ORF EO17910

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160107.1
Annotathon code: ORF_EO17910
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : madi
Annotated on : 2008-03-19 18:52:37
  • Beylard Emmanuelle
  • CATTENOZ diane

Synopsis

Genomic Sequence

>AACY01160107.1 ORF_EO17910 genomic DNA
CTTTAGCCATGCCTGTGAGGCTCTGATCGAGAGATTGCGTATAGCACGGGCGCGATTGATCACCCATATAGAACCAGCGATTCATGGTGTTTTCTATTTC
TGGCTGCGCTTTGACTTCGTCAACTAGTCTTTGTCGCATCGATGGGTCTCTTATTGCACGTACCCTTTCGCCAAATTCGAGTGCCCTTACTTCGTCCCAG
GCGGGTGTTCGAAAAAAGTTATCTGTGTATAAACCACCGACACCACCTCCGCTTCTAGGTACGGTTACCGAGGTCACGTTCAAACCCTCCGCTCGCATTG
CTGATACGCGTTCGTCGAGTCGTTCTTTTCCAATTTCTACTGCGCTGCTAAACAAAGCGCCCCGCGAGGCTCTTGCTTCGTCTGCGATGAGGTCCATTTC
TGCCTCGAAGTCATCGAAGTCAGAGACGGTTTGCATCAAACCTCCATGTTTGCCAACTTCTTTAGCGACCGCTCTCAGTTCATCGCGCTCCGCAAAAGTA
CCTGGGATTGAGCGCCCATCGGGTAGTCGATGCGGTGGAAATCGATTGGTAGAGAATCCTACAGCTCCTTCTTTGACCGATTGCCCAGCCAGTTCGGCTA
TTTGACGAATTTCGTCCGGGGTGGCTGCTTCTTCGACAGCACGTTCTCCCATCACGTAAAAGCGAGTGGCGCAGTGGCCGACCAGCCCACAAACATTGAT
TGATGGTCCGAGCTCCGATAGGGCGTCAAGGTAGCCGCCATAGGATGTCCAATTCCAAGGGAGACCATGCAGTATGGCGTTCTTAGGTATGTCCTCCACA
GTCTCCATCATCCCCGCTAGGAATTCACGATCCGATTCTTTACAGGGCGCGAAAGTGACGCCGCAGTTGCCAAAC

Translation

[2 - 874/875]   indirect strand
>ORF_EO17910 Translation [2-874   indirect strand]
FGNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINVCGLVGHCATRFYVMGERAVEEAATPDEIRQIAELAGQSV
KEGAVGFSTNRFPPHRLPDGRSIPGTFAERDELRAVAKEVGKHGGLMQTVSDFDDFEAEMDLIADEARASRGALFSSAVEIGKERLDERVSAMRAEGLNV
TSVTVPRSGGGVGGLYTDNFFRTPAWDEVRALEFGERVRAIRDPSMRQRLVDEVKAQPEIENTMNRWFYMGDQSRPCYTQSLDQSLTGMAK

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

9 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


    +-------------------------------------ORF       
  +-1 
  ! +-------------------------Frank  [Actinobactérie]
  ! 
  !   +--------------Psychro  [Flavobactérie]
  2---3 
  !   !  +-------------------BordeBronc  [Béta-protéobactérie]
  !   +--4 
  !      ! +-----------------------gammaprote  [Gamma-protéobactérie]
  !      +-5 
  !        ! +---------------------Mycobac  [Actinobactérie]
  !        +-7 
  !          ! +------------------------Strepto  [Actinobactérie]
  !          +-6 
  !            +-------------------Burkho  [Béta-protéobactérie]
  ! 
  +---------------------------------------------------------Pyrococcus


remember: (although rooted by outgroup) this is an unrooted tree!

Between        And            Length
-------        ---            ------
   2             1            0.07471
   1          ORF             1.25979
   1          FrankActin      0.83421
   2             3            0.10962
   3          PsychroFla      0.49653
   3             4            0.09330
   4          BordeBronc      0.64167
   4             5            0.04026
   5          gammaprote      0.78940
   5             7            0.07880
   7          MycobacAct      0.72569
   7             6            0.03331
   6          StreptoAct      0.81038
   6          BurkhoBeta      0.66552
   2          Pyrococcus      1.91154


--------------------------------------------------------------------------------Arbre(s) sous forme parenthésée issus de neighbor :
((ORF:1.25979,FrankActin:0.83421):0.07471,(PsychroFla:0.49653,
(BordeBronc:0.64167,(gammaprote:0.78940,(MycobacAct:0.72569,
(StreptoAct:0.81038,BurkhoBeta:0.66552):0.03331):0.07880):0.04026):0.09330):0.10962,Pyrococcus:1.91154);


Annotator commentaries

Cette séquence est codante,incomplète en 5' et 3'.Elle a une longueur de 291 aa.

