ...   332    1e-89   Gene info
gi|113954253|ref|YP_729534.1|  serine hydroxymethyltransferase...   332    1e-89   Gene info
gi|94500397|ref|ZP_01306929.1|  Glycine/serine hydroxymethyltr...   332    1e-89 
gi|58336600|ref|YP_193185.1|  serine hydroxymethyltransferase ...   331    2e-89   Gene info
gi|106881424|ref|ZP_01348829.1|  Glycine hydroxymethyltransfer...   331    2e-89 
gi|97050296|sp|Q391K1|GLYA2_BURS3  Serine hydroxymethyltransferas   331    2e-89 
gi|78222815|ref|YP_384562.1|  Aminotransferase, class I and II...   330    3e-89   Gene info
gi|97050142|sp|Q2SYS4|GLYA1_BURTA  Serine hydroxymethyltransferas   330    3e-89 
gi|78045069|ref|YP_361350.1|  serine hydroxymethyltransferase ...   330    3e-89   Gene info
gi|94984329|ref|YP_603693.1|  Glycine hydroxymethyltransferase...   330    3e-89   Gene info
gi|88799133|ref|ZP_01114713.1|  Glycine/serine hydroxymethyltr...   330    4e-89 
gi|116269954|ref|ZP_01494196.1|  Glycine hydroxymethyltransfer...   330    4e-89 
gi|82538563|ref|ZP_00897556.1|  hypothetical protein Bpse110_0...   330    4e-89 
gi|68054288|ref|ZP_00538452.1|  Glycine hydroxymethyltransfera...   330    4e-89 
gi|53720368|ref|YP_109354.1|  serine hydroxymethyltransferase ...   330    4e-89   Gene info
gi|72383460|ref|YP_292815.1|  serine hydroxymethyltransferase ...   330    5e-89   Gene info
gi|114567898|ref|YP_755052.1|  Glycine hydroxymethyltransferas...   330    5e-89   Gene info
gi|16762332|ref|NP_457949.1|  putative serine hydroxymethyltra...   330    5e-89   Gene info
gi|116218565|ref|ZP_01484208.1|  hypothetical protein VchoV5_0200   330    6e-89 
gi|49188151|ref|YP_031404.1|  serine hydroxymethyltransferase ...   330    6e-89   Gene info
gi|78065369|ref|YP_368138.1|  serine hydroxymethyltransferase ...   330    6e-89   Gene info
gi|30265339|ref|NP_847716.1|  serine hydroxymethyltransferase ...   329    6e-89   Gene info
gi|110802007|ref|YP_699205.1|  serine hydroxymethyltransferase...   329    7e-89   Gene info
gi|30249404|ref|NP_841474.1|  Serine hydroxymethyltransferase ...   329    7e-89   Gene info
gi|111620020|ref|ZP_01407019.1|  Glycine hydroxymethyltransfer...   329    8e-89 
gi|23100440|ref|NP_693907.1|  serine hydroxymethyltransferase ...   329    8e-89   Gene info
gi|42784486|ref|NP_981733.1|  serine hydroxymethyltransferase ...   329    9e-89   Gene info
gi|52140246|ref|YP_086584.1|  serine hydroxymethyltransferase ...   329    1e-88   Gene info
gi|47570683|ref|ZP_00241282.1|  serine hydroxymethyltransferas...   329    1e-88 
gi|94311612|ref|YP_584822.1|  glycine hydroxymethyltransferase...   328    1e-88   Gene info
gi|30023347|ref|NP_834978.1|  serine hydroxymethyltransferase ...   328    1e-88   Gene info
gi|77683802|ref|ZP_00799246.1|  Glycine hydroxymethyltransfera...   328    2e-88 
gi|110594643|ref|ZP_01382986.1|  Glycine hydroxymethyltransfer...   327    3e-88 
gi|78485746|ref|YP_391671.1|  Glycine hydroxymethyltransferase...   327    3e-88   Gene info
gi|90406959|ref|ZP_01215150.1|  serine hydroxymethyltransferas...   327    3e-88 
gi|39996707|ref|NP_952658.1|  serine hydroxymethyltransferase ...   327    3e-88   Gene info
gi|15925103|ref|NP_372637.1|  serine hydroxymethyl transferase...   327    4e-88   Gene info
gi|82751714|ref|YP_417455.1|  serine hydroxymethyltransferase ...   327    4e-88   Gene info
gi|118051120|ref|ZP_01519669.1|  glycine hydroxymethyltransfer...   327    5e-88 
gi|88936052|ref|ZP_01141671.1|  serine hydroxymethyltransferas...   327    5e-88 
gi|94986603|ref|YP_594536.1|  Glycine/serine hydroxymethyltran...   327    5e-88   Gene info
gi|85712648|ref|ZP_01043694.1|  Glycine/serine hydroxymethyltr...   326    5e-88 
gi|113868790|ref|YP_727279.1|  Glycine/serine hydroxymethyltra...   326    6e-88   Gene info
gi|55822722|ref|YP_141163.1|  serine hydroxymethyltransferase ...   326    6e-88   Gene info
gi|55820819|ref|YP_139261.1|  serine hydroxymethyltransferase ...   326    6e-88   Gene info
gi|110599122|ref|ZP_01387363.1|  Glycine hydroxymethyltransfer...   326    7e-88 
gi|15672583|ref|NP_266757.1|  serine hydroxymethyltransferase ...   326    8e-88   Gene info
gi|87161336|ref|YP_494713.1|  serine hydroxymethyltransferase ...   326    9e-88   Gene info
gi|114775683|ref|ZP_01451251.1|  Glycine/serine hydroxymethylt...   325    1e-87 
gi|89095617|ref|ZP_01168511.1|  serine hydroxymethyltransferas...   325    1e-87 
gi|24214109|ref|NP_711590.1|  serine hydroxymethyltransferase ...   325    1e-87   Gene info
gi|77919043|ref|YP_356858.1|  serine hydroxymethyltransferase ...   325    2e-87   Gene info
gi|71837192|ref|ZP_00676958.1|  Glycine hydroxymethyltransfera...   325    2e-87 
