ORF HF17370

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160052.1
Annotathon code: ORF_HF17370
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : madi
Annotated on : 2008-03-19 18:52:37
  • Beylard Emmanuelle
  • CATTENOZ diane

Synopsis

Genomic Sequence

>AACY01160052.1 ORF_HF17370 genomic DNA
CTGCGAGGATGCACACGCGCTCTCAATAGCTGGATAGCATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTCTGTCTTCTGCG
GCACTGGAATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGACAGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCA
CCTCGCCTGCAGCCGGGCCATGACCAGCTGGCAACAGAACGCGGGCGTCAACAGCACCCAGCAAAAGATCTCGGCCGTGCTTGTCTCGTTTTCGCCGGAC
GGCCGCAAGGCACGCCGCGCTCTCAACAGTTGGCTGAGCCTCAAGAGGCAACGTTCCGGCGTCGTGCGTGCAGTGACGGCTTGGACACGTTGGAGCGAGC
GCCGCAGCTTCAACGCGTGGACCGCGAGCATTGCGGCCCGTGCGCTTGCGCGCCTGGCGATGAAGCGCGGGGCCGTCTCGCTCTTCCACTACGGCCGCGA
GACCCGCCGGGCGCTCAATTCGTGGGTCGAGATGGCGCAGGAATGGTCGCTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTCTTCCCGAAGGGT
CGGGCGAAGCGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCTGAATGCCGTGACGTCCATGTCAGCGGAGGGCCGTGCCG
TGCGCAAAGCCCTCAACTCGTGGGCAGTCTTCTTGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCATCACGGCGAGCGTGCGGGTTT
CAACGCGTGGATCGCTGCCGCTAAGGAGCACGCGGGCGTGCAGCGGAAGATGCAGCGG

Translation

[1 - 858/858]   direct strand
>ORF_HF17370 Translation [1-858   direct strand]
LRGCTRALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPD
GRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKG
RAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALNSWAVFLRQRFVQVKSLRALVHHGERAGFNAWIAAAKEHAGVQRKMQR

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny


Annotator commentaries

Concernant le Blast :

En prenant l'ORF le plus long, nous avons commencé par faire un Blast p vs Swissprot : le peu de résultats obtenu nous a conduit à faire un Blast p vs NR, inutilisable,car les E-values n'étaient pas du tout significatives ( supérieures à 0.30).

Ceci nous a conduit à soumettre notre séquence génomique à un blast x vs NR qui fait une analyse dans les 6 phases, mais malheureusement il ne nous a pas plus renseigné (les E-values étaient toutes majoritairement supérieures à 0.40).

De ce fait, nous avons cherché s'il existait des domaines protéiques pour toutes nos traductions d'ORF. Les résultats obtenus ne sont pas significatifs : nous n'avons trouvé aucun domaine fonctionnel -mais nous avons 3 domaines structuraux: peptide signal (signal d'adressage aux membranes le plus souvent). -nous avons 11 domaines "no hits reported",c'est-à-dire des domaines pour lesquels il n'existe aucun domaine protéique homologue dans les banques à ce jour, et 2 domaines "unintegrated", signifiant que ces domaines sont en cours d'identification et donc aucun lien n'existe actuellement dans la banque.

Ces résultats nous conduisent à 2 hypothèses discutables: -soit notre séquence est codante mais il n'existe aucune homologie dans le monde du vivant séquencé aujourd'hui. -soit notre séquence est non codante c'est-à-dire qu'elle correspondrait à une région intergénique.


Ainsi nous considérons ces 2 hypothèses comme équivalentes au regard de l'état actuel du séquençage du monde vivant. Nous avons coché la case "codant" pour faire apparaitre la protéine à l'écran, dans l'hypothèse d'un éventuel futur séquençage d'un gène homologue.


Multiple Alignement


BLAST

Blast x vs NR :


Sequences producing significant alignements:                        (Bits)  Value

gi|111019055|ref|YP_702027.1|  hypothetical protein RHA1_ro020...  38.5    0.40   Gene info
gi|74025540|ref|XP_829336.1|  hypothetical protein Tb11.01.459...  37.7    0.69   Gene info
gi|116055714|emb|CAL57799.1|  unnamed protein product [Ostreococc  37.4    0.90 
gi|73956822|ref|XP_850317.1|  PREDICTED: similar to Period cir...  37.4    0.90   UniGene infoGene info
gi|69284641|ref|ZP_00616439.1|  hypothetical protein KradDRAFT...  37.0    1.2  
gi|67516265|ref|XP_658018.1|  hypothetical protein AN0414.2 [A...  36.6    1.5    Gene info
gi|118175189|gb|ABK76085.1|  secreted protein [Mycobacterium smeg  36.2    2.0  
gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococc  36.2    2.0  
gi|115605783|gb|ABJ15868.1|  gamete-specific protein minus 1 [Chl  36.2    2.0  
gi|51894119|ref|YP_076810.1|  hypothetical protein, proline-ri...  36.2    2.0    Gene info
gi|116670139|ref|YP_831072.1|  DivIVA family protein [Arthroba...  36.2    2.0    Gene info
gi|86156673|ref|YP_463458.1|  LigA [Anaeromyxobacter dehalogen...  35.8    2.6    Gene info
gi|67546299|ref|ZP_00424214.1|  Cobalamin (vitamin B12) biosyn...  35.8    2.6  
gi|115377591|ref|ZP_01464788.1|  hypothetical protein STIAU_45...  35.4    3.4  
gi|109093898|ref|XP_001111018.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093900|ref|XP_001111086.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093896|ref|XP_001111056.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093892|ref|XP_001111206.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093894|ref|XP_001110984.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|109093890|ref|XP_001111164.1|  PREDICTED: similar to spindl...  35.4    3.4    Gene info
gi|67548232|ref|ZP_00426124.1|  Oxidoreductase, molybdopterin ...  35.4    3.4  
gi|92911148|ref|ZP_01279922.1|  hypothetical protein MjlsDRAFT...  35.0    4.5  
gi|34533498|dbj|BAC86720.1|  unnamed protein product [Homo sapien  35.0    4.5    UniGene info
gi|76818916|ref|YP_335795.1|  hypothetical protein BURPS1710b_...  35.0    4.5    Gene info
gi|76809242|ref|YP_332102.1|  hypothetical protein BURPS1710b_...  35.0    4.5    Gene info
gi|52075896|dbj|BAD45842.1|  splicing coactivator subunit-like...  35.0    4.5  
gi|89339746|ref|ZP_01192344.1|  Enoyl-CoA hydratase/isomerase ...  35.0    4.5  
gi|94389870|ref|XP_911516.2|  PREDICTED: Sfi1 homolog, spindle...  34.7    5.8    UniGene infoGene info
gi|90203202|ref|ZP_01205848.1|  Enoyl-CoA hydratase/isomerase ...  34.7    5.8  
gi|56238586|emb|CAI26157.1|  novel protein [Mus musculus] >gi|...  34.7    5.8    Gene info
gi|86605038|ref|YP_473801.1|  phytoene synthase [Synechococcus...  34.7    5.8    Gene info
gi|32189776|ref|NP_859506.1|  hypothetical protein LMJ_0239 [L...  34.7    5.8    Gene info
gi|74225816|dbj|BAE21725.1|  unnamed protein product [Mus musculu  34.7    5.8    UniGene infoGene info
gi|34393970|dbj|BAC83818.1|  Epstein-Barr virus EBNA-1-like pr...  34.7    5.8    Gene info
gi|89338824|ref|ZP_01191589.1|  Beta-lactamase-like [Mycobacte...  34.7    5.8  
gi|71665330|ref|XP_819636.1|  hypothetical protein [Trypanosom...  34.7    5.8    Gene info
gi|67917748|ref|ZP_00511352.1|  exonuclease SbcC [Chlorobium l...  34.7    5.8  
gi|67158044|ref|ZP_00419134.1|  Carbamoyltransferase [Azotobac...  34.7    5.8  
gi|55956784|ref|NP_055590.2|  spindle assembly associated Sfi1...  34.3    7.6    UniGene infoGene info
gi|6273397|gb|AAF06353.1|AF199413_1  thymidine kinase [Pseudorabi  34.3    7.6  
gi|83405158|gb|AAI10815.1|  SFI1 protein [Homo sapiens]            34.3    7.6    UniGene infoGene info
gi|76665259|ref|XP_872957.1|  PREDICTED: similar to storkhead box  34.3    7.6    Gene info
gi|55956786|ref|NP_001007468.1|  spindle assembly associated S...  34.3    7.6    UniGene infoGene info
gi|6635201|dbj|BAA25468.2|  KIAA0542 protein [Homo sapiens]        34.3    7.6    UniGene infoGene info
gi|83372689|ref|ZP_00917469.1|  Phosphoribosylglycinamide form...  34.3    7.6  
gi|118163605|gb|ABK64502.1|  caax amino protease family protein [  33.9    9.9  
gi|116130892|gb|EAA06516.4|  ENSANGP00000004748 [Anopheles gambia  33.9    9.9  
gi|114848442|ref|ZP_01458742.1|  conserved hypothetical protei...  33.9    9.9  
gi|115435730|ref|NP_001042623.1|  Os01g0255700 [Oryza sativa (...  33.9    9.9    Gene info
gi|86609155|ref|YP_477917.1|  phytoene synthase [Synechococcus...  33.9    9.9    Gene info
gi|76809236|ref|YP_334181.1|  4'-phosphopantetheinyl transfera...  33.9    9.9    Gene info
gi|46581446|ref|YP_012254.1|  hypothetical protein DVU3043 [De...  33.9    9.9    Gene info
gi|51892660|ref|YP_075351.1|  translation initiation factor IF...  33.9    9.9    Gene info
gi|115446397|ref|NP_001046978.1|  Os02g0521800 [Oryza sativa (...  33.9    9.9    Gene info
gi|15610961|ref|NP_218342.1|  PROBABLE POLYKETIDE SYNTHASE PKS...  33.9    9.9    Gene info
gi|88940687|ref|ZP_01146121.1|  Aerobic-type carbon monoxide d...  33.9    9.9  
gi|83749467|ref|ZP_00946458.1|  Hypothetical Protein RRSL_0085...  33.9    9.9  
gi|81252692|ref|ZP_00877271.1|  COG3321: Polyketide synthase m...  33.9    9.9  
gi|76782427|ref|ZP_00769632.1|  COG3321: Polyketide synthase m...  33.9    9.9  



>gi|111019055|ref|YP_702027.1| Gene info hypothetical protein RHA1_ro02062 [Rhodococcus sp. RHA1]
 gi|110818585|gb|ABG93869.1| Gene info conserved hypothetical protein [Rhodococcus sp. RHA1]
Length=497

 Score = 38.5 bits (88),  Expect = 0.40
 Identities = 49/162 (30%), Positives = 62/162 (38%), Gaps = 33/162 (20%)
 Frame = -1

Query  528  DPRIERPAGLAAVVEERDG----PALHRQARKRTGR---NARGPRVEAAALAPTC----P  382
            DP   RP+   AV   R G    PAL R+ R+R GR     R PR   A + P      P
Sbjct  72   DPPARRPSRRLAVRGARRGHRATPALPRRRRRRRGRVPAGTRSPRQARAGVRPAVRRGRP  131

Query  381  SRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKH---------GRDLLLGAVDARVLLP  229
            +R C   A                 A  R +RD+H         GRD L GA    +   
Sbjct  132  ARTCARGARRGRHPDDRGAARRLRSARARDRRDRHRAHAHRIGRGRDPLRGARHRHL---  188

Query  228  AGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGTAHSS  103
                  AG+ +D     A AR+   R  A  +P   G+A SS
Sbjct  189  -----RAGDRRD-----APARTPGRRAEAPPEPRRTGSAVSS  220


>gi|74025540|ref|XP_829336.1| Gene info hypothetical protein Tb11.01.4590 [Trypanosoma brucei TREU927]
 gi|70834722|gb|EAN80224.1| Gene info hypothetical protein, conserved [Trypanosoma brucei]
Length=349

 Score = 37.7 bits (86),  Expect = 0.69
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 11/103 (10%)
 Frame = +1