Concernant le poids moléculaire :

Notre ORF n'ayant ni codon d'initiation (il manquerait environ 85 aa en Nter), ni codon stop (il manquerait environ 180 aa en C-ter), son poids moléculaire ne peut pas être significatif, c'est pourquoi nous ne l'avons pas notifié.

Concernant le blast:

Nous avons commencé par faire un blast p vs Swissprot : les résultats obtenus n'étaient pas satisfaisants en quantité et en qualité (E-values non significatives). Nous avons donc fait un blast p vs NR, sur lequel nous nous sommes appuyé pour faire notre arbre, car nous avons obtenus de nombreuses séquences présentant des E-values significatives.

Concernant l'alignement multiple:

Notre séquence et celle de Frankia (séquence présentant la E-value la plus signifivative) sont similaires sur 363 aa.

Nous avons fait un premier arbre en prenant toutes les séquences (environ 20) présentant les E-values les plus significatives pour savoir où se plaçait notre ORF. Nous avons pu exclure les alpha-protéobactéries de notre groupe d'étude compte-tenu de leur position excentrée par rapport à notre ORF.

Ainsi notre groupe d'étude se constitue d'actinobactéries, de béta-protéobactéries et de gamma-protéobactéries.Ce groupe d'étude ne nous parait pas pertinent du fait de la présence d'organismes appartenant à des espèces aussi différentes que les actinobactéries et les protéobactéries. Cependant nous n'avons pas été en mesure de constituer un groupe d'étude plus homogène. Au regard du blast et des différents arbres, notre séquence semblerait s'apparenter aux actinobactéries. Nous n'avons pas pu charger plus notre arbre en actinobactéries, car nous ne disposions pas de plus d'espèces que celles présentes dans notre arbre ( séquences retrouvées en double ou en triple dans les résultats du Blast).

Nous avons tenté plusieurs arbres différents en essayant de changer plusieurs séquences de notre groupe d'étude, ainsi qu'en modifiant notre groupe extérieur (nous avons essayé avec : -Pyrococcus abyssi GE5 - Euryarchae -Candidatus kuenenia stuttqartiensis - Planctomycetes -Solibacter usitatus Ellin6076 - Eubactérie). Nous vous soumettons celui qui nous semble le plus correct. Dans celui- ci notre groupe extérieur est représenté par Pyrococcus abyssi GE5 qui fait partie de la famille des Archaes.

Concernant les orthologues :

Nous avons classé les orthologues du plus proche au plus éloigné de notre ORF. Ainsi,le plus proche est une actinobactérie du nom de Frankia, puis vient Psychroflexus torquis, Bordetella bronchiseptica ...


Concernant les domaines protéiques :

Nous avons soumis notre ORF à la banque Interpro: notre séquence présente un domaine protéique ayant une activité catalytique d'hydrolase : metallo dependent hydrolase.

Concernant la fonction moléculaire et le processus biologique :

Notre séquence semblerait correspondre à une amino-hydrolase qui a pour rôle de catalyser l'hydrolyse d'un N-acyl-D-amino acide en produisant le D-amino acide corrrespondant. Cette fonction servirait à produire des intermédiaires utilisés pour la synthèse de pesticides, de peptides bioactifs et d'antibiotiques. Notre ORF semblerait donc impliqué,entre autres, dans le métabolisme de biosynthèse des protéines.

Concernant le symbole gène :

Nous avons consulté les fiches NR de nos orthologues et nous n'avons pas identifié de "symbole gene". Nous avons alors consulté les fiches Swissprot, mais aucun de nos orthologues n'y figure. Ainsi nous ne pouvons vous en proposer un pour notre séquence.


Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


BordeBronch               -------MHDEQALDLVIRGGLLMDGHGGAPRVADIGVRGALIAEIGDIAPGAAAEIDAR
Psychro                   ---MDGLNREINDFDLIIKNGTLVDGTGAKSKPGNIAIKNGIIAAIGHFSGKANEIIDAT
gammaproteo               -----------MDYDLKITGGLVYDGDGGEPRKADVAVRNGTIVAVGDCAGDARETIDAR
Mycobac                   ---MGSPYIRGMTYDLVIRGGTVVDGLGGAPFTGDVAVRGGVIVSVGTVDAAGAREIDAT
Burkho                    MSIPARSKLQAADFDVVIRSGTIVDGSGGPSYVADLAIRDGKIVRIGRIAERGVEEIDAT
Strepto                   ------------MHDLIIRNGSLCDGSGIPVRTGDVAVNHGVITRVGRVPGRGRTEIDAG
Frank                     ------------MHDIVIYGGEVVDGTGSPPRRADVAIDGERITAVGEVGERGRRQIDAR
ORF                       ------------------------------------------------------------
Pyrococcus                ----------MVEYDIVIKNGKIVDGTGNPWFRTDIGIKDGKIVKIGKIKEDGQVTIDAS
                                                                                      

BordeBronch               GKIVTPGFVDIHTHYDGQIIWNSRLAPSSWHGVTTVVMGNCGVGFAPVRAADRGNLIELM
Psychro                   NLVVTPGFVDIHTHYDGQAIWDSQLKPSSIHGVTTVVMGNCGVGFAPCKPEDRVKLVELM
gammaproteo               GHIVTPGFIDLHTHYDGQVSWDAGMQPSVNHGVSTVVMGSCGVGFAPVREADREKLIRLM
Mycobact                  GLLVTPGFVDLHTHYDGQAIWSDRLTPSSAHGVTTAVMGNCGVGFAPCRPADHDVLVDVM
Burkho                    GQIVTPGFVDIHTHYDGQVTWETRLSPSSNHGVTTVLTGNCGVGFAPCRSTQRDTLVKVM
Strepto                   GHLVTPGFVDIHTHFDGQVSWDPQLTPSCWHGVTSVVMGNCGVGFAPAQPDRHDWLIGLM
Frank                     GRLVTPGFVDIHTHLDAQLFWDPVASPSSWHGVTSIVLGNCGVTFAPVRPGEQRYLAEMM
ORF                       -------------------------------------FGNCGVTFAPCKESDREFLAGMM
Pyrococcus                NLIVAPGFIDMHAHDDLIFFKDRFNRAKLLQGVTTVVSGNCGISVAPVNEEMLDVLKSYV
                                                                *.**: .** .      *   :

BordeBronchi              EGVEDIPGIALHEGLDWAWETFPDFLRATERI-EHDIDFCAQLPHAALRVYVMGERALRL
Psychro                   EGVEDIPAPVMHEGLNWQWETFEEYIKALEKN-KLDIDICALLPHAALRVYVMGERAIKH
gammaproteo               EGVEDIPGIALAEGLTWDWETLPEYMDALDAK-PHSIDFAVQVTHDPLRVYVMGDRAVCN
Mycobac                   AGVEDIPGVVMVDGLPWHWETFPEFLDALDAG-ARDIDVAAFLPHSPLRVYVMGRRGVDR
Burkho                    EGVEDIPEIVMTEGIPWNWETFPEYLDTLKAR-RYDIDFATQVPHSAIRVYVMND---GD
Strepto                   EGVEDIPGASLSEGITWEWETFPEYLDAVERL-PRVMDVAAQVPHGALRAYVMGDRGAAN
Frank                     ESVEDIPADTIMDGIDWSWESYGDYLKALGRR-QLGVNVGGMIGHCALRYYVMGARSLDE
ORF                       ETVEDIPKNAILHGLPWNWTSYGGYLDALSEL-GPSINVCGLVGHCATRFYVMGER-AVE
Pyrococcus                G--------ILGKEVEFKWRSYGEFLDALEEVGPLGTNFVGLVGHGTLRIAVMGMEA---
                                    : . : : * :   :: :         :.   : * . *  **.      