gi|57234762|ref|YP_181180.1|  Serine hydroxymethyltransferase ...   325    2e-87   Gene info
gi|84518669|ref|ZP_01006018.1|  serine hydroxymethyltransferas...   324    2e-87 
gi|73748278|ref|YP_307517.1|  serine hydroxymethyltransferase ...   324    3e-87   Gene info
gi|88933558|ref|ZP_01139232.1|  Glycine hydroxymethyltransfera...   324    3e-87 
gi|53804250|ref|YP_114103.1|  serine hydroxymethyltransferase ...   324    3e-87   Gene info
gi|46579614|ref|YP_010422.1|  serine hydroxymethyltransferase ...   324    3e-87   Gene info
gi|82747463|ref|ZP_00909960.1|  serine hydroxymethyltransferas...   324    3e-87 
gi|73540494|ref|YP_295014.1|  serine hydroxymethyltransferase ...   324    3e-87   Gene info
gi|38372373|sp|Q8EWD1|GLYA_MYCPE  Serine hydroxymethyltransferase   323    4e-87 
gi|89256092|ref|YP_513454.1|  serine hydroxymethyltransferase ...   323    4e-87   Gene info
gi|23123869|ref|ZP_00105902.1|  COG0112: Glycine/serine hydrox...   323    4e-87 
gi|29377039|ref|NP_816193.1|  serine hydroxymethyltransferase ...   323    4e-87   Gene info
gi|116328753|ref|YP_798473.1|  Glycine hydroxymethyltransferas...   323    5e-87   Gene info
gi|111019924|ref|YP_702896.1|  glycine hydroxymethyltransferas...   323    7e-87   Gene info
gi|90961855|ref|YP_535771.1|  Serine hydroxymethyltransferase ...   322    8e-87   Gene info
gi|56708303|ref|YP_170199.1|  serine hydroxymethyltransferase ...   322    8e-87   Gene info
gi|57339696|gb|AAW49835.1|  hypothetical protein FTT1241 [synthet   322    8e-87 
gi|26553727|ref|NP_757661.1|  serine hydroxymethyl transferase...   322    1e-86   Gene info
gi|74318183|ref|YP_315923.1|  glycine/serine hydroxymethyltran...   322    1e-86   Gene info
gi|27468628|ref|NP_765265.1|  serine hydroxymethyl transferase...   322    1e-86   Gene info
gi|73662080|ref|YP_300861.1|  serine hydroxymethyltransferase ...   322    1e-86   Gene info
gi|94493943|ref|ZP_01301146.1|  hypothetical protein Rgryl_010004   322    1e-86 
gi|77165493|ref|YP_344018.1|  Glycine hydroxymethyltransferase...   322    2e-86   Gene info
gi|75908297|ref|YP_322593.1|  serine hydroxymethyltransferase ...   321    3e-86   Gene info
gi|6919897|sp|O85718|GLYA_ACIRA  Serine hydroxymethyltransfera...   320    4e-86 
gi|71906243|ref|YP_283830.1|  Glycine hydroxymethyltransferase...   320    5e-86   Gene info
gi|50085359|ref|YP_046869.1|  serine hydroxymethyltransferase ...   320    6e-86   Gene info
gi|111225291|ref|YP_716085.1|  serine hydroxymethyltransferase...   320    6e-86   Gene info
gi|118071570|ref|ZP_01539764.1|  glycine hydroxymethyltransfer...   319    7e-86 
gi|108803318|ref|YP_643255.1|  Glycine hydroxymethyltransferas...   319    7e-86   Gene info
gi|70725923|ref|YP_252837.1|  serine hydroxymethyl transferase...   319    7e-86   Gene info
gi|34539916|ref|NP_904395.1|  serine hydroxymethyltransferase ...   319    9e-86   Gene info
gi|424016|pir||S30382  glycine hydroxymethyltransferase (EC 2....   318    1e-85 
gi|108762445|ref|YP_632928.1|  serine hydroxymethyltransferase...   318    1e-85   Gene info
gi|95929570|ref|ZP_01312312.1|  Glycine hydroxymethyltransfera...   318    1e-85 
gi|92114735|ref|YP_574663.1|  Glycine hydroxymethyltransferase...   318    1e-85   Gene info
gi|15900895|ref|NP_345499.1|  serine hydroxymethyltransferase ...   318    1e-85   Gene info
gi|15895532|ref|NP_348881.1|  Glycine hydroxymethyltransferase...   318    1e-85   Gene info
gi|34496741|ref|NP_900956.1|  glycine hydroxymethyltransferase...   318    2e-85   Gene info
gi|84494535|ref|ZP_00993654.1|  Glycine hydroxymethyltransfera...   318    2e-85 
gi|116511391|ref|YP_808607.1|  Glycine/serine hydroxymethyltra...   318    2e-85   Gene info
gi|17545448|ref|NP_518850.1|  serine hydroxymethyltransferase ...   318    2e-85   Gene info
gi|81096271|ref|ZP_00874618.1|  Glycine hydroxymethyltransfera...   318    2e-85 
gi|86742398|ref|YP_482798.1|  Glycine hydroxymethyltransferase...   317    3e-85   Gene info
gi|33598384|ref|NP_886027.1|  serine hydroxymethyltransferase ...   317    3e-85   Gene info
gi|33593887|ref|NP_881531.1|  serine hydroxymethyltransferase ...   317    3e-85   Gene info
gi|77410472|ref|ZP_00786833.1|  serine hydroxymethyltransferas...   317    3e-85 
gi|15828810|ref|NP_326170.1|  serine hydroxymethyltransferase ...   317    3e-85   Gene info
gi|25011157|ref|NP_735552.1|  serine hydroxymethyltransferase ...   317    4e-85   Gene info
gi|109897624|ref|YP_660879.1|  Glycine hydroxymethyltransferas...   317    4e-85   Gene info
gi|22537232|ref|NP_688083.1|  serine hydroxymethyltransferase ...   317    4e-85   Gene info