Query  109  MRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVS  288
            +RR  SS      S R+ RA  RS+ G+   +   R++       G +S  ++  AV+ S
Sbjct  130  LRRLQSSASGKSVSRRRSRAT-RSLAGKEEDIGDDRSLV------GFDSVPRRYDAVVPS  182

Query  289  FS-PDGRKARRALNSW---LSLKRQRSGVVRAVTAWTRWSERR  405
             + PD   A  A  SW   L     RSG +R VTAW    ER+
Sbjct  183  GNVPDAVSAAAASKSWKMNLVANLTRSGTLRGVTAWNERCERQ  225


>gi|116055714|emb|CAL57799.1|  unnamed protein product [Ostreococcus tauri]
Length=1315

 Score = 37.4 bits (85),  Expect = 0.90
 Identities = 65/313 (20%), Positives = 110/313 (35%), Gaps = 44/313 (14%)
 Frame = +1

Query  13   TRALNSWIAYNKEAA---LQLRRLRKGLSVFCGTG----MRRAFSSWLAMRASSRQLRAC  171
            +R+ N+W A   EA    + LR++ K +++         +RR F  W    ASS   R  
Sbjct  624  SRSFNAWRAATGEAINAKINLRKMEKIINLQAKYAAKERLRRVFVIWRDHAASSCHQRQM  683

Query  172  LRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQ  351
                +  + +   + A   W+++      QQ+     ++        R A ++W      
Sbjct  684  AAKTIASMRNRVLTSAFERWRESTK-EYAQQRRMLTHIAQKMQRNSLRLAFDTW------  736

Query  352  RSGVVRAVTAWTRWSERRSFNAWTASIaaralarlaMKRGAVSLFHYGRETRRALNSWVE  531
               VV             +FN W   +  +      + R         R  R   ++WV 
Sbjct  737  --AVVAHDAXXXXXXXFTAFNTWHEQVCTKKRYHAIIARFYERF--RDRSLRGTFSTWVA  792

Query  532  MAQEWSLK-------QRLLQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNA--VTSMS  684
            + +E           ++L +  L  L   G A RR +    +  + R+    A  V  + 
Sbjct  793  VTREAKEHRLAIINGEKLRENKLAQLI--GSASRRTMGYAFMEWRDRVRENKAIKVNEIK  850

Query  685  AEGRAVRKALNS-------WAVFLRQRFVQVKSLRALVHHGER----AGFNAWIAAAK--  825
            A+   VR  + S       W  F+  R   V+  R  V   ER    A F  W+   K  
Sbjct  851  ADRMVVRSRMRSLSRTFDQWLSFVHLRRRTVEMARIFVKRAERAHLAAAFGGWLDVVKVR  910

Query  826  --EHAGVQRKMQR  858
                A V + +QR
Sbjct  911  KRNRALVTKSLQR  923


>gi|73956822|ref|XP_850317.1| UniGene infoGene info PREDICTED: similar to Period circadian protein 3 (hPER3) [Canis 
familiaris]
Length=1128

 Score = 37.4 bits (85),  Expect = 0.90
 Identities = 33/104 (31%), Positives = 43/104 (41%), Gaps = 12/104 (11%)
 Frame = -1

Query  474  GPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVR  295
            G +   +A   + R + GPR EAA  APT   R C        L  Q  +ESAA      
Sbjct  442  GDSQEPRASLASSRESGGPRGEAARRAPTALQRVCASVNKMKKLGGQLHIESAAA-----  496

Query  294  RKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARS  163
            R  DKH     +G   AR   P G   A+  +Q   +N+    S
Sbjct  497  RSPDKHA----MGTHPAR---PGGEQKASSPLQTLKNNSVHMES  533


>gi|69284641|ref|ZP_00616439.1|  hypothetical protein KradDRAFT_2999 [Kineococcus radiotolerans 
SRS30216]
 gi|67988088|gb|EAM75871.1|  hypothetical protein KradDRAFT_2999 [Kineococcus radiotolerans 
SRS30216]
Length=301

 Score = 37.0 bits (84),  Expect = 1.2
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 5/99 (5%)
 Frame = +2

Query  218  P*PAGNRTRASTAPSKRSRPCLS--RFRRTAARHAALSTVG*ASRGNVPASCVQ*RLGHV  391
            P PA    R  T+PSKR+    S   +RR A+R  ++  V   S G+ PA          
Sbjct  15   PGPAATWRRVQTSPSKRASTAASMPSWRRAASRSRSMRRV---SSGSPPAPSAPSAPNAT  71

Query  392  GASAAASTRGPRALRPVRLRAWR*SAGPSRSSTTAARPA  508
            G S+     G R         W  +A  +R++ +A+R A
Sbjct  72   GGSSRGPAGGVRGCAAAARARWARAARSTRAAASASRQA  110


>gi|67516265|ref|XP_658018.1| Gene info hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
 gi|40747357|gb|EAA66513.1| Gene info hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
Length=981

 Score = 36.6 bits (83),  Expect = 1.5
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)
 Frame = +1

Query  58   LQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQ  237
            L+ RRLR+ L      GM+R F         S  LRA L +V GRI+ LA + A ++ + 
Sbjct  457  LKERRLRQDL------GMKRKFIDIWVQTYDSNALRAALEAVTGRIIPLAKANASSTHKS  510

Query  238  NAGVNSTQQKISAVLVSF  291
              G +  ++ ++  L  F
Sbjct  511  ANGASPHEKALTKKLAKF  528


>gi|118175189|gb|ABK76085.1|  secreted protein [Mycobacterium smegmatis str. MC2 155]
Length=433

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 29/78 (37%), Positives = 36/78 (46%), Gaps = 12/78 (15%)
 Frame = -1

Query  474  GPALHRQARKRTGRNARGPRVEAAALAP---------TCPSRHCTHDAGTLPLEA-QPTV  325
            G A  + AR R GR  R P V AAALAP         + P  H + DA   PL A QP +
Sbjct  5    GGAAIQAARHRAGRFMRTPMVGAAALAPLILAGAVGASAPPHHGSSDAAVTPLAAVQPQI  64

Query  324  --ESAACLAAVRRKRDKH  277
              +  A +AA +     H
Sbjct  65   DHDGPAVVAAAKAPTKFH  82


>gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococcus tauri]
Length=340

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 47/222 (21%), Positives = 91/222 (40%), Gaps = 20/222 (9%)
 Frame = +1

Query  1    LRGCTRALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRS  180
            L  C    ++ ++  K  ++ L R+   L++     + R+++ W     + ++    L  
Sbjct  97   LAACFYQWSNLMSEKKRRSVLLERMALRLNMRL---LVRSWNKWGEYVVNEKRRNNVLGK  153

Query  181  VVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSW----LSLKR  348
            V  RI +   + A T W++ A   S   K+    +       +  +AL  W    +  +R
Sbjct  154  VYSRIRNTELANAFTRWREFA-EESYDAKMQLRKIVSRMLRLRLSQALGRWRENTIESQR  212

Query  349  QRSGVVRAVTAWTRWSERRSFNAW--TASIaaralarlaMKRGAVS--LFHYGRET-RRA  513
            QR+ + R  T        + FNAW  T +         A ++  V+       R T R A
Sbjct  213  QRALLARVATRIRNRCVAQCFNAWCDTVNDNKIEAQASAYRQRLVNNLCLRINRATLREA  272

Query  514  LNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
               W  + +E  + + ++++ L       RAKR A+N ++ W
Sbjct  273  FKKWWRVVEEREMHREMIRKVL-------RAKRVAMNFFMTW  307


>gi|115605783|gb|ABJ15868.1|  gamete-specific protein minus 1 [Chlamydomonas incerta]
Length=892

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 37/112 (33%), Positives = 46/112 (41%), Gaps = 5/112 (4%)
 Frame = -1

Query  498  AAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHD---AGTLPLEAQPT  328
            AAVV   +G A      KR GR A GP   AAAL+    S +   D   A  + + A  +
Sbjct  588  AAVVAVGEGKAAAAATAKRGGRGATGPEAAAAALSALGGSGNSELDEAMATYVRVAAVYS  647

Query  327  VESAACLAAVRRKRDKHGRDLLLG--AVDARVLLPAGHGPAAGEVQDAADNA  178
             E+AA +A            L LG  A    V  PA +G   G V   A  A
Sbjct  648  DEAAAAVAECESLMQDFDDKLQLGNLATTFAVATPAANGRPRGGVNGGATRA  699


>gi|51894119|ref|YP_076810.1| Gene info hypothetical protein, proline-rich [Symbiobacterium thermophilum 
IAM 14863]
 gi|51857808|dbj|BAD41966.1| Gene info hypothetical protein, proline-rich [Symbiobacterium thermophilum 
IAM 14863]
Length=247

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 45/146 (30%), Positives = 56/146 (38%), Gaps = 9/146 (6%)
 Frame = -1

Query  531  LDPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGT  352
            +D R+ R   LAA +E R    +  +AR R      G + +A A     P      DAG 
Sbjct  56   IDQRMARLNDLAAQLEIRAVAEVQAKARSRA---KSGTQPQADAPPDGRPPAPAPPDAGD  112

Query  351  LPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQ  172
                 QP  E A  + A ++K  K GR    GA    V      GPAAG  Q      A 
Sbjct  113  QEAP-QPQPERAPEVEAAQQK-PKRGRRSRAGAGSTAV----PSGPAAGSQQAGGSRQAA  166

Query  171  ARSQLSRGRAHRQPAAEGTAHSSAAE  94
               Q +      QPA    A  S AE
Sbjct  167  DSGQFASPGQPSQPAEAPPAEPSPAE  192


>gi|116670139|ref|YP_831072.1| Gene info DivIVA family protein [Arthrobacter sp. FB24]
 gi|116610248|gb|ABK02972.1| Gene info DivIVA family protein [Arthrobacter sp. FB24]
Length=232

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 33/123 (26%), Positives = 46/123 (37%), Gaps = 4/123 (3%)
 Frame = -1

Query  507  AGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPT  328
            A  A VVE+   P    +   R    A     EA   AP   +      A   P    PT
Sbjct  64   AAAAPVVEKVPAPVKAEKDESRAKAEAEAKAAEAKKKAPEPATALAPVPAAAAPAAVNPT  123

Query  327  VESAA-CLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARSQLSR  151
             ESAA  LA  ++  DKH  D   G      ++      A+  V DA + + +    L +
Sbjct  124  AESAAGLLAMAQQMHDKHVAD---GQQQKDKIIAEAQIEASSLVNDAQEKSRKILGALEQ  180

Query  150  GRA  142
             R+
Sbjct  181  QRS  183


>gi|86156673|ref|YP_463458.1| Gene info LigA [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773184|gb|ABC80021.1| Gene info LigA [Anaeromyxobacter dehalogenans 2CP-C]
Length=808

 Score = 35.8 bits (81),  Expect = 2.6
 Identities = 50/163 (30%), Positives = 60/163 (36%), Gaps = 26/163 (15%)
 Frame = -1

Query  537  RHLDPRIERPAGLAAVVEERDGPALH-RQARKRTGRNARGPRVEAAA--LAPTCPSRHCT  367
            R   P   RP G A       G A   R  R+R GR  RGP   A    + P    R   
Sbjct  210  RRARPARARPRGRARPRRRARGAAGRGRPGRRRAGRAPRGPPAPAGGERVHPPLALRGAE  269

Query  366  HDAGTLPLEAQPTVESAACLAAVRRK-------RDKHGRDLLLGAVDARVLLPAGHGPAA  208
             D      +A   V  A    A RR+       R + GR    G   AR    AGHG   
Sbjct  270  RD------DAAAGVRRAGDRGADRRRRGGARAARGRAGR----GGGGAR----AGHGRGG  315

Query  207  GEVQDAADNAAQARSQLSRGRAH-RQPAAEGTAHSSAAEDRKA  82
            G  +  A  A   R++  RGR   R  A  G A + A   R+A
Sbjct  316  GRPRRRARRAG-GRARAGRGRRRARAGAGRGRARAGAGRGRRA  357