BordeBronchi              EMATPEDIARMRSLAAEAMRHGAIGFSTSRSINHRSVTGDPMPSLRAAEEELTGIAMGLA
Psychro                   EVATKADMQIMRKLAKEAVEAGAFGFSTSRTISHKSLKGEYTPTLRAHEDELTAIAMGLA
gammaproteo               EPATETDIAAMRRITREALEAGAIGFSTGRSDVHRSADGEWTPSSEATTEELAGIASAFS
Mycobac                   EPAGPEDLAMMRKLAAEAVQAGALGFASSRFTLHKTESGRPIPSYDADRAEIEAIARGVD
Burkho                    GPPDAAQLRQMTEIVRDAIRAGAFGVSSSQHAGHRTVEGDLAPSVKAATDELFALAEGLK
Strepto                   EPPTEEDLRRMCALVRQGLQAGAIGFSTSRTVTHLAITGDPVPGTFAAEDELFALGGVLG
Frank                     APATDEDIARMAAVVGEAIDGGALGFSTSRSFMHTVPDGRAVPGTYALEAELAAIAGALA
ORF                       EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDGRSIPGTFAERDELRAVAKEVG
Pyrococcus                RDPTEEELGRMKELLAKSMEEGAFGMSSG---------LIYPPGVYSKTWELIELAMVVA
                            .   ::  :  :  ..:  **.*.::.             *   :   *:  :.  . 

BordeBronchiBeta          DAGGGVLEIIIDFDDPD----MLEAEFGMMRRLVEKS-GRPLSFSLMQKHGNKDGWRRLL
PsychroFlavobactérie      DAGSGFIEIVSDWNEP-----DPETEFEVLKRIVKRS-GRPLVFSCTQRHDRPHFWEDLM
gammaproteoGamma          GLSHGILQAVNDFDLEREG-DAFDKEFDILESMAKAGEGRPFSLSLMQRDFAPDQWRRII
MycobacActino             DAGGGLIQFVPDLVAG------DYEPVLQTVFDVAADVGLPVTFTLAIGNAGDPFFLDAL
BurkhoBeta                EADGGVFQVITDGYSAK----SDAAKQMALIRRIAEISGRPVSYSLLQKDHCVDLPEAML
StreptoActino             EVGTGVFQLVPLGAGGEK--VDDPLGEIKWMRRLSAAVGRPITFGLFQNDNDPDGWRELL
FrankActino               SRGRGTIEVVPRIGERDGPERQNSVAELAWMEEVSRASGRPLTFAIMQSDRRPGLWSWVM
ORF                       KHG-GLMQTVSDFDDFEA-------EMDLIADEARASRGALFSSAVEIGK------ERLD
PyrococcusArchae          KYGGIYSTHMRDEGNR-----VIEALEEAIRIGRESGVRVEVSHHKVSGRKNWGKSRKTL
                            .      :                               .                  

BordeBronchiBeta          ALTAQAAADGLPIRAQVAPRGVGVLLGLQGSRNVFSDCASYKAIAQLALDERVRRMRDPA
PsychroFlavobactérie      AMARKAQKE---------------------------------------------------
gammaproteoGamma          ERAEKAEAKGVSMRLQTAPRGIGVITGLQCTFHPFIGFPSYKAICDLPLEQRVARMREPE
MycobacActino             RMVEKANSNGGHISAQIFPRPIGLMLGLELSGNPFVMYPSYREIAALPLAERVAQMRKPE
BurkhoBeta                ALNRHAQADGLPIRAQVFPRPVGLMFGLGLSFHPFRFRPSYEAIHALPLDQRVAAMRDPA
StreptoActino             QVAEDAVASGADLHPQVAGRPFSIIISLDS-THPFRRRPSYKRIAHLPAAERRAAMRDPA
FrankActino               DEVAAARGRGADLRPQTAARGSGILYGLVG-RTPYDALPGWAKFMEQPWAERLAALRDAE
ORF                       ERVSAMRAEGLNVTSVTVPRSGGGVGGLYT--DNFFRTPAWDEVRALEFGERVRAIRDPS
PyrococcusArchae          ALIEKARNEGIEITLDVYPYTAGSTYLAALLPPWVHESGKIKER-----------CRDEE
                                                                                      

BordeBronchiBeta          LRAQLLRELRESQDTP-----------LGKRLNEFDNIFPLGNPPCYDPGPERSIAALAR
PsychroFlavobactérie      ------------------------------------------------------------
gammaproteoGamma          FKAQILTEESEKLAGDGTPVPPIVDALMAAIDYVASKTFLLGENPEYEQGAETSVLHMAE
MycobacActino             VRERILNDKPESDGHP-----------LMFAAQAWNYMFPLGEPPNYEPSPSDSIGARAQ
BurkhoBeta                RRRAILSETPAHPNPV-----------FVNIVKDFEDSFVLGDPPNYEPTPDQSIRAQAR
StreptoActino             LREKILGEAPDDADPRS----------SLFPQGYERHFPMKANQPDYEPGADESFDAIAR
FrankActino               VRRALVEEAENPVELSG----------PLAPKDPSKLYLLPPGPARYDVDPGNSLAAEAA
ORF                       MRQRLVDEVKAQPEIEN--------------TMNRWFYMGDQSRPCYTQSLDQSLTGMAK
PyrococcusArchae          TRKKIREFIETRDDWQN------------FIKEAGWENIIITHSENFPEFVGKSLKEISD
                                                                                      