gi|77408663|ref|ZP_00785396.1|  serine hydroxymethyltransferas...   316    6e-85 
gi|97536268|sp|Q8PZQ0|GLYA_METMA  Serine hydroxymethyltransferase   316    7e-85 
gi|21226544|ref|NP_632466.1|  Serine hydroxymethyltransferase ...   316    8e-85   Gene info
gi|72162752|ref|YP_290409.1|  glycine hydroxymethyltransferase...   315    1e-84   Gene info
gi|15902972|ref|NP_358522.1|  serine hydroxymethyltransferase ...   315    1e-84   Gene info
gi|15791769|ref|NP_281592.1|  serine hydroxymethyltransferase ...   315    1e-84   Gene info
gi|118067751|ref|ZP_01536006.1|  glycine hydroxymethyltransfer...   315    1e-84 
gi|89210690|ref|ZP_01189076.1|  Orn/Lys/Arg decarboxylase, maj...   315    1e-84 
gi|86159166|ref|YP_465951.1|  Glycine hydroxymethyltransferase...   315    2e-84   Gene info
gi|29346148|ref|NP_809651.1|  serine hydroxymethyltransferase ...   315    2e-84   Gene info
gi|91776269|ref|YP_546025.1|  Glycine hydroxymethyltransferase...   315    2e-84   Gene info
gi|116873904|ref|YP_850685.1|  serine hydroxymethyltransferase...   314    2e-84   Gene info
gi|83648600|ref|YP_437035.1|  Glycine/serine hydroxymethyltran...   314    2e-84   Gene info
gi|87301953|ref|ZP_01084787.1|  serine hydroxymethyltransferas...   314    2e-84 
gi|16804577|ref|NP_466062.1|  hypothetical protein lmo2539 [Li...   314    3e-84   Gene info
gi|47096961|ref|ZP_00234537.1|  serine hydroxymethyltransferas...   314    3e-84 
gi|116493075|ref|YP_804810.1|  Glycine/serine hydroxymethyltra...   314    3e-84   Gene info
gi|40534|emb|CAA37812.1|  unnamed protein product [Campylobacter    314    3e-84 
gi|111018817|ref|YP_701789.1|  glycine hydroxymethyltransferas...   313    4e-84   Gene info
gi|86151363|ref|ZP_01069578.1|  serine hydroxymethyltransferas...   313    4e-84 
gi|57237457|ref|YP_178470.1|  serine hydroxymethyltransferase ...   313    5e-84   Gene info
gi|91229389|ref|ZP_01262923.1|  serine hydroxymethyltransferas...   313    5e-84 
gi|53713493|ref|YP_099485.1|  serine hydroxymethyltransferase ...   313    6e-84   Gene info
gi|28897489|ref|NP_797094.1|  serine hydroxymethyltransferase ...   313    6e-84   Gene info
gi|24379519|ref|NP_721474.1|  serine hydroxymethyltransferase ...   313    6e-84   Gene info
gi|15640957|ref|NP_230588.1|  serine hydroxymethyltransferase ...   313    7e-84   Gene info
gi|56460972|ref|YP_156253.1|  Glycine/serine hydroxymethyltran...   313    8e-84   Gene info
gi|88796430|ref|ZP_01112101.1|  serine hydroxymethyltransferas...   312    8e-84 
gi|116333896|ref|YP_795423.1|  Glycine/serine hydroxymethyltra...   312    8e-84   Gene info
gi|87304710|ref|ZP_01086866.1|  serine hydroxymethyltransferas...   312    9e-84 
gi|115251778|emb|CAJ69613.1|  putative serine hydroxymethyltra...   312    9e-84 
gi|34556538|ref|NP_906353.1|  serine hydroxymethyltransferase ...   312    9e-84   Gene info
gi|88859174|ref|ZP_01133815.1|  serine hydroxymethyltransferas...   312    1e-83 
gi|42523483|ref|NP_968863.1|  serine hydroxymethyltransferase ...   311    1e-83   Gene info
gi|46908711|ref|YP_015100.1|  serine hydroxymethyltransferase ...   311    1e-83   Gene info
gi|75826255|ref|ZP_00755690.1|  COG0112: Glycine/serine hydrox...   311    1e-83 
gi|90573514|ref|ZP_01230027.1|  hypothetical protein CdifQ_020...   311    2e-83 
gi|27904762|ref|NP_777888.1|  serine hydroxymethyltransferase ...   311    2e-83   Gene info
gi|109691680|ref|ZP_01378747.1|  hypothetical protein Cjejd_01...   311    2e-83 
gi|15616900|ref|NP_240113.1|  serine hydroxymethyltransferase ...   311    2e-83   Gene info
gi|20092328|ref|NP_618403.1|  glycine hydroxymethyltransferase...   311    2e-83   Gene info
gi|116754542|ref|YP_843660.1|  Glycine hydroxymethyltransferas...   311    2e-83   Gene info
gi|116189617|ref|ZP_01479366.1|  hypothetical protein VchoM_02...   311    2e-83 
gi|15616327|ref|NP_244632.1|  serine hydroxymethyltransferase ...   311    2e-83   Gene info
gi|115377130|ref|ZP_01464344.1|  serine hydroxymethyltransfera...   311    2e-83 
gi|50122172|ref|YP_051339.1|  serine hydroxymethyltransferase ...   311    2e-83   Gene info
gi|77963401|ref|ZP_00827211.1|  COG0112: Glycine/serine hydrox...   311    3e-83 
gi|71894321|ref|YP_278429.1|  Serine hydroxymethyltransferase ...   311    3e-83   Gene info
gi|50364921|ref|YP_053346.1|  serine hydroxymethyl transferase...   310    3e-83   Gene info
gi|78357475|ref|YP_388924.1|  Glycine hydroxymethyltransferase...   310    3e-83   Gene info
gi|28274156|gb|AAO33831.1|  GlyA [Tannerella forsythensis]          310    4e-83 
gi|75816446|ref|ZP_00746916.1|  COG0112: Glycine/serine hydrox...   310    4e-83 