>gi|67546299|ref|ZP_00424214.1|  Cobalamin (vitamin B12) biosynthesis CbiD protein [Burkholderia 
vietnamiensis G4]
 gi|67532447|gb|EAM29233.1|  Cobalamin (vitamin B12) biosynthesis CbiD protein [Burkholderia 
vietnamiensis G4]
Length=673

 Score = 35.8 bits (81),  Expect = 2.6
 Identities = 43/148 (29%), Positives = 59/148 (39%), Gaps = 11/148 (7%)
 Frame = -1

Query  513  RPAGLA------AVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGT  352
            RPAG A       + + R+  A  R+AR R  R    PR  A       P+R   H A  
Sbjct  82   RPAGAAHRRPRARLADRRNRGAQSRRARLRGRRRCAAPRAHAGPARRRIPARRPAHQARH  141

Query  351  LPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQ  172
               +A+ +  + A  AAV R R   G+ L    +DA   + + H         AA +  Q
Sbjct  142  ARADARAS-RARAGRAAVGRGR---GQRLDRHRMDAGASVVSRHRDRVAR-GTAALHRTQ  196

Query  171  ARSQLSRGRAHRQPAAEGTAHSSAAEDR  88
             R     G A R+ A    AH + A  R
Sbjct  197  PRRARRAGPATRRRARARCAHGAGAARR  224


>gi|115377591|ref|ZP_01464788.1|  hypothetical protein STIAU_4522 [Stigmatella aurantiaca DW4/3-1]
 gi|115365392|gb|EAU64430.1|  hypothetical protein STIAU_4522 [Stigmatella aurantiaca DW4/3-1]
Length=371

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 36/105 (34%), Positives = 45/105 (42%), Gaps = 17/105 (16%)
 Frame = -1

Query  402  ALAPTCPSRHCTHDAGTLPLEAQ-PTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPA  226
            ALA    +RH + D  TL L+ Q P       LA +  +    G++ L  AV       A
Sbjct  199  ALADEAGARHASIDLQTLALQGQLPVGLGQIRLARLAPRPHAGGQEQLQRAVQ------A  252

Query  225  GHGPAAGEVQDAADNAAQARSQLSRGRAHRQ----PAAEGTAHSS  103
             H   AGEV + A    Q R       AH Q    PAA+G AH S
Sbjct  253  AHHVQAGEVLEVALGGIQPR------EAHLQPPLRPAADGAAHRS  291


>gi|109093898|ref|XP_001111018.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 2 [Macaca mulatta]
Length=1100

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  378  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  437

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  438  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  469

Query  460  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  470  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  519

Query  640  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  783
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  520  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  570


>gi|109093900|ref|XP_001111086.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 4 [Macaca mulatta]
Length=934

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  212  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  271

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  272  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  303

Query  460  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  304  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  353

Query  640  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  783
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  354  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  404


>gi|109093896|ref|XP_001111056.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 3 [Macaca mulatta]
Length=1137

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  415  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  474

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  475  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  506

Query  460  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  507  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  556

Query  640  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  783
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  557  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  607


>gi|109093892|ref|XP_001111206.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform b isoform 6 [Macaca mulatta]
Length=1188

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  466  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  525

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  526  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  557

Query  460  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  558  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  607

Query  640  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  783
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  608  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  658


>gi|109093894|ref|XP_001110984.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 1 [Macaca mulatta]
Length=1158

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  436  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  495

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  496  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  527

Query  460  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  528  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  577

Query  640  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  783
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  578  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  628


>gi|109093890|ref|XP_001111164.1| Gene info PREDICTED: similar to spindle assembly associated Sfi1 homolog 
isoform a isoform 5 [Macaca mulatta]
Length=1219

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 46/231 (19%), Positives = 82/231 (35%), Gaps = 45/231 (19%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       ++ R   R  +         R+  +W Q A     +Q+   V  + 
Sbjct  497  KQVFSIWRQKTFQHQENRLAERMAILHAERQLLHRSWFTWHQQAAARHQEQEWQTVACAH  556

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA                             
Sbjct  557  HRHGR-LKKAFCLWRESAQGLRAERTGRVRAAE---------------------------  588

Query  460  MKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  639
                    FH  +  RRA + W E       ++R L R       + RA+ RA+ +W+ +
Sbjct  589  --------FHVAQLLRRAWSQWRECLAVRGAERRKLMR--ADRHQQQRARLRALQAWVTY  638

Query  640  SKQRLELLNAVTSMSAE--GRAVRKALNSWAVFLRQRFVQV-KSLRALVHH  783
              +   +L  V +  ++   + +R AL  W      R  +  K+ +A  H+
Sbjct  639  QGRVRSILQEVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASAHY  689


>gi|67548232|ref|ZP_00426124.1|  Oxidoreductase, molybdopterin binding [Burkholderia vietnamiensis 
G4]
 gi|67530427|gb|EAM27268.1|  Oxidoreductase, molybdopterin binding [Burkholderia vietnamiensis 
G4]
Length=651

 Score = 35.4 bits (80),  Expect = 3.4
 Identities = 41/158 (25%), Positives = 54/158 (34%), Gaps = 17/158 (10%)
 Frame = -1

Query  507  AGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPT  328
            AG    VE RDGP    + R   GR+ +  R EA      C  +      G + L  QP 
Sbjct  66   AGRVVDVEGRDGPRCDEEGRHEEGRDEKARRDEAGCDVARCDGQGVGRQDGAVEL-TQPY  124

Query  327  VESAACLAAVRRKRDKHGRDLLLGAVDARVL---------------LPAGHGPAAGEVQD  193
               AA  AA R    +    +       RV+                P+ H P  G    
Sbjct  125  GRVAAACAARRPVARRAALRVSWRGASCRVVPVRIDADAIRSVHHANPSRHRPRGGPAPR  184

Query  192  AADNAA-QARSQLSRGRAHRQPAAEGTAHSSAAEDRKA  82
            A D++A  AR  L++        A   AH     D  A
Sbjct  185  APDSSAVGAREPLAQCARGDPDGAVRLAHLRCVADLSA  222


>gi|92911148|ref|ZP_01279922.1|  hypothetical protein MjlsDRAFT_1205 [Mycobacterium sp. JLS]
 gi|92431540|gb|EAS90877.1|  hypothetical protein MjlsDRAFT_1205 [Mycobacterium sp. JLS]
Length=571

 Score = 35.0 bits (79),  Expect = 4.5
 Identities = 50/163 (30%), Positives = 62/163 (38%), Gaps = 35/163 (21%)
 Frame = -1

Query  528  DPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHD----  361
            D RI  P   AAV    DGP          G + RG      ALA   PS   T D    
Sbjct  392  DQRIAPPGDAAAVQRAADGPRHRTAGSLHPGEHGRG------ALAVGEPSPAGTVDRSRE  445

Query  360  --AGTLPLEAQPTVESAACLAAVRRKR---DKHG--------RD------LLLGAVDARV  238
               G L   AQ T  +   + AVRR+R    +HG        RD      L +G   +R+
Sbjct  446  VRPGPLHRTAQRTQAAPVRVRAVRRRRPQVHRHGLRSVGDQDRDAPAAAPLPVGTAASRL  505

Query  237  LLPA---GHGPAAGEVQDAADNAA---QARSQLSRGRAHRQPA  127
             L     GH  A G   D    AA   + R + +  R  R+PA
Sbjct  506  RLETGLRGHAGADGRYADRVAPAALTPRVRRRAAGWRRRRRPA  548


>gi|34533498|dbj|BAC86720.1| UniGene info unnamed protein product [Homo sapiens]
Length=141

 Score = 35.0 bits (79),  Expect = 4.5
 Identities = 38/120 (31%), Positives = 51/120 (42%), Gaps = 19/120 (15%)
 Frame = -1

Query  435  RNARGPRVEAAALAPTCPSRHCT-HDAGTLPLEAQPTVESAACLAAVRRKRDKHG----R  271
            RNA G  +    L  T  +R C   +AG L          A+   A+R  R + G     
Sbjct  24   RNAAGSELSERGLRETEATRECRGEEAGGL----------ASQFRALRASRGRSGGCRPS  73

Query  270  DLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARSQLSRGRAHRQP--AAEGTAHSSAA  97
              L     ++  LP+G G  A   Q +  N A   +Q SRG  H+QP  + EGT  S AA
Sbjct  74   PALGSGRGSQTSLPSGPGMPAP--QSSQRNPANRGAQQSRGGRHQQPTCSVEGTLPSIAA  131


>gi|76818916|ref|YP_335795.1| Gene info hypothetical protein BURPS1710b_A0637 [Burkholderia pseudomallei 
1710b]
 gi|76583389|gb|ABA52863.1| Gene info hypothetical protein BURPS1710b_A0637 [Burkholderia pseudomallei 
1710b]
Length=1069

 Score = 35.0 bits (79),  Expect = 4.5
 Identities = 45/153 (29%), Positives = 58/153 (37%), Gaps = 9/153 (5%)
 Frame = -1

Query  531  LDPRIERPAGLAAVVEERDGPALHRQARKRTGRN-ARGPRVEAAALAPTCPSRHCTHDAG  355
            +D R  RPA +A        PA+ R AR+R  R  A   R +  A     P  H  H   
Sbjct  1    MDRRSARPAAVAVAAVHAGQPAVSRSARQRLFRQPAARQRADPPANRDALP--HGRHVRV  58

Query  354  TLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPA--GHGPAAGEVQDAADN  181
                +A+P +   A  AA RR   +H       A       PA   H  AAG    AA  
Sbjct  59   RAARDARPRLRRRAADAAARRSAGRHRTHPRPRARRRGHRAPAARSHVRAAGRPARAARR  118

Query  180  AAQARSQLSRGRAHRQPAAEGTAHSSAAEDRKA  82
            +A     + R RA    AA  +   +AA    A
Sbjct  119  SA----PVDRRRAGEDRAAAPSRPLAAARREHA  147


>gi|76809242|ref|YP_332102.1| Gene info hypothetical protein BURPS1710b_0689 [Burkholderia pseudomallei 
1710b]
 gi|76578695|gb|ABA48170.1| Gene info conserved hypothetical protein [Burkholderia pseudomallei 1710b]
Length=920

 Score = 35.0 bits (79),  Expect = 4.5
 Identities = 44/155 (28%), Positives = 59/155 (38%), Gaps = 25/155 (16%)
 Frame = -1

Query  522  RIERPAGLAAVVEERDGPALHRQAR-----KRTGRNARGPRVEAAALAPTCPSRHCTHDA  358
            R+ RP G  +  E RDGPA HR+AR     +   R   G RV A    P         +A
Sbjct  311  RVRRPEGAGS--EPRDGPARHRRARAARDAQEAVRPQDGRRVNALCTRP---------EA  359

Query  357  GTLPLEAQPTVESAACLAAVRRKRDKHGRDL-LLGAVDARVLLPAGHGPAAGEVQDAADN  181
               P  A     +A  +A    +  +HG  L   G +D       G   +AG      D 
Sbjct  360  HVQPRHADRDARAARAVARHSGRPVRHGDRLERRGEIDVPEF---GERRSAGGFGAHRDR  416

Query  180  AAQARSQLSRG----RAHRQPAAEGTAHSSAAEDR  88
              +  +Q   G    R  R P  +G  H   A+DR
Sbjct  417  RRRRHAQAGVGSRAARRARVPGPDG-RHLRGADDR  450


>gi|52075896|dbj|BAD45842.1|  splicing coactivator subunit-like [Oryza sativa (japonica cultivar-group)]
 gi|54290966|dbj|BAD61646.1|  splicing coactivator subunit-like [Oryza sativa (japonica cultivar-group)]
Length=316

 Score = 35.0 bits (79),  Expect = 4.5
 Identities = 32/120 (26%), Positives = 45/120 (37%), Gaps = 21/120 (17%)
 Frame = -1

Query  459  RQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDK  280
            R+ R+++G  A   R  AA       +    H A T P          A  +  RRKR  
Sbjct  186  RRVRRKSGAAAAAERSSAAM------AERAEHGASTKP---------TARASGERRKRKS  230