BordeBronchiBeta          RAGADPAELAYDCLLEEDGKALLFSPFANYADQNLDACAQMLADPNTVIGLGDGGAHVAL
PsychroFlavobactérie      ------------------------------------------------------------
gammaproteoGamma          EKGVSSLEMIYDLLLEEEGRALLYFPIYNYTNMNFDNVYEMMKHPQSIMGLSDGGAHVGT
MycobacActino             ARGVSPLEEAYDRLLDDDGHAMLLVTLANFRDGSLDTVAELIRRDDVVLGLGDGGAHYGM
BurkhoBeta                RTGTPPAELVYDLLLERDGTAILLAPSSNYSEGDLEAVRRMMVDDNTLLALGDGGAHYGM
StreptoActino             RTGQNPETLIYDFLTSEDTSGMIFRPLLGYSEYTLDPIREMLLHPQAVLGLSDAGAHCRL
FrankActino               RRGVSPAAAFLACTLETDGRGLLYYPVLN---QDLDAVAAMITNPDVVVGVGDAGAHVAL
ORF                       ------------------------------------------------------------
PyrococcusArchae          LLHRDPFDVLFDILAKDGTNAGMIVFLMS-----EEDVERILSHPYSMIGTDGLDSGEGL
                                                                                      

BordeBronchiBeta          ISDASFPTFLLKHWGGGAGR-PAFDLPWLVKRQTADTARAVGLHDRGVLEVGKKADINVI
PsychroFlavobactérie      ------------------------------------------------------------
gammaproteoGamma          ICDSSFPSYLLTYWARDRDRGGKLELSEAIRRLTSDIADYCGMADRGRIKVGLKANINII
MycobacActino             ICDASFPTYMLTHWVRDRAT-GRLSVQDAVRELTSVPARVAGLADRGRIAVGYKADLNVI
BurkhoBeta                ICDSSYPTTVLSYWTRDRPE-GRVSLEWAVNKLSRRNALAIGLTDRGLLAEGMKADINVI
StreptoActino             ICDASTPTSMLTHWVRDRSRGARLPLEFVVKKQTWEPAQLYGLRDRGLLRPGYRADINII
FrankActino               TMDAGQPTFLLRHWVRDRGL---LDVGTAVRKLSSEGAELFGLADRGVLKPGAFADVNVI
ORF                       ------------------------------------------------------------
PyrococcusArchae          PHPRAYGTFPRVLGRYVREK-KLLRLEDAIRKMTSLPALKLGLKDRGLVKEGMWADLVIF
                                                                                      

BordeBronchiBeta          DPATIDPGVPVMNMDLPAGKGRYLQKPSGYVATIVSGVVVYRDAAATGALPGRLVRMAAE
PsychroFlavobactérie      ------------------------------------------------------------
gammaproteoGamma          DFKNLRLYAPRMVQDLPAGGQRLLQDASGYRAVIVDGETVLENDQLTGKHPGRLYRAGQQ
MycobacActino             DADALTLHKPVIVNDLPAGGRRLDQTADGYVATIVSGEVIAENGQPTAARPGKLIRGRQP
BurkhoBeta                DYANLTLHAPHPVHDLPAGGRRLVQSADGYTATLVNGVITYRDGQPTGALPGRLLRSGDY
StreptoActino             DLDRLSLRSPEFVHDLPAGGGRLIQKADGYVATVVAGEITFREGEATGALPGRLVRGTRS
FrankActino               DLDRLDLDTPEMLADFPHGANRFVQRARGYDYTLVNGCVLIEGDELTEERPGRIVTA---
ORF                       ------------------------------------------------------------
PyrococcusArchae          DPHRVKDRATYTNPRLPP---------DGIKYVIVNGVLSVENGELTGDAGGVVIRRTS-
                                                                                      