gi|37527171|ref|NP_930515.1|  serine hydroxymethyltransferase ...   310    4e-83   Gene info
gi|27363764|ref|NP_759292.1|  serine hydroxymethyltransferase ...   310    4e-83   Gene info
gi|77958563|ref|ZP_00822594.1|  COG0112: Glycine/serine hydrox...   310    4e-83 
gi|73669805|ref|YP_305820.1|  glycine hydroxymethyltransferase...   310    5e-83   Gene info
gi|57241809|ref|ZP_00369753.1|  serine hydroxymethyltransferas...   310    6e-83 
gi|16801744|ref|NP_472012.1|  glyA [Listeria innocua Clip11262...   310    6e-83   Gene info
gi|94968292|ref|YP_590340.1|  Glycine hydroxymethyltransferase...   310    6e-83   Gene info
gi|90579820|ref|ZP_01235628.1|  serine hydroxymethyltransferas...   309    8e-83 
gi|114773077|ref|ZP_01450361.1|  serine hydroxymethyltransfera...   309    1e-82 
gi|32474129|ref|NP_867123.1|  serine hydroxymethyltransferase ...   309    1e-82   Gene info
gi|56965621|ref|YP_177355.1|  serine hydroxymethyltransferase ...   309    1e-82   Gene info
gi|15607212|ref|NP_214584.1|  PROBABLE SERINE HYDROXYMETHYLTRA...   309    1e-82   Gene info
gi|97050644|sp|Q2KV15|GLYA_BORA1  Serine hydroxymethyltransfer...   308    1e-82 
gi|31791247|ref|NP_853740.1|  PROBABLE SERINE HYDROXYMETHYLTRA...   308    2e-82   Gene info
gi|113937379|ref|ZP_01423255.1|  Glycine hydroxymethyltransfer...   308    2e-82 
gi|87306949|ref|ZP_01089095.1|  serine hydroxymethyltransferas...   308    2e-82 
gi|42561412|ref|NP_975863.1|  glycine hydroxymethyltransferase...   307    3e-82   Gene info
gi|54307990|ref|YP_129010.1|  serine hydroxymethyltransferase ...   307    3e-82   Gene info
gi|13508315|ref|NP_110265.1|  serine hydroxymethyltransferase ...   307    3e-82   Gene info
gi|51893055|ref|YP_075746.1|  serine hydroxymethyltransferase ...   306    4e-82   Gene info
gi|89073127|ref|ZP_01159666.1|  serine hydroxymethyltransferas...   306    5e-82 
gi|85057818|ref|YP_456734.1|  serine hydroxymethyltransferase ...   306    5e-82   Gene info
gi|88945806|ref|ZP_01148970.1|  Glycine hydroxymethyltransfera...   306    5e-82 
gi|39938667|ref|NP_950433.1|  glycine hydroxymethyltransferase...   306    6e-82   Gene info
gi|86145386|ref|ZP_01063717.1|  Glycine/serine hydroxymethyltr...   306    6e-82 
gi|83319931|ref|YP_424070.1|  serine hydroxymethyltransferase ...   306    6e-82   Gene info
gi|16123098|ref|NP_406411.1|  serine hydroxymethyltransferase ...   306    6e-82   Gene info
gi|71893574|ref|YP_279020.1|  serine hydroxymethyltransferase ...   306    8e-82   Gene info
gi|54020057|ref|YP_115668.1|  serine hydroxymethyltransferase ...   306    8e-82   Gene info
gi|29654711|ref|NP_820403.1|  serine hydroxymethyltransferase ...   306    8e-82   Gene info
gi|117672869|ref|ZP_01495927.1|  hypothetical protein YpseI_02...   306    9e-82 
gi|85858031|ref|YP_460233.1|  serine hydroxymethyltransferase ...   305    1e-81   Gene info
gi|95927332|ref|ZP_01310091.1|  hypothetical protein CburR_010008   305    1e-81 
gi|57168541|ref|ZP_00367674.1|  serine hydroxymethyltransferas...   305    1e-81 
gi|94676948|ref|YP_588483.1|  serine hydroxymethyltransferase ...   305    2e-81   Gene info
gi|56808652|ref|ZP_00366377.1|  COG0112: Glycine/serine hydrox...   305    2e-81 
gi|94264509|ref|ZP_01288296.1|  Glycine hydroxymethyltransfera...   305    2e-81 
gi|108804485|ref|YP_644422.1|  Glycine hydroxymethyltransferas...   304    2e-81   Gene info
gi|58430471|dbj|BAD89029.1|  serine hydroxymethyltransferase [Nei   304    3e-81 
gi|116617899|ref|YP_818270.1|  Glycine/serine hydroxymethyltra...   303    4e-81   Gene info
gi|106890125|ref|ZP_01357321.1|  Glycine hydroxymethyltransfer...   303    4e-81 
gi|116672247|ref|YP_833180.1|  Glycine hydroxymethyltransferas...   303    5e-81   Gene info
gi|57506075|ref|ZP_00371998.1|  serine hydroxymethyltransferas...   303    5e-81 
gi|15675122|ref|NP_269296.1|  serine hydroxymethyltransferase ...   303    6e-81   Gene info
gi|118062464|ref|ZP_01530812.1|  Glycine hydroxymethyltransfer...   303    7e-81 
gi|108562605|ref|YP_626921.1|  serine hydroxymethyltransferase...   303    8e-81   Gene info
gi|15644812|ref|NP_206982.1|  serine hydroxymethyltransferase ...   302    8e-81   Gene info
gi|50914209|ref|YP_060181.1|  serine hydroxymethyltransferase ...   302    9e-81   Gene info
gi|90410894|ref|ZP_01218908.1|  serine hydroxymethyltransferas...   302    1e-80 
gi|71903506|ref|YP_280309.1|  serine hydroxymethyltransferase ...   302    1e-80   Gene info
gi|61213308|sp|Q5XC65|GLYA_STRP6  Serine hydroxymethyltransferase   302    1e-80 
gi|19746092|ref|NP_607228.1|  serine hydroxymethyltransferase ...   302    1e-80   Gene info