Query  279  HGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQ------ARSQLSRGRAHRQPAAEG  118
              R     A ++      GHG AA   ++  D  A        R++LS  RA  +P   G
Sbjct  231  GARATRRDAAESAAAAALGHGRAAARREEGDDRWAPPVSESGGRARLSAARARGEPMGRG  290


>gi|89339746|ref|ZP_01192344.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium flavescens PYR-GCK]
 gi|89320236|gb|EAS11726.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium flavescens PYR-GCK]
Length=254

 Score = 35.0 bits (79),  Expect = 4.5
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)
 Frame = -1

Query  303  AVRRKRDKHGRDLLLGAVDARV-LLPAGHGPAAG  205
            A+R+K  KHGRDL++G V  R+ ++ A +GPA G
Sbjct  80   ALRQKTIKHGRDLVIGMVRCRIPVIAAVNGPAVG  113


>gi|94389870|ref|XP_911516.2| UniGene infoGene info PREDICTED: Sfi1 homolog, spindle assembly associated [Mus musculus]
Length=772

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 60/280 (21%), Positives = 107/280 (38%), Gaps = 28/280 (10%)
 Frame = +1

Query  31   WIAYNKEAAL-QLRRLRKGLSVFCGTG--MRRAFSSWLAMRASSRQLRACLRSVVGRILH  201
            W  ++++AA+ QL R ++ +++       +RRAF  W       R  R            
Sbjct  132  WFVWHQQAAVCQLERQQQAMAIAHHHSGLLRRAFCIWKESTQGFRIERMGRAQAAHFHSA  191

Query  202  LACSRAMTSWQQNAGVN-STQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAVT  378
               SRA + W++   +    QQK+     +        RRAL  WL  + +   V+R V 
Sbjct  192  QLLSRAWSMWRECLALRLEEQQKLKCA--ALHSQCILLRRALQKWLVYQNRVRSVLREVA  249

Query  379  AWTRWSERR----SFNAWTASIaaralarlaMKRGAVSLFHYGRE-TRRALNSWVEMAQ-  540
            A  R   R+    + + W  +           K+ + +  HY R    + L  W E+   
Sbjct  250  ARERQHNRQLLWWALHLWREN---TMARLDGAKKTSQARVHYSRTLCSKVLVQWREVTSV  306

Query  541  --EWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLWS----KQRLELLNAVTSMSAEGRAV  702
               +  K+    R       +GR  +     W   S    +QR +L  A  +     + +
Sbjct  307  QIYYRQKEAAALREARKALDRGRL-QNWFQHWRFCSQRAAQQRFQLGQA--AQHHHWQLL  363

Query  703  RKALNSWAVF----LRQRFVQVKSLRALVHHGERAGFNAW  810
             +A+  W       +R++F+Q ++ + L     RA F  W
Sbjct  364  MEAMARWKAHHLGCIRKKFLQRQAAQLLAQRLSRACFCQW  403


>gi|90203202|ref|ZP_01205848.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]
 gi|90200081|gb|EAS26840.1|  Enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]
Length=254

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)
 Frame = -1

Query  303  AVRRKRDKHGRDLLLGAVDARV-LLPAGHGPAAG  205
            A+R+K  KHGRDL++G V  R+ ++ A +GPA G
Sbjct  80   ALRQKTIKHGRDLVIGMVRCRIPVVAAVNGPAVG  113


>gi|56238586|emb|CAI26157.1| Gene info novel protein [Mus musculus]
 gi|56800520|emb|CAI35197.1| Gene info novel protein [Mus musculus]
Length=1042

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 60/280 (21%), Positives = 107/280 (38%), Gaps = 28/280 (10%)
 Frame = +1

Query  31   WIAYNKEAAL-QLRRLRKGLSVFCGTG--MRRAFSSWLAMRASSRQLRACLRSVVGRILH  201
            W  ++++AA+ QL R ++ +++       +RRAF  W       R  R            
Sbjct  501  WFVWHQQAAVCQLERQQQAMAIAHHHSGLLRRAFCIWKESTQGFRIERMGRAQAAHFHSA  560

Query  202  LACSRAMTSWQQNAGVN-STQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAVT  378
               SRA + W++   +    QQK+     +        RRAL  WL  + +   V+R V 
Sbjct  561  QLLSRAWSMWRECLALRLEEQQKLKCA--ALHSQCILLRRALQKWLVYQNRVRSVLREVA  618

Query  379  AWTRWSERR----SFNAWTASIaaralarlaMKRGAVSLFHYGRE-TRRALNSWVEMAQ-  540
            A  R   R+    + + W  +           K+ + +  HY R    + L  W E+   
Sbjct  619  ARERQHNRQLLWWALHLWREN---TMARLDGAKKTSQARVHYSRTLCSKVLVQWREVTSV  675

Query  541  --EWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLWS----KQRLELLNAVTSMSAEGRAV  702
               +  K+    R       +GR  +     W   S    +QR +L  A  +     + +
Sbjct  676  QIYYRQKEAAALREARKALDRGRL-QNWFQHWRFCSQRAAQQRFQLGQA--AQHHHWQLL  732

Query  703  RKALNSWAVF----LRQRFVQVKSLRALVHHGERAGFNAW  810
             +A+  W       +R++F+Q ++ + L     RA F  W
Sbjct  733  MEAMARWKAHHLGCIRKKFLQRQAAQLLAQRLSRACFCQW  772


>gi|86605038|ref|YP_473801.1| Gene info phytoene synthase [Synechococcus sp. JA-3-3Ab]
 gi|86553580|gb|ABC98538.1| Gene info phytoene synthase [Synechococcus sp. JA-3-3Ab]
Length=311

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 4/64 (6%)
 Frame = +1

Query  601  RAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALNSWAVFLRQRF----VQVKSLR  768
            R KRRA+ +   W +Q  ELL+ + +  AE    R  L  W   L   F     QV +  
Sbjct  47   RPKRRAIWAIYAWLRQTDELLDGLEASQAEVEVTRSKLEQWGSHLESLFQGGEPQVPTDL  106

Query  769  ALVH  780
            AL+H
Sbjct  107  ALIH  110


>gi|32189776|ref|NP_859506.1| Gene info hypothetical protein LMJ_0239 [Leishmania major strain Friedlin]
 gi|21629370|gb|AAM69047.1|AC125735_77 Gene info hypothetical protein, conserved [Leishmania major]
Length=2936

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 32/131 (24%), Positives = 52/131 (39%), Gaps = 5/131 (3%)
 Frame = -1

Query  459  RQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAAC---LAAVRRK  289
            R A  +  R+  G R  A++ +P   +   +    +LP    P  ESAA    L  V+R+
Sbjct  489  RAASPKRSRDIAGARAGASSASPPTTALSTSPPLASLPPVLSPAAESAAVLRDLKDVQRR  548

Query  288  RDKHG--RDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGT  115
               HG  R     A  A  L    H PAA          + +   +S   +     A  +
Sbjct  549  LHAHGHLRGTAAAAAGAMPLEVKAHSPAAAPSNSTRGPESCSPCDISVAASSVSSTATSS  608

Query  114  AHSSAAEDRKA  82
            + SS+A  +++
Sbjct  609  SSSSSAAMKRS  619


>gi|74225816|dbj|BAE21725.1| UniGene infoGene info unnamed protein product [Mus musculus]
Length=1216

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 60/280 (21%), Positives = 107/280 (38%), Gaps = 28/280 (10%)
 Frame = +1

Query  31   WIAYNKEAAL-QLRRLRKGLSVFCGTG--MRRAFSSWLAMRASSRQLRACLRSVVGRILH  201
            W  ++++AA+ QL R ++ +++       +RRAF  W       R  R            
Sbjct  532  WFVWHQQAAVCQLERQQQAMAIAHHHSGLLRRAFCIWKESTQGFRIERMGRAQAAHFHSA  591

Query  202  LACSRAMTSWQQNAGVN-STQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAVT  378
               SRA + W++   +    QQK+     +        RRAL  WL  + +   V+R V 
Sbjct  592  QLLSRAWSMWRECLALRLEEQQKLKCA--ALHSQCILLRRALQKWLVYQNRVRSVLREVA  649

Query  379  AWTRWSERR----SFNAWTASIaaralarlaMKRGAVSLFHYGRE-TRRALNSWVEMAQ-  540
            A  R   R+    + + W  +           K+ + +  HY R    + L  W E+   
Sbjct  650  ARERQHNRQLLWWALHLWREN---TMARLDGAKKTSQARVHYSRTLCSKVLVQWREVTSV  706

Query  541  --EWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLWS----KQRLELLNAVTSMSAEGRAV  702
               +  K+    R       +GR  +     W   S    +QR +L  A  +     + +
Sbjct  707  QIYYRQKEAAALREARKALDRGRL-QNWFQHWRFCSQRAAQQRFQLGQA--AQHHHWQLL  763

Query  703  RKALNSWAVF----LRQRFVQVKSLRALVHHGERAGFNAW  810
             +A+  W       +R++F+Q ++ + L     RA F  W
Sbjct  764  MEAMARWKAHHLGCIRKKFLQRQAAQLLAQRLSRACFCQW  803


>gi|34393970|dbj|BAC83818.1| Gene info Epstein-Barr virus EBNA-1-like protein [Oryza sativa (japonica 
cultivar-group)]
Length=418

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 36/117 (30%), Positives = 46/117 (39%), Gaps = 5/117 (4%)
 Frame = -1

Query  498  AAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVES  319
            AA +  R   A+H + R R   +ARGPR   A LAPT   R C   AG   ++  P    
Sbjct  46   AARLTVRREHAMHARGRGRDAVHARGPRWTQAELAPTWRLRGC--HAGRREVDDDPAANG  103

Query  318  AACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNAAQARSQLSRG  148
                AAV      HG D        R+ +  G  P A   +   D     R Q + G
Sbjct  104  RR--AAVASGGANHG-DTGKSVHTGRLHVTRGDEPTARIRRRLLDGGGLRRRQPAAG  157


>gi|89338824|ref|ZP_01191589.1|  Beta-lactamase-like [Mycobacterium flavescens PYR-GCK]
 gi|89320757|gb|EAS12246.1|  Beta-lactamase-like [Mycobacterium flavescens PYR-GCK]
Length=247

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 2/32 (6%)
 Frame = -1

Query  261  LGAVDARVLLPAGHGPA-AGEVQDAADNAAQA  169
            LGA+D  V+LP GHGP   G V+DAA  AAQA
Sbjct  214  LGALDTEVILP-GHGPLWRGPVRDAAAQAAQA  244


>gi|71665330|ref|XP_819636.1| Gene info hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70884946|gb|EAN97785.1| Gene info hypothetical protein, conserved [Trypanosoma cruzi]
Length=1073

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 5/82 (6%)
 Frame = +1

Query  544  WSLKQRLLQRGLTTLF--PKGRAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALN  717
            W  ++ +L RG   LF  P+ R      NS   W K R+E+ N +T+M+  G        
Sbjct  314  WMNERHILARGTPLLFTRPRSRPFESNRNSHSEWQKNRIEMPNKLTAMATSGVGFDVDAT  373

Query  718  SWAVFLRQRFVQVKSLRALVHH  783
            S    L++ F     + +++HH
Sbjct  374  S---SLKRHFNSNIMITSILHH  392


>gi|67917748|ref|ZP_00511352.1|  exonuclease SbcC [Chlorobium limicola DSM 245]
 gi|67784511|gb|EAM43886.1|  exonuclease SbcC [Chlorobium limicola DSM 245]
Length=1223

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 43/158 (27%), Positives = 61/158 (38%), Gaps = 22/158 (13%)
 Frame = -1

Query  507  AGLAAVVEERDGPALHRQARKRTG------------RNARGPRVEAAALAPTCPSRHCTH  364
            A +AA    +   +LH +A + TG            R   G R E      T   + C H
Sbjct  618  ADMAADALRQGRLSLHERALEITGLRVAAARLETEIRQLHGQRDELRKSIET-DLQWCRH  676

Query  363  DAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAAD  184
             AGTL +E +P+VE+   +    R       D L  A      +   H  AA E ++   
Sbjct  677  SAGTLSIEGEPSVENIDAILDKHRLLSVKLSDRLAAA----ERIEGAHTAAAQEEKNFQQ  732

Query  183  NAAQA-RSQLSRG----RAHRQPAAEGTAHSSAAEDRK  85
               +A R Q S G     A  + A  G + + A E RK
Sbjct  733  RLTEALRQQESAGYALKTAETEAARAGESEALAGEKRK  770


>gi|67158044|ref|ZP_00419134.1|  Carbamoyltransferase [Azotobacter vinelandii AvOP]
 gi|67085027|gb|EAM04504.1|  Carbamoyltransferase [Azotobacter vinelandii AvOP]
Length=1081

 Score = 34.7 bits (78),  Expect = 5.8
 Identities = 46/147 (31%), Positives = 54/147 (36%), Gaps = 24/147 (16%)
 Frame = -1

Query  510  PAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDAG--------  355
            PAG A V   R G       R+RTGR A G     AA    C SR     AG        
Sbjct  18   PAGAATV--RRIG------RRRRTGRLASGQPAARAAGTTLCRSRRVARPAGAGQAFGRR  69

Query  354  ----TLPLEAQ---PTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQ  196
                  P  A+   P    AA  AA  R+    GR  L     +R       G A G  +
Sbjct  70   QGVAAFPARAEGCAPARRPAAGHAAPARRGAGRGRGRLAAVRVSRRGPGPERGLATGGGR  129

Query  195  DAADNAAQARSQLSRGRAHRQPAAEGT  115
             AA       ++   GR HR+PA  GT
Sbjct  130  AAAVRRPAGGTRRGSGR-HRRPARRGT  155


>gi|55956784|ref|NP_055590.2| UniGene infoGene info spindle assembly associated Sfi1 homolog isoform b [Homo sapiens]
 gi|55660841|emb|CAH70755.1| Gene info homolog of yeast Sfi1 (SFI1) [Homo sapiens]
 gi|55957177|emb|CAI12881.1| Gene info homolog of yeast Sfi1 (SFI1) [Homo sapiens]
 gi|56417786|emb|CAI23034.1| Gene info homolog of yeast Sfi1 (SFI1) [Homo sapiens]
Length=1211

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 42/170 (24%), Positives = 62/170 (36%), Gaps = 18/170 (10%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       R+ R   R  +         R+   W Q A     +Q+   V  + 
Sbjct  489  KQVFSLWRQKMFQHRENRLAERMAILHAERQLLYRSWFMWHQQAAARHQEQEWQTVACAH  548

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA         R +++ W   +A R   R  
Sbjct  549  HRHGR-LKKAFCLWRESAQGLRTERTGRVRAAEFHMAQLLRWAWSQWRECLALRGAERQK  607

Query  460  MKRGAVSLFHYGRETRRALNSWV-----------EMAQEWSLKQRLLQRG  576
            + R    L H      RAL +WV           E+A   S   R L RG
Sbjct  608  LMR--ADLHHQHSVLHRALQAWVTYQGRVRSILREVAARESQHNRQLLRG  655


>gi|6273397|gb|AAF06353.1|AF199413_1  thymidine kinase [Pseudorabies virus]
Length=297

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 25/75 (33%), Positives = 32/75 (42%), Gaps = 1/75 (1%)
 Frame = +2

Query  224  PAGNRTRASTAPSKRSRPCLSRFRRTAARHAALSTVG*ASRGNV-PASCVQ*RLGHVGAS  400
            P    TRA +     S PC S  R T AR AA +T G A R +  P +           +
Sbjct  169  PGSTWTRACSRACATSTPCWSTRRATLARGAAGATTGGARRASTRPCATASRSTSSAARA  228

Query  401  AAASTRGPRALRPVR  445
             A S+R P + R  R
Sbjct  229  TAPSSRTPSSARTRR  243


>gi|83405158|gb|AAI10815.1| UniGene infoGene info SFI1 protein [Homo sapiens]
Length=1137

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 42/170 (24%), Positives = 62/170 (36%), Gaps = 18/170 (10%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       R+ R   R  +         R+   W Q A     +Q+   V  + 
Sbjct  415  KQVFSLWRQKMFQHRENRLAERMAILHAERQLLYRSWFMWHQQAAARHQEQEWQTVACAH  474

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA         R +++ W   +A R   R  
Sbjct  475  HRHGR-LKKAFCLWRESAQGLRTERTGRVRAAEFHMAQLLRWAWSQWRECLALRGAERQK  533

Query  460  MKRGAVSLFHYGRETRRALNSWV-----------EMAQEWSLKQRLLQRG  576
            + R    L H      RAL +WV           E+A   S   R L RG
Sbjct  534  LMR--ADLHHQHSVLHRALQAWVTYQGRVRSILREVAARESQHNRQLLRG  581


>gi|76665259|ref|XP_872957.1| Gene info PREDICTED: similar to storkhead box 1 [Bos taurus]
Length=301

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 28/81 (34%), Positives = 31/81 (38%), Gaps = 5/81 (6%)
 Frame = -1

Query  372  CTHDAGTLPLEAQPTVESAACL-----AAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAA  208
            C H A   P  A     +  CL     AA R  R   GR    G    R  L AG     
Sbjct  130  CAHGAPGRPAGASLAAPAGRCLGPTRWAAAREARRVLGRSGAAGFPLLRSALAAGERADE  189

Query  207  GEVQDAADNAAQARSQLSRGR  145
            GEV+      A + S LSRGR
Sbjct  190  GEVETDGAQVASSGSGLSRGR  210


>gi|55956786|ref|NP_001007468.1| UniGene infoGene info spindle assembly associated Sfi1 homolog isoform a [Homo sapiens]
Length=1242

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 42/170 (24%), Positives = 62/170 (36%), Gaps = 18/170 (10%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       R+ R   R  +         R+   W Q A     +Q+   V  + 
Sbjct  520  KQVFSLWRQKMFQHRENRLAERMAILHAERQLLYRSWFMWHQQAAARHQEQEWQTVACAH  579

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA         R +++ W   +A R   R  
Sbjct  580  HRHGR-LKKAFCLWRESAQGLRTERTGRVRAAEFHMAQLLRWAWSQWRECLALRGAERQK  638

Query  460  MKRGAVSLFHYGRETRRALNSWV-----------EMAQEWSLKQRLLQRG  576
            + R    L H      RAL +WV           E+A   S   R L RG
Sbjct  639  LMR--ADLHHQHSVLHRALQAWVTYQGRVRSILREVAARESQHNRQLLRG  686


>gi|6635201|dbj|BAA25468.2| UniGene infoGene info KIAA0542 protein [Homo sapiens]
Length=1212

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 42/170 (24%), Positives = 62/170 (36%), Gaps = 18/170 (10%)
 Frame = +1

Query  112  RRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSF  291
            ++ FS W       R+ R   R  +         R+   W Q A     +Q+   V  + 
Sbjct  490  KQVFSLWRQKMFQHRENRLAERMAILHAERQLLYRSWFMWHQQAAARHQEQEWQTVACAH  549

Query  292  SPDGRKARRALNSW----LSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIaaralarla  459
               GR  ++A   W      L+ +R+G VRA         R +++ W   +A R   R  
Sbjct  550  HRHGR-LKKAFCLWRESAQGLRTERTGRVRAAEFHMAQLLRWAWSQWRECLALRGAERQK  608

Query  460  MKRGAVSLFHYGRETRRALNSWV-----------EMAQEWSLKQRLLQRG  576
            + R    L H      RAL +WV           E+A   S   R L RG
Sbjct  609  LMR--ADLHHQHSVLHRALQAWVTYQGRVRSILREVAARESQHNRQLLRG  656


>gi|83372689|ref|ZP_00917469.1|  Phosphoribosylglycinamide formyltransferase [Rhodobacter sphaeroides 
ATCC 17029]
 gi|83367011|gb|EAP70497.1|  Phosphoribosylglycinamide formyltransferase [Rhodobacter sphaeroides 
ATCC 17029]
Length=584

 Score = 34.3 bits (77),  Expect = 7.6
 Identities = 45/147 (30%), Positives = 53/147 (36%), Gaps = 25/147 (17%)
 Frame = -1

Query  537  RHLDPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPSRHCTHDA  358
            RH+     R  GL      RDG      A  R GR A GPRVE          R      
Sbjct  189  RHVSQGRLRSRGLR---RGRDGARCRPAAGGRRGRRAAGPRVERGPF-----ERLFLRAQ  240

Query  357  GTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEVQDAADNA  178
            G   L A+       C  A+RR++ + G        DA  L  AG G  AG  +  A   
Sbjct  241  GGRALGAR-----LGCARALRRRQPRAG----ASRADA-PLCEAGAGGGAGGGRACA---  287

Query  177  AQARSQLSRGRAHRQPAAEGTAHSSAA  97
                    R R HR+PAA     S  A
Sbjct  288  ----GPYHRRRPHREPAARSARGSGRA  310


>gi|118163605|gb|ABK64502.1|  caax amino protease family protein [Mycobacterium avium 104]
Length=216

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 25/58 (43%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query  284  SRFRRTAARHAALSTVG*ASRG-NVPASCVQ*RLGHVGASAAASTRGPRALRPVRLRA  454
            SRFRRTAA   A + VG +  G  +PA         +GA+  A TR P  L P RL A
Sbjct  4    SRFRRTAALSLAGALVGWSFVGPRLPAGARMVLQAGMGAALVALTRAPLGLHPPRLWA  61


>gi|116130892|gb|EAA06516.4|  ENSANGP00000004748 [Anopheles gambiae str. PEST]
Length=2553

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 25/110 (22%), Positives = 40/110 (36%), Gaps = 0/110 (0%)
 Frame = -1

Query  414  VEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVL  235
            +++  L   CP  HC+     +        +       +++  DK    L     D    
Sbjct  333  MQSCLLGKNCPKTHCSSSRQIINHWKNCQRQDCPVCLPLQQHHDKQQDTLEPAKGDDASQ  392

Query  234  LPAGHGPAAGEVQDAADNAAQARSQLSRGRAHRQPAAEGTAHSSAAEDRK  85
                 G A G+ QDA    A+ +     G +     A+GTA   AA D+K
Sbjct  393  AEQKEGKADGKSQDAGAGEAKDQQDKPSGESLDHKMADGTAEGKAALDKK  442


>gi|114848442|ref|ZP_01458742.1|  conserved hypothetical protein [Desulfovibrio vulgaris subsp. 
vulgaris DP4]
 gi|114807095|gb|EAU58857.1|  conserved hypothetical protein [Desulfovibrio vulgaris subsp. 
vulgaris DP4]
Length=343

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 0/54 (0%)
 Frame = -1

Query  417  RVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLG  256
            R+   A+ P      CTHD+GT P+ A P  +  A         D   R L++G
Sbjct  6    RMTTTAMTPPSAPAACTHDSGTQPIHAVPAADKPAAGTPAHPATDGAYRLLVMG  59


>gi|115435730|ref|NP_001042623.1| Gene info Os01g0255700 [Oryza sativa (japonica cultivar-group)]
 gi|113532154|dbj|BAF04537.1| Gene info Os01g0255700 [Oryza sativa (japonica cultivar-group)]
Length=450

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 36/123 (29%), Positives = 47/123 (38%), Gaps = 13/123 (10%)
 Frame = -1

Query  438  GRNARGPRVEAAALAPTCPSRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRD---  268
            GR+A GP          C  R C   AGT    A+P      C     + R +HGR    
Sbjct  2    GRSALGPAQHGPRRVGPCLGRECGTWAGT----ARPGASVGPC--RPDKPRPRHGRAAHM  55

Query  267  LLLGAVDARVLLPAGHGPAA----GEVQDAADNAAQARSQLSRGRAHRQPAAEGTAHSSA  100
             ++G   A++   +G G AA    GEV D     +  R   S  +       EGT    A
Sbjct  56   AMMGVPVAQLGKSSGAGDAATGGGGEVADFLLADSSPRRSSSAAKETGLDGTEGTHDGGA  115