>gi|71083738|ref|YP_266458.1| Gene info glycine hydroxymethyltransferase [Candidatus Pelagibacter ubique 
HTCC1062]
 gi|97051133|sp|Q4FLT4|GLYA_PELUB Gene info Serine hydroxymethyltransferase (Serine methylase) (SHMT)
 gi|71062851|gb|AAZ21854.1| Gene info glycine hydroxymethyltransferase [Candidatus Pelagibacter ubique 
HTCC1062]
Length=436

 Score =  507 bits (1306),  Expect = 2e-142, Method: Composition-based stats.
 Identities = 241/270 (89%), Positives = 259/270 (95%), Gaps = 0/270 (0%)

Query  1    YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG  60
            YPGKRYYNGCEHVDVAE LA+ER+KK+F+CK+AN QPHSGAQANGAVFLALL P DTFMG
Sbjct  71   YPGKRYYNGCEHVDVAENLAIERLKKIFDCKFANAQPHSGAQANGAVFLALLNPGDTFMG  130

Query  61   MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY  120
            MSLNSGGHITHGLKISMSGKWFN I YDVDK+SELIDYDNVEKLALEHKPKLII GGSAY
Sbjct  131  MSLNSGGHITHGLKISMSGKWFNPIGYDVDKESELIDYDNVEKLALEHKPKLIICGGSAY  190