Query  99   AED  91
            A D
Sbjct  116  AGD  118


>gi|86609155|ref|YP_477917.1| Gene info phytoene synthase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557697|gb|ABD02654.1| Gene info phytoene synthase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=292

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 4/64 (6%)
 Frame = +1

Query  601  RAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALNSWAVFLRQRF----VQVKSLR  768
            ++KRRA+ +   W +Q  ELL+ + +  AE    R  L  W   L   F     QV +  
Sbjct  31   QSKRRAIWAIYAWLRQTDELLDGLEASQAEVEVTRSKLEQWGSHLESLFQGGEPQVPTDL  90

Query  769  ALVH  780
            AL+H
Sbjct  91   ALIH  94





blast p vs Swissprot : 

Sequences producing significant alignments:                        (Bits)  Value

gi|74718825|sp|Q9HC07|TM165_HUMAN  Transmembrane protein 165 (...  31.2    3.8    Gene info
gi|1346440|sp|P48027|GACS_PSESY  Sensor protein gacS               30.4    6.3  
gi|110825747|sp|P52875|TM165_MOUSE  Transmembrane protein 165 ...  30.4    6.9    Gene info
gi|12230290|sp|Q9L6N1|METE_SALTY  5-methyltetrahydropteroyltri...  30.0    8.5  

Alignments

	
>gi|1346440|sp|P48027|GACS_PSESY  Sensor protein gacS
Length=907

 Score = 34.7 bits (78),  Expect = 0.38, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  81   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  136
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  691  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  750

Query  137  F------NAWTASIAARALARLAMKRGAVSL  161
                   +  T  I+ R LA++ +K   ++L
Sbjct  751  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  781


>gi|74718825|sp|Q9HC07|TM165_HUMAN  Transmembrane protein 165 (Transmembrane protein TPARL) (Transmembrane 
protein PT27)
Length=324

 Score = 31.2 bits (69),  Expect = 4.6, Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query  187  RLLQRGLTTLFPKGRAKRRAVNSWLLWSK---QRLELLNAVTSMSAEGRAVRKALNSWAV  243
            R+L+ GL     +G+ +   V + L       QR +LLN    +   G ++      W  
Sbjct  173  RMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVET-GTSITVPQKKWLH  231

Query  244  FLRQRFVQVKSLRALVHHGERAGFNAWIAAAKE  276
            F+   FVQ  +L  L   G+R+     + AA+E
Sbjct  232  FISPIFVQALTLTFLAEWGDRSQLTTIVLAARE  264


>gi|6225872|sp|O83258|PRIA_TREPA  Primosomal protein N' (ATP-dependent helicase priA) (Replication 
factor Y)
Length=657

 Score = 30.8 bits (68),  Expect = 6.0, Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 13/83 (15%)

Query  67   HLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAVT  126
            HLAC+R    W  +  + +  Q + AV+ S     RK  R L+S+ S     +GV R  T
Sbjct  83   HLACAR----WMAHFYLCALGQALCAVVPS-----RKRERTLSSFASC----AGVRRTDT  129

Query  127  AWTRWSERRSFNAWTASIAARAL  149
                  +R++ +A TAS  AR+ 
Sbjct  130  YALSGEQRKAIDAITASTGARSF  152


>gi|110825747|sp|P52875|TM165_MOUSE  Transmembrane protein 165 (Transmembrane protein TPARL) (TPA-regulated 
locus protein) (Transmembrane protein PFT27)
Length=323

 Score = 30.4 bits (67),  Expect = 7.9, Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 5/93 (5%)

Query  187  RLLQRGLTTLFPKGRAKRRAVNSWLLWSK---QRLELLNAVTSMSAEGRAVRKALNSWAV  243
            R+L+ GL     +G+ +   V + L       QR +LLN     +    A+ +    W  
Sbjct  173  RMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIPQ--KKWLH  230

Query  244  FLRQRFVQVKSLRALVHHGERAGFNAWIAAAKE  276
            F+   FVQ  +L  L   G+R+     + AA+E
Sbjct  231  FISPIFVQALTLTFLAEWGDRSQLTTIVLAARE  263


>gi|12230290|sp|Q9L6N1|METE_SALTY  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
(Methionine synthase, vitamin-B12 independent isozyme) 
(Cobalamin-independent methionine synthase)
Length=754

 Score = 30.0 bits (66),  Expect = 9.6, Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query  212  LWSKQRLELLNAVTSMSAEGRAVRKALNSWAVFLRQRFVQVKSLRALVHHGERAGFNAWI  271
            LW      LL++   +S E R +   + SW  F  Q+  ++  LR  ++ GE A    W 
Sbjct  317  LWVASSCSLLHSPIDLSVETR-LDTEVKSWFAFALQKCGELALLRDALNSGETAALEEWS  375

Query  272  A--AAKEHA  278
            A   A+ H+
Sbjct  376  APIQARRHS  384
	
	
	
	

  Database: Non-redundant SwissProt sequences
    Posted date:  Nov 28, 2006  5:54 PM
  Number of letters in database: 82,042,039
  Number of sequences in database:  217,875
Lambda     K      H
   0.324    0.129    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 217875
Number of Hits to DB: 2003269
Number of extensions: 64583
Number of successful extensions: 207
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 214
Number of HSP's successfully gapped: 0
Length of query: 286
Length of database: 82042039
Length adjustment: 111
Effective length of query: 175
Effective length of database: 57857914
Effective search space: 10125134950
Effective search space used: 10125134950
T: 11
A: 40
X1: 15 (7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.0 bits)
S2: 66 (30.0 bits)










blast p vs NR:

Sequences producing significant alignments:                        (Bits)  Value

gi|110751273|ref|XP_392215.3|  PREDICTED: similar to CG30069-PA [  38.5    0.35  
gi|67516265|ref|XP_658018.1|  hypothetical protein AN0414.2 [A...  36.6    1.3   
gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococc  35.8    2.4  
gi|28868897|ref|NP_791516.1|  sensor histidine kinase/response...  35.8    2.6   
gi|71734710|ref|YP_275861.1|  response regulator, sensor histi...  35.0    3.8   
gi|1346440|sp|P48027|GACS_PSESY  Sensor protein gacS >gi|15132...  34.7    5.2  
gi|66046927|ref|YP_236768.1|  Response regulator receiver:ATP-...  34.7    5.3   
gi|281611|pir||B41863  two-component regulatory protein lemA - Ps  34.7    5.9  
gi|81252692|ref|ZP_00877271.1|  COG3321: Polyketide synthase m...  33.9    9.9  
gi|15610961|ref|NP_218342.1|  PROBABLE POLYKETIDE SYNTHASE PKS...  33.9    10.0  
gi|76782427|ref|ZP_00769632.1|  COG3321: Polyketide synthase m...  33.9    10.0 



Alignments


>gi|110751273|ref|XP_392215.3|  PREDICTED: similar to CG30069-PA [Apis mellifera]
Length=4664

 Score = 38.5 bits (88),  Expect = 0.35, Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 92/230 (40%), Gaps = 34/230 (14%)

Query  21    QLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAM------  74
             + RR    L V  G  M    ++  A       L    R VVGR  H+  S A+      
Sbjct  4247  ETRRHEDNLKVSTGHAMESKTTTRDAFSPKKEDLGGGRREVVGRKHHMESSIALGDDLVS  4306

Query  75    --TSWQQNAGV--NSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSGVVRAVTAWTR  130
               T+ Q+N       T ++++A +     DG  +RR++ S  +++   + VV+  T+  R
Sbjct  4307  STTTSQRNYNTFTKRTAKEVAAKMSGMELDGSASRRSVES-RTVENGTTSVVKRTTSSQR  4365

Query  131   --WSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQEWSLKQRL  188
                +E R              A ++++ GAV      R+ +R          E++++Q+ 
Sbjct  4366  VITTEHRD-------------ASISIEGGAVESSKCSRDHQRHERDSSRGGAEYNVEQKH  4412

Query  189   LQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKAL  238
              +        +  +KR  VN+    S+QR E      S  A     R+A+
Sbjct  4413  HR--------QETSKRDYVNAQHAESRQRQETSRCYNSSQASSAEFRQAI  4454


>gi|67516265|ref|XP_658018.1|  hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
 gi|40747357|gb|EAA66513.1|  hypothetical protein AN0414.2 [Aspergillus nidulans FGSC A4]
Length=981

 Score = 36.6 bits (83),  Expect = 1.3, Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query  20   LQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQ  79
            L+ RRLR+ L      GM+R F         S  LRA L +V GRI+ LA + A ++ + 
Sbjct  457  LKERRLRQDL------GMKRKFIDIWVQTYDSNALRAALEAVTGRIIPLAKANASSTHKS  510

Query  80   NAGVNSTQQKISAVLVSF  97
              G +  ++ ++  L  F
Sbjct  511  ANGASPHEKALTKKLAKF  528


>gi|116054697|emb|CAL56774.1|  unnamed protein product [Ostreococcus tauri]
Length=340

 Score = 35.8 bits (81),  Expect = 2.4, Method: Composition-based stats.
 Identities = 47/213 (22%), Positives = 84/213 (39%), Gaps = 32/213 (15%)

Query  1    LRGCTRALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRS  60
            +R   R+ N W  Y      +   L K  S    T +  AF+ W      S   +  LR 
Sbjct  127  MRLLVRSWNKWGEYVVNEKRRNNVLGKVYSRIRNTELANAFTRWREFAEESYDAKMQLRK  186

Query  61   VVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSG  120
            +V R+L L  S+A+  W++N  + S +Q                 RAL + ++ + +   
Sbjct  187  IVSRMLRLRLSQALGRWRENT-IESQRQ-----------------RALLARVATRIRNRC  228

Query  121  VVRAVTAWTRWSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQ  180
            V +   AW          A  ++   R +  L ++    +L       R A   W  + +
Sbjct  229  VAQCFNAWCDTVNDNKIEAQASAYRQRLVNNLCLRINRATL-------REAFKKWWRVVE  281

Query  181  EWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLW  213
            E  + + ++++ L       RAKR A+N ++ W
Sbjct  282  EREMHREMIRKVL-------RAKRVAMNFFMTW  307


>gi|28868897|ref|NP_791516.1|  sensor histidine kinase/response regulator GacS [Pseudomonas 
syringae pv. tomato str. DC3000]
 gi|28852136|gb|AAO55211.1|  sensor histidine kinase/response regulator GacS [Pseudomonas 
syringae pv. tomato str. DC3000]
Length=917

 Score = 35.8 bits (81),  Expect = 2.6, Method: Composition-based stats.
 Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 20/156 (12%)

Query  23   RRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRA-CLRS------VVGRILHLACSRAMT  75
            R+L+K LS        RA  + +A   SSR  R  C+        +V  +L    +  M 
Sbjct  639  RKLQKALSELIAP---RAIRADIAPPLSSRAPRVLCVDDNPANLLLVQTLLEDMGAEVMA  695

Query  76   SWQQNAGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRW  131
                 A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    
Sbjct  696  VEGGYAAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERGQSSLPIVALTAHAMA  755

Query  132  SERRSF------NAWTASIAARALARLAMKRGAVSL  161
            +E+RS       +  T  I+ R LA++ +K   ++L
Sbjct  756  NEKRSLLQSGMDDYLTKPISERQLAQVVLKWSGLAL  791


>gi|71734710|ref|YP_275861.1|  response regulator, sensor histidine kinase component GacS [Pseudomonas 
syringae pv. phaseolicola 1448A]
 gi|71555263|gb|AAZ34474.1|  response regulator, sensor histidine kinase component GacS [Pseudomonas 
syringae pv. phaseolicola 1448A]
Length=917

 Score = 35.0 bits (79),  Expect = 3.8, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  81   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  136
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  701  AAVNAVQQEAFDLVLMDMQMPGMDGRQATEAIRTWEAERNQSSLPIVALTAHAMANEKRS  760

Query  137  F------NAWTASIAARALARLAMKRGAVSL  161
                   +  T  I+ R LA++ +K   ++L
Sbjct  761  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  791


>gi|1346440|sp|P48027|GACS_PSESY  Sensor protein gacS
 gi|151329|gb|AAA25877.1|  regulatory protein
Length=907

 Score = 34.7 bits (78),  Expect = 5.2, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  81   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  136
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  691  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  750

Query  137  F------NAWTASIAARALARLAMKRGAVSL  161
                   +  T  I+ R LA++ +K   ++L
Sbjct  751  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  781


>gi|66046927|ref|YP_236768.1|  Response regulator receiver:ATP-binding region, ATPase-like:Histidine 
kinase, HAMP region:Histidine kinase A, N-terminal:Hpt 
[Pseudomonas syringae pv. syringae B728a]
 gi|63257634|gb|AAY38730.1|  Response regulator receiver:ATP-binding region, ATPase-like:Histidine 
kinase, HAMP region:Histidine kinase A, N-terminal:Hpt 
[Pseudomonas syringae pv. syringae B728a]
Length=917

 Score = 34.7 bits (78),  Expect = 5.3, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  81   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  136
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  701  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  760

Query  137  F------NAWTASIAARALARLAMKRGAVSL  161
                   +  T  I+ R LA++ +K   ++L
Sbjct  761  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  791


>gi|281611|pir||B41863  two-component regulatory protein lemA - Pseudomonas syringae
Length=929

 Score = 34.7 bits (78),  Expect = 5.9, Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query  81   AGVNSTQQK-ISAVLVSFSP---DGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRS  136
            A VN+ QQ+    VL+       DGR+A  A+ +W + + Q S  + A+TA    +E+RS
Sbjct  713  AAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRS  772

Query  137  F------NAWTASIAARALARLAMKRGAVSL  161
                   +  T  I+ R LA++ +K   ++L
Sbjct  773  LLQSGMDDYLTKPISERQLAQVVLKWTGLAL  803


>gi|81252692|ref|ZP_00877271.1|  COG3321: Polyketide synthase modules and related proteins [Mycobacterium 
tuberculosis C]
Length=2095

 Score = 33.9 bits (76),  Expect = 9.9, Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query  91    SAVLVSFSPDGRKARRALNSWL---SLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAAR  147
             SA  ++ SP G+ A  A NSWL   +  RQ  G+     AW  WS+      W+AS  AR
Sbjct  1875  SAAALTGSP-GQSAYSAANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSAS-PAR  1932

Query  148   ALA  150
             A A
Sbjct  1933  ASA  1935


>gi|15610961|ref|NP_218342.1|  PROBABLE POLYKETIDE SYNTHASE PKS2 [Mycobacterium tuberculosis 
H37Rv]
 gi|15843449|ref|NP_338486.1|  mycocerosic acid synthase [Mycobacterium tuberculosis CDC1551]
 gi|31794999|ref|NP_857492.1|  POLYKETIDE SYNTHASE PKS2 [Mycobacterium bovis AF2122/97]
 gi|2224820|emb|CAB10012.1|  PROBABLE POLYKETIDE SYNTHASE PKS2 [Mycobacterium tuberculosis 
H37Rv]
 gi|13883819|gb|AAK48300.1|  mycocerosic acid synthase [Mycobacterium tuberculosis CDC1551]
 gi|31620597|emb|CAD96041.1|  POLYKETIDE SYNTHASE PKS2 [Mycobacterium bovis AF2122/97]
Length=2126

 Score = 33.9 bits (76),  Expect = 10.0, Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query  91    SAVLVSFSPDGRKARRALNSWL---SLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAAR  147
             SA  ++ SP G+ A  A NSWL   +  RQ  G+     AW  WS+      W+AS  AR
Sbjct  1906  SAAALTGSP-GQSAYSAANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSAS-PAR  1963

Query  148   ALA  150
             A A
Sbjct  1964  ASA  1966


>gi|76782427|ref|ZP_00769632.1|  COG3321: Polyketide synthase modules and related proteins [Mycobacterium 
tuberculosis F11]
Length=2095

 Score = 33.9 bits (76),  Expect = 10.0, Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query  91    SAVLVSFSPDGRKARRALNSWL---SLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAAR  147
             SA  ++ SP G+ A  A NSWL   +  RQ  G+     AW  WS+      W+AS  AR
Sbjct  1875  SAAALTGSP-GQSAYSAANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSAS-PAR  1932

Query  148   ALA  150
             A A
Sbjct  1933  ASA  1935
	
	
	
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples
    Posted date:  Dec 3, 2006  5:52 PM
  Number of letters in database: 1,445,405,603
  Number of sequences in database:  4,201,456
Lambda     K      H
   0.324    0.128    0.398 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4201456
Number of Hits to DB: 72114758
Number of extensions: 2434772
Number of successful extensions: 8419
Number of sequences better than 10: 1
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 8487
Number of HSP's successfully gapped: 1
Length of query: 286
Length of database: 1445405603
Length adjustment: 129
Effective length of query: 157
Effective length of database: 903417779
Effective search space: 141836591303
Effective search space used: 141836591303
T: 11
A: 40
X1: 15 (7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.0 bits)
S2: 76 (33.9 bits)





	
	

ORF finding

Orffinder ATG direct :

>ORF number 1 in reading frame 1 on the direct strand extends from base 109 to base 858.
ATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGACAGCTGCGAGCG
TGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTGCAGCCGGGCCATGACCAGC
TGGCAACAGAACGCGGGCGTCAACAGCACCCAGCAAAAGATCTCGGCCGTGCTTGTCTCG
TTTTCGCCGGACGGCCGCAAGGCACGCCGCGCTCTCAACAGTTGGCTGAGCCTCAAGAGG
CAACGTTCCGGCGTCGTGCGTGCAGTGACGGCTTGGACACGTTGGAGCGAGCGCCGCAGC
TTCAACGCGTGGACCGCGAGCATTGCGGCCCGTGCGCTTGCGCGCCTGGCGATGAAGCGC
GGGGCCGTCTCGCTCTTCCACTACGGCCGCGAGACCCGCCGGGCGCTCAATTCGTGGGTC
GAGATGGCGCAGGAATGGTCGCTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTC
TTCCCGAAGGGTCGGGCGAAGCGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAG
CGCCTCGAGCTGCTGAATGCCGTGACGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAA
GCCCTCAACTCGTGGGCAGTCTTCTTGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGG
GCTCTCGTTCATCACGGCGAGCGTGCGGGTTTCAACGCGTGGATCGCTGCCGCTAAGGAG
CACGCGGGCGTGCAGCGGAAGATGCAGCGG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MRRAFSSWLAMRASSRQLRACLRSVVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVS
FSPDGRKARRALNSWLSLKRQRSGVVRAVTAWTRWSERRSFNAWTASIAARALARLAMKR
GAVSLFHYGRETRRALNSWVEMAQEWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLWSKQ
RLELLNAVTSMSAEGRAVRKALNSWAVFLRQRFVQVKSLRALVHHGERAGFNAWIAAAKE
HAGVQRKMQR

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 543 to base 758.
ATGGTCGCTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTCTTCCCGAAGGGTCG
GGCGAAGCGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCT
GAATGCCGTGACGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTG
GGCAGTCTTCTTGCGGCAGCGCTTTGTGCAGGTTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MVAEAAATAARAHDALPEGSGEASCGQFLATLVKAAPRAAECRDVHVSGGPCRAQSPQLV
GSLLAAALCAG*


Orffinder ATG reverse : 

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 179 to base 370.
ATGGACGTCACGGCATTCAGCAGCTCGAGGCGCTGCTTTGACCAAAGTAGCCAAGAATTG
ACCGCACGACGCTTCGCCCGACCCTTCGGGAAGAGCGTCGTGAGCCCTCGCTGCAGTAGC
CGCTGCTTCAGCGACCATTCCTGCGCCATCTCGACCCACGAATTGAGCGCCCGGCGGGTC
TCGCGGCCGTAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MDVTAFSSSRRCFDQSSQELTARRFARPFGKSVVSPRCSSRCFSDHSCAISTHELSARRV
SRP*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 428 to base 856.
ATGCTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCAAGCCGTCACT
GCACGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAGAGCGCGGCGT
GCCTTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTGCTGGGTGCTG
TTGACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAGGTGCAAGATG
CGGCCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCGCATCGCCAGC
CAGCTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCCCTTCCGCAAC
CGTCGTAGTTGCAACGCCGCCTCCTTGTTGTATGCTATCCAGCTATTGAGAGCGCGTGTG
CATCCTCGC

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
MLAVHALKLRRSLQRVQAVTARTTPERCLLRLSQLLRARRALRPSGENETSTAEIFCWVL
LTPAFCCQLVMARLQARCKMRPTTLRKHARSCREDARIASQLLKARRIPVPQKTERPFRN
RRSCNAASLLYAIQLLRARVHPR

No ORFs were found in reading frame 3.



Orffinder ATG CTG TTG GTG direct : 

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 858.
CTGCGAGGATGCACACGCGCTCTCAATAGCTGGATAGCATACAACAAGGAGGCGGCGTTG
CAACTACGACGGTTGCGGAAGGGCCTTTCTGTCTTCTGCGGCACTGGAATGCGCCGTGCC
TTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGACAGCTGCGAGCGTGCTTGCGCAGC
GTTGTCGGCCGCATCTTGCACCTCGCCTGCAGCCGGGCCATGACCAGCTGGCAACAGAAC
GCGGGCGTCAACAGCACCCAGCAAAAGATCTCGGCCGTGCTTGTCTCGTTTTCGCCGGAC
GGCCGCAAGGCACGCCGCGCTCTCAACAGTTGGCTGAGCCTCAAGAGGCAACGTTCCGGC
GTCGTGCGTGCAGTGACGGCTTGGACACGTTGGAGCGAGCGCCGCAGCTTCAACGCGTGG
ACCGCGAGCATTGCGGCCCGTGCGCTTGCGCGCCTGGCGATGAAGCGCGGGGCCGTCTCG
CTCTTCCACTACGGCCGCGAGACCCGCCGGGCGCTCAATTCGTGGGTCGAGATGGCGCAG
GAATGGTCGCTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTCTTCCCGAAGGGT
CGGGCGAAGCGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAGCGCCTCGAGCTG
CTGAATGCCGTGACGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAGCCCTCAACTCG
TGGGCAGTCTTCTTGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCAT
CACGGCGAGCGTGCGGGTTTCAACGCGTGGATCGCTGCCGCTAAGGAGCACGCGGGCGTG
CAGCGGAAGATGCAGCGG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LRGCTRALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRS
VVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSG
VVRAVTAWTRWSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQ
EWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALNS
WAVFLRQRFVQVKSLRALVHHGERAGFNAWIAAAKEHAGVQRKMQR

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 30 to base 758.
CTGGATAGCATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTC
TGTCTTCTGCGGCACTGGAATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTC
CTCTCGACAGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTG
CAGCCGGGCCATGACCAGCTGGCAACAGAACGCGGGCGTCAACAGCACCCAGCAAAAGAT
CTCGGCCGTGCTTGTCTCGTTTTCGCCGGACGGCCGCAAGGCACGCCGCGCTCTCAACAG
TTGGCTGAGCCTCAAGAGGCAACGTTCCGGCGTCGTGCGTGCAGTGACGGCTTGGACACG
TTGGAGCGAGCGCCGCAGCTTCAACGCGTGGACCGCGAGCATTGCGGCCCGTGCGCTTGC
GCGCCTGGCGATGAAGCGCGGGGCCGTCTCGCTCTTCCACTACGGCCGCGAGACCCGCCG
GGCGCTCAATTCGTGGGTCGAGATGGCGCAGGAATGGTCGCTGAAGCAGCGGCTACTGCA
GCGAGGGCTCACGACGCTCTTCCCGAAGGGTCGGGCGAAGCGTCGTGCGGTCAATTCTTG
GCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCTGAATGCCGTGACGTCCATGTCAGCGGA
GGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTGGGCAGTCTTCTTGCGGCAGCGCTTTGT
GCAGGTTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
LDSIQQGGGVATTTVAEGPFCLLRHWNAPCLQQLAGDARVLSTAASVLAQRCRPHLAPRL
QPGHDQLATERGRQQHPAKDLGRACLVFAGRPQGTPRSQQLAEPQEATFRRRACSDGLDT
LERAPQLQRVDREHCGPCACAPGDEARGRLALPLRPRDPPGAQFVGRDGAGMVAEAAATA
ARAHDALPEGSGEASCGQFLATLVKAAPRAAECRDVHVSGGPCRAQSPQLVGSLLAAALC
AG*