Query  121  SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG  180
            SRVI+FKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPC++AHVVTSTTHKVFRSARGG
Sbjct  191  SRVIDFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCEHAHVVTSTTHKVFRSARGG  250

Query  181  IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA  240
            IIL+N+EDL KKF+TAVFPGYQGGPLMH+IA KAAGF EAL+P+F+ YIK+VLANAKIL+
Sbjct  251  IILTNHEDLAKKFNTAVFPGYQGGPLMHVIAGKAAGFLEALRPDFKDYIKSVLANAKILS  310

Query  241  ETLKNNGFKIYSGGTDTHLMLVDLRPFNVK  270
            ETLKNNGFKIYSGGTDTHLMLVDLRPFNVK
Sbjct  311  ETLKNNGFKIYSGGTDTHLMLVDLRPFNVK  340


>gi|91763226|ref|ZP_01265190.1|  glycine hydroxymethyltransferase [Candidatus Pelagibacter ubique 
HTCC1002]
 gi|91717639|gb|EAS84290.1|  glycine hydroxymethyltransferase [Candidatus Pelagibacter ubique 
HTCC1002]
Length=436

 Score =  506 bits (1303),  Expect = 4e-142, Method: Composition-based stats.
 Identities = 241/270 (89%), Positives = 258/270 (95%), Gaps = 0/270 (0%)

Query  1    YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG  60
            YPGKRYYNGCEHVDVAE LA+ER+KK+F+CK+AN QPHSGAQANGAVFLALL P DTFMG
Sbjct  71   YPGKRYYNGCEHVDVAENLAIERLKKIFDCKFANAQPHSGAQANGAVFLALLNPGDTFMG  130

Query  61   MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY  120
            MSLNSGGHITHGLKISMSGKWFN I YDVDK+SELIDYDNVEKLALEHKPKLII GGSAY
Sbjct  131  MSLNSGGHITHGLKISMSGKWFNPIGYDVDKESELIDYDNVEKLALEHKPKLIICGGSAY  190

Query  121  SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG  180
            SRVI+FKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPC++AHVVTSTTHKVFRSARGG
Sbjct  191  SRVIDFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCEHAHVVTSTTHKVFRSARGG  250

Query  181  IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA  240
            IIL+N EDL KKF+TAVFPGYQGGPLMH+IA KAAGF EAL+P+F+ YIK+VLANAKIL+
Sbjct  251  IILTNYEDLAKKFNTAVFPGYQGGPLMHVIAGKAAGFLEALRPDFKDYIKSVLANAKILS  310

Query  241  ETLKNNGFKIYSGGTDTHLMLVDLRPFNVK  270
            ETLKNNGFKIYSGGTDTHLMLVDLRPFNVK
Sbjct  311  ETLKNNGFKIYSGGTDTHLMLVDLRPFNVK  340


>gi|91218939|ref|ZP_01255761.1|  glycine hydroxymethyltransferase [Psychroflexus torquis ATCC 
700755]
 gi|91182910|gb|EAS69431.1|  glycine hydroxymethyltransferase [Psychroflexus torquis ATCC 
700755]
Length=356

 Score =  415 bits (1067),  Expect = 9e-115, Method: Composition-based stats.
 Identities = 199/269 (73%), Positives = 229/269 (85%), Gaps = 0/269 (0%)

Query  1    YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG  60
            YP KRYY GCEHVDV+E LA+ER KKLF+CK+ANVQPHSGAQANGAV+LALLKP DT + 
Sbjct  69   YPSKRYYGGCEHVDVSENLAIERAKKLFDCKFANVQPHSGAQANGAVYLALLKPGDTTLA  128