Orffinder ATG CTG GTG TTG reverse : 


>ORF number 1 in reading frame 1 on the reverse strand extends from base 301 to base 795.
CTGCTTCAGCGACCATTCCTGCGCCATCTCGACCCACGAATTGAGCGCCCGGCGGGTCTC
GCGGCCGTAGTGGAAGAGCGAGACGGCCCCGCGCTTCATCGCCAGGCGCGCAAGCGCACG
GGCCGCAATGCTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCAAGC
CGTCACTGCACGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAGAGC
GCGGCGTGCCTTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTGCTG
GGTGCTGTTGACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAGGTG
CAAGATGCGGCCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCGCAT
CGCCAGCCAGCTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCCCTT
CCGCAACCGTCGTAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LLQRPFLRHLDPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCPS
RHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGEV
QDAADNAAQARSQLSRGRAHRQPAAEGTAHSSAAEDRKALPQPS*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 143 to base 370.
TTGAGGGCTTTGCGCACGGCACGGCCCTCCGCTGACATGGACGTCACGGCATTCAGCAGC
TCGAGGCGCTGCTTTGACCAAAGTAGCCAAGAATTGACCGCACGACGCTTCGCCCGACCC
TTCGGGAAGAGCGTCGTGAGCCCTCGCTGCAGTAGCCGCTGCTTCAGCGACCATTCCTGC
GCCATCTCGACCCACGAATTGAGCGCCCGGCGGGTCTCGCGGCCGTAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
LRALRTARPSADMDVTAFSSSRRCFDQSSQELTARRFARPFGKSVVSPRCSSRCFSDHSC
AISTHELSARRVSRP*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 428 to base 856.
ATGCTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCAAGCCGTCACT
GCACGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAGAGCGCGGCGT
GCCTTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTGCTGGGTGCTG
TTGACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAGGTGCAAGATG
CGGCCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCGCATCGCCAGC
CAGCTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCCCTTCCGCAAC
CGTCGTAGTTGCAACGCCGCCTCCTTGTTGTATGCTATCCAGCTATTGAGAGCGCGTGTG
CATCCTCGC

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
MLAVHALKLRRSLQRVQAVTARTTPERCLLRLSQLLRARRALRPSGENETSTAEIFCWVL
LTPAFCCQLVMARLQARCKMRPTTLRKHARSCREDARIASQLLKARRIPVPQKTERPFRN
RRSCNAASLLYAIQLLRARVHPR

No ORFs were found in reading frame 3.


Orffinder any codon direct :

 
>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 858.
CTGCGAGGATGCACACGCGCTCTCAATAGCTGGATAGCATACAACAAGGAGGCGGCGTTG
CAACTACGACGGTTGCGGAAGGGCCTTTCTGTCTTCTGCGGCACTGGAATGCGCCGTGCC
TTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGACAGCTGCGAGCGTGCTTGCGCAGC
GTTGTCGGCCGCATCTTGCACCTCGCCTGCAGCCGGGCCATGACCAGCTGGCAACAGAAC
GCGGGCGTCAACAGCACCCAGCAAAAGATCTCGGCCGTGCTTGTCTCGTTTTCGCCGGAC
GGCCGCAAGGCACGCCGCGCTCTCAACAGTTGGCTGAGCCTCAAGAGGCAACGTTCCGGC
GTCGTGCGTGCAGTGACGGCTTGGACACGTTGGAGCGAGCGCCGCAGCTTCAACGCGTGG
ACCGCGAGCATTGCGGCCCGTGCGCTTGCGCGCCTGGCGATGAAGCGCGGGGCCGTCTCG
CTCTTCCACTACGGCCGCGAGACCCGCCGGGCGCTCAATTCGTGGGTCGAGATGGCGCAG
GAATGGTCGCTGAAGCAGCGGCTACTGCAGCGAGGGCTCACGACGCTCTTCCCGAAGGGT
CGGGCGAAGCGTCGTGCGGTCAATTCTTGGCTACTTTGGTCAAAGCAGCGCCTCGAGCTG
CTGAATGCCGTGACGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAGCCCTCAACTCG
TGGGCAGTCTTCTTGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCAT
CACGGCGAGCGTGCGGGTTTCAACGCGTGGATCGCTGCCGCTAAGGAGCACGCGGGCGTG
CAGCGGAAGATGCAGCGG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LRGCTRALNSWIAYNKEAALQLRRLRKGLSVFCGTGMRRAFSSWLAMRASSRQLRACLRS
VVGRILHLACSRAMTSWQQNAGVNSTQQKISAVLVSFSPDGRKARRALNSWLSLKRQRSG
VVRAVTAWTRWSERRSFNAWTASIAARALARLAMKRGAVSLFHYGRETRRALNSWVEMAQ
EWSLKQRLLQRGLTTLFPKGRAKRRAVNSWLLWSKQRLELLNAVTSMSAEGRAVRKALNS
WAVFLRQRFVQVKSLRALVHHGERAGFNAWIAAAKEHAGVQRKMQR

>ORF number 1 in reading frame 2 on the direct strand extends from base 38 to base 223.
CATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTCTGTCTTCT
GCGGCACTGGAATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTCCTCTCGAC
AGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTGCAGCCGGG
CCATGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
HTTRRRRCNYDGCGRAFLSSAALECAVPSAAGWRCARPLDSCERACAALSAASCTSPAAG
P*

>ORF number 2 in reading frame 2 on the direct strand extends from base 674 to base 856.
CGTCCATGTCAGCGGAGGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTGGGCAGTCTTCT
TGCGGCAGCGCTTTGTGCAGGTTAAATCGCTGCGGGCTCTCGTTCATCACGGCGAGCGTG
CGGGTTTCAACGCGTGGATCGCTGCCGCTAAGGAGCACGCGGGCGTGCAGCGGAAGATGC
AGC

>Translation of ORF number 2 in reading frame 2 on the direct strand.
RPCQRRAVPCAKPSTRGQSSCGSALCRLNRCGLSFITASVRVSTRGSLPLRSTRACSGRC
S

>ORF number 1 in reading frame 3 on the direct strand extends from base 30 to base 758.
CTGGATAGCATACAACAAGGAGGCGGCGTTGCAACTACGACGGTTGCGGAAGGGCCTTTC
TGTCTTCTGCGGCACTGGAATGCGCCGTGCCTTCAGCAGCTGGCTGGCGATGCGCGCGTC
CTCTCGACAGCTGCGAGCGTGCTTGCGCAGCGTTGTCGGCCGCATCTTGCACCTCGCCTG
CAGCCGGGCCATGACCAGCTGGCAACAGAACGCGGGCGTCAACAGCACCCAGCAAAAGAT
CTCGGCCGTGCTTGTCTCGTTTTCGCCGGACGGCCGCAAGGCACGCCGCGCTCTCAACAG
TTGGCTGAGCCTCAAGAGGCAACGTTCCGGCGTCGTGCGTGCAGTGACGGCTTGGACACG
TTGGAGCGAGCGCCGCAGCTTCAACGCGTGGACCGCGAGCATTGCGGCCCGTGCGCTTGC
GCGCCTGGCGATGAAGCGCGGGGCCGTCTCGCTCTTCCACTACGGCCGCGAGACCCGCCG
GGCGCTCAATTCGTGGGTCGAGATGGCGCAGGAATGGTCGCTGAAGCAGCGGCTACTGCA
GCGAGGGCTCACGACGCTCTTCCCGAAGGGTCGGGCGAAGCGTCGTGCGGTCAATTCTTG
GCTACTTTGGTCAAAGCAGCGCCTCGAGCTGCTGAATGCCGTGACGTCCATGTCAGCGGA
GGGCCGTGCCGTGCGCAAAGCCCTCAACTCGTGGGCAGTCTTCTTGCGGCAGCGCTTTGT
GCAGGTTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
LDSIQQGGGVATTTVAEGPFCLLRHWNAPCLQQLAGDARVLSTAASVLAQRCRPHLAPRL
QPGHDQLATERGRQQHPAKDLGRACLVFAGRPQGTPRSQQLAEPQEATFRRRACSDGLDT
LERAPQLQRVDREHCGPCACAPGDEARGRLALPLRPRDPPGAQFVGRDGAGMVAEAAATA
ARAHDALPEGSGEASCGQFLATLVKAAPRAAECRDVHVSGGPCRAQSPQLVGSLLAAALC
AG*


Orffinder any codon reverse : 

>ORF number 1 in reading frame 1 on the reverse strand extends from base 298 to base 795.
CCGCTGCTTCAGCGACCATTCCTGCGCCATCTCGACCCACGAATTGAGCGCCCGGCGGGT
CTCGCGGCCGTAGTGGAAGAGCGAGACGGCCCCGCGCTTCATCGCCAGGCGCGCAAGCGC
ACGGGCCGCAATGCTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCA
AGCCGTCACTGCACGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAG
AGCGCGGCGTGCCTTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTG
CTGGGTGCTGTTGACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAG
GTGCAAGATGCGGCCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCG
CATCGCCAGCCAGCTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCC
CTTCCGCAACCGTCGTAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
PLLQRPFLRHLDPRIERPAGLAAVVEERDGPALHRQARKRTGRNARGPRVEAAALAPTCP
SRHCTHDAGTLPLEAQPTVESAACLAAVRRKRDKHGRDLLLGAVDARVLLPAGHGPAAGE
VQDAADNAAQARSQLSRGRAHRQPAAEGTAHSSAAEDRKALPQPS*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 83 to base 370.
ACGAGAGCCCGCAGCGATTTAACCTGCACAAAGCGCTGCCGCAAGAAGACTGCCCACGAG
TTGAGGGCTTTGCGCACGGCACGGCCCTCCGCTGACATGGACGTCACGGCATTCAGCAGC
TCGAGGCGCTGCTTTGACCAAAGTAGCCAAGAATTGACCGCACGACGCTTCGCCCGACCC
TTCGGGAAGAGCGTCGTGAGCCCTCGCTGCAGTAGCCGCTGCTTCAGCGACCATTCCTGC
GCCATCTCGACCCACGAATTGAGCGCCCGGCGGGTCTCGCGGCCGTAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
TRARSDLTCTKRCRKKTAHELRALRTARPSADMDVTAFSSSRRCFDQSSQELTARRFARP
FGKSVVSPRCSSRCFSDHSCAISTHELSARRVSRP*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 371 to base 856.
TGGAAGAGCGAGACGGCCCCGCGCTTCATCGCCAGGCGCGCAAGCGCACGGGCCGCAATG
CTCGCGGTCCACGCGTTGAAGCTGCGGCGCTCGCTCCAACGTGTCCAAGCCGTCACTGCA
CGCACGACGCCGGAACGTTGCCTCTTGAGGCTCAGCCAACTGTTGAGAGCGCGGCGTGCC
TTGCGGCCGTCCGGCGAAAACGAGACAAGCACGGCCGAGATCTTTTGCTGGGTGCTGTTG
ACGCCCGCGTTCTGTTGCCAGCTGGTCATGGCCCGGCTGCAGGCGAGGTGCAAGATGCGG
CCGACAACGCTGCGCAAGCACGCTCGCAGCTGTCGAGAGGACGCGCGCATCGCCAGCCAG
CTGCTGAAGGCACGGCGCATTCCAGTGCCGCAGAAGACAGAAAGGCCCTTCCGCAACCGT
CGTAGTTGCAACGCCGCCTCCTTGTTGTATGCTATCCAGCTATTGAGAGCGCGTGTGCAT
CCTCGC

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
WKSETAPRFIARRASARAAMLAVHALKLRRSLQRVQAVTARTTPERCLLRLSQLLRARRA
LRPSGENETSTAEIFCWVLLTPAFCCQLVMARLQARCKMRPTTLRKHARSCREDARIASQ
LLKARRIPVPQKTERPFRNRRSCNAASLLYAIQLLRARVHPR

No ORFs were found in reading frame 3.