Query  61   MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY  120
            MSLNSGGH+THG K + SGKWFNA+ Y+VDKK+ LIDYD VE+LA E+KPKLIIAGGSAY
Sbjct  129  MSLNSGGHLTHGAKPAQSGKWFNALHYEVDKKTGLIDYDAVERLATENKPKLIIAGGSAY  188

Query  121  SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG  180
            SRVI+FK+FREI DKVGAYL+VDMAH SGLVAG  YPNP  YA VVTSTTHKV R  RGG
Sbjct  189  SRVIDFKKFREICDKVGAYLLVDMAHLSGLVAGGAYPNPTKYADVVTSTTHKVLRGPRGG  248

Query  181  IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA  240
            IIL+NNE+L KKF++A+FPG QGGPLMH+IAAKA  F EAL  +F+ Y KNV+ NAK+L+
Sbjct  249  IILTNNEELAKKFNSAIFPGLQGGPLMHVIAAKAVCFKEALSDDFKIYTKNVIKNAKVLS  308

Query  241  ETLKNNGFKIYSGGTDTHLMLVDLRPFNV  269
            + L   GFKI+SGGTDTHLML+DLR F V
Sbjct  309  DRLSKKGFKIFSGGTDTHLMLLDLRSFKV  337


>gi|110633487|ref|YP_673695.1| Gene info glycine hydroxymethyltransferase [Mesorhizobium sp. BNC1]
 gi|110284471|gb|ABG62530.1| Gene info glycine hydroxymethyltransferase [Mesorhizobium sp. BNC1]
Length=437

 Score =  393 bits (1010),  Expect = 4e-108, Method: Composition-based stats.
 Identities = 178/268 (66%), Positives = 219/268 (81%), Gaps = 0/268 (0%)

Query  1    YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG  60
            YPGKRYY GC+ VDV E+LA++R KKLFNC++ANVQPHSG+Q N AVFLALL+P DTFMG
Sbjct  70   YPGKRYYGGCQFVDVVEQLAIDRAKKLFNCQFANVQPHSGSQMNQAVFLALLQPGDTFMG  129

Query  61   MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY  120
            + LNSGGH+THG  ++MSGKWFN +SY V +   L+D D VE+LA EHKPKLI+AGG+AY
Sbjct  130  LDLNSGGHLTHGSPVNMSGKWFNVVSYGVRRDDNLLDMDEVERLATEHKPKLILAGGTAY  189

Query  121  SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG  180
            SR+ ++KRFREIAD VGAYLMVDMAH +GLVAG  +P+P  +AHVVT+TTHK  R  RGG
Sbjct  190  SRIWDWKRFREIADSVGAYLMVDMAHIAGLVAGGAHPSPLPHAHVVTTTTHKSLRGPRGG  249

Query  181  IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA  240
            ++L+N+ED+ KK ++AVFPG QGGPLMH+IAAKA    EAL+PEF+ Y   V+ANA+ LA
Sbjct  250  MVLTNDEDIAKKVNSAVFPGLQGGPLMHVIAAKAVALGEALQPEFKAYAHQVVANARALA  309

Query  241  ETLKNNGFKIYSGGTDTHLMLVDLRPFN  268
             +L+  G +I SGGTD HLMLVDLRP N
Sbjct  310  ASLQETGLEIVSGGTDNHLMLVDLRPKN  337


>gi|114704834|ref|ZP_01437742.1|  serine hydroxymethyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114539619|gb|EAU42739.1|  serine hydroxymethyltransferase [Fulvimarina pelagi HTCC2506]
Length=436

 Score =  388 bits (997),  Expect = 1e-106, Method: Composition-based stats.
 Identities = 178/269 (66%), Positives = 221/269 (82%), Gaps = 0/269 (0%)

Query  1    YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG  60
            YPG+RYY GC++VD+ E+LA+ER+ KLF C +ANVQP+SG+QAN +VFLAL+KP DT +G
Sbjct  71   YPGRRYYGGCQYVDIVEELAIERVTKLFGCNFANVQPNSGSQANQSVFLALIKPGDTILG  130

Query  61   MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY  120
            MSL++GGH+THG K +MSGKWFNA+ Y +D ++ LIDYD +EKLA EHKPKLII GGSAY
Sbjct  131  MSLDAGGHLTHGAKPNMSGKWFNAVQYGLDLETGLIDYDALEKLADEHKPKLIIGGGSAY  190

Query  121  SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG  180
            SR ++FKR REIADKVGAY MVDMAHF+GLVA   +P+P  +AHV TSTTHK  R  RGG
Sbjct  191  SRQVDFKRMREIADKVGAYFMVDMAHFAGLVAAGVHPSPFPHAHVATSTTHKTLRGPRGG  250

Query  181  IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA  240
            I+L+N+ED+ KK ++AVFPG QGGPLMH+IA KA  F EAL  EF++Y ++V  NAK+LA
Sbjct  251  IVLTNDEDIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDEFKSYQRSVCENAKVLA  310

Query  241  ETLKNNGFKIYSGGTDTHLMLVDLRPFNV  269
            ETL+  G  I SGGTDTHLMLVDLRP ++
Sbjct  311  ETLRAGGCDIVSGGTDTHLMLVDLRPMDL  339


>gi|62289717|ref|YP_221510.1| Gene info serine hydroxymethyltransferase [Brucella abortus biovar 1 str. 
9-941]
 gi|82699646|ref|YP_414220.1| Gene info Glycine hydroxymethyltransferase [Brucella melitensis biovar 
Abortus 2308]
 gi|75497002|sp|Q57DY5|GLYA_BRUAB  Serine hydroxymethyltransferase (Serine methylase) (SHMT)
 gi|97050656|sp|Q2YN95|GLYA_BRUA2 Gene info Serine hydroxymethyltransferase (Serine methylase) (SHMT)
 gi|62195849|gb|AAX74149.1| Gene info GlyA, serine hydroxymethyltransferase [Brucella abortus biovar 
1 str. 9-941]
 gi|82615747|emb|CAJ10743.1| Gene info Glycine hydroxymethyltransferase [Brucella abortus]
Length=438

 Score =  380 bits (975),  Expect = 5e-104, Method: Composition-based stats.
 Identities = 178/268 (66%), Positives = 218/268 (81%), Gaps = 0/268 (0%)

Query  1    YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG  60
            YPGKRYY GC++VDV E+LA+ER KKLF  ++ANVQP+SG+Q N AVFLALL+P DTFMG
Sbjct  71   YPGKRYYGGCQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMG  130

Query  61   MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY  120
            + LNSGGH+THG  ++MSGKWFN +SY V K   L+D D V +LA E+KPKLI+AGG+AY
Sbjct  131  LDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAY  190

Query  121  SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG  180
            SR+ ++KRFREIAD+VGAYLMVDMAH +GLVAG  +P+P  +AHV T+TTHK  R  RGG
Sbjct  191  SRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGG  250

Query  181  IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA  240
            +IL+N+ D+ KK ++AVFPG QGGPLMH+IA KA  F EALKPEF+ Y KNV+ NA+ LA
Sbjct  251  MILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALA  310

Query  241  ETLKNNGFKIYSGGTDTHLMLVDLRPFN  268
            E LK++G  I SGGTD HLMLVDLRP N
Sbjct  311  EELKSHGLDIVSGGTDNHLMLVDLRPKN  338

ORF finding

nous avons choisi l'option any codon

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends
 from base 2 to base 814.
TATCCAGGAAAAAGATATTATAATGGTTGTGAACATGTTGACGTGGCTGAAAAATTAGCA
CTGGAGAGAATTAAAAAACTTTTTAATTGTAAATATGCCAATGTTCAACCTCATTCAGGT
GCACAAGCAAATGGAGCAGTGTTTTTAGCGCTACTTAAACCGAACGATACATTTATGGGT
ATGAGCTTAAATTCTGGTGGTCATATAACACATGGTCTTAAAATATCTATGTCTGGGAAA
TGGTTTAATGCAATAAGCTATGATGTTGATAAAAAATCTGAATTAATTGATTACGATAAT
GTTGAAAAATTAGCTTTAGAACACAAACCAAAATTAATCATCGCTGGTGGAAGTGCTTAT
TCAAGAGTTATTAATTTTAAAAGATTTAGAGAAATTGCAGATAAAGTTGGAGCATATTTA
ATGGTTGATATGGCACATTTCTCAGGATTAGTTGCAGGTAAAGGATATCCAAACCCGTGT
GATTATGCGCATGTTGTAACTTCAACTACGCATAAAGTTTTTAGAAGTGCCAGAGGTGGT
ATAATCTTATCTAACAATGAAGACCTAGGAAAAAAATTTGATACAGCTGTTTTTCCTGGT
TATCAAGGTGGACCTTTAATGCATATTATTGCAGCTAAAGCAGCAGGTTTTTATGAGGCA
CTAAAGCCAGAGTTTCAGACATATATTAAAAACGTTTTAGCAAATGCAAAAATATTGGCT
GAAACTTTAAAAAATAATGGCTTTAAAATTTATTCAGGTGGAACAGATACTCATTTAATG
TTAGTGGATTTAAGACCTTTTAATGTGAAAGGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
YPGKRYYNGCEHVDVAEKLALERIKKLFNCKYANVQPHSGAQANGAVFLALLKPNDTFMG
MSLNSGGHITHGLKISMSGKWFNAISYDVDKKSELIDYDNVEKLALEHKPKLIIAGGSAY
SRVINFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCDYAHVVTSTTHKVFRSARGG
IILSNNEDLGKKFDTAVFPGYQGGPLMHIIAAKAAGFYEALKPEFQTYIKNVLANAKILA
ETLKNNGFKIYSGGTDTHLMLVDLRPFNVKG

No ORFs were found in reading frame 3.




No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.