BordeBronchiBeta          PAAA--
PsychroFlavobactérie      ------
gammaproteoGamma          AMESAA
MycobacActino             APASA-
BurkhoBeta                A-----
StreptoActino             GPVVL-
FrankActino               ------
ORF                       ------
PyrococcusArchae          ------
                                

BLAST

Blast vs NR : 



Sequences producing significant alignments:                       (Bits)  Value

gi|68232257|ref|ZP_00571409.1|  Amidohydrolase [Frankia sp. EA...   159    2e-37
gi|114570191|ref|YP_756871.1|  Amidohydrolase 3 [Maricaulis ma...   157    5e-37 
gi|114798786|ref|YP_762196.1|  amidohydrolase family protein/D...   153    1e-35 
gi|83859220|ref|ZP_00952741.1|  hypothetical protein OA2633_12...   150    7e-35
gi|90201504|ref|ZP_01204150.1|  Amidohydrolase:Amidohydrolase-...   149    1e-34
gi|94495249|ref|ZP_01301830.1|  hypothetical protein SKA58_021...   148    3e-34
gi|33601761|ref|NP_889321.1|  hypothetical protein BB2785 [Bor...   148    3e-34 
gi|89338748|ref|ZP_01191513.1|  Amidohydrolase-like [Mycobacte...   146    1e-33
gi|33597284|ref|NP_884927.1|  hypothetical protein BPP2713 [Bo...   145    3e-33 
gi|85374289|ref|YP_458351.1|  hypothetical protein ELI_07310 [...   143    8e-33 
gi|88704218|ref|ZP_01101932.1|  D-aminoacylase [gamma proteoba...   141    3e-32
gi|87201100|ref|YP_498357.1|  D-aminoacylase-like [Novosphingo...   140    9e-32 
gi|87199453|ref|YP_496710.1|  hypothetical protein Saro_1432 [...   138    4e-31 
gi|27376115|ref|NP_767644.1|  hypothetical protein bll1004 [Br...   137    5e-31 
gi|78698635|ref|ZP_00863136.1|  conserved hypothetical protein...   137    6e-31
gi|78060699|ref|YP_367274.1|  Amidohydrolase-like [Burkholderi...   135    3e-30 
gi|73539075|ref|YP_299442.1|  hypothetical protein Reut_B5252 ...   135    3e-30 
gi|85708872|ref|ZP_01039938.1|  hypothetical protein NAP1_0651...   133    8e-30
gi|118472407|ref|YP_885286.1|  amidohydrolase family protein [...   131    3e-29 
gi|91782245|ref|YP_557451.1|  hypothetical protein Bxe_A3590 [...   128    2e-28 
gi|83744454|gb|ABC42544.1|  unknown [Streptomyces hygroscopicus]    128    3e-28
gi|91222020|ref|ZP_01257605.1|  hypothetical protein P700755_3...   128    4e-28
gi|16127690|ref|NP_422254.1|  hypothetical protein CC3460 [Cau...   126    1e-27 
gi|118569188|gb|ABL03939.1|  D-amino acid aminohydrolase [Mycobac   125    3e-27
gi|118462929|ref|YP_883830.1|  amidohydrolase family protein [...   124    4e-27 
gi|41410038|ref|NP_962874.1|  hypothetical protein MAP3940c [M...   124    4e-27 
gi|92909188|ref|ZP_01277966.1|  D-aminoacylase-like [Mycobacte...   123    9e-27
gi|41410412|ref|NP_963248.1|  hypothetical protein MAP4314 [My...   122    3e-26 
gi|118462826|ref|YP_884389.1|  amidohydrolase family protein, ...   121    3e-26 
gi|118053765|ref|ZP_01522308.1|  Amidohydrolase 3 [Comamonas t...   120    1e-25
gi|92915996|ref|ZP_01284617.1|  D-aminoacylase-like [Mycobacte...   119    1e-25
gi|92909511|ref|ZP_01278288.1|  D-aminoacylase-like [Mycobacte...   119    1e-25
gi|89361972|ref|ZP_01199784.1|  conserved hypothetical protein...   119    1e-25
gi|89341023|ref|ZP_01193269.1|  Amidohydrolase [Mycobacterium ...   119    1e-25
gi|90204394|ref|ZP_01207037.1|  Amidohydrolase [Mycobacterium ...   115    3e-24
gi|29830342|ref|NP_824976.1|  D-aminoacylase [Streptomyces ave...   111    4e-23 
gi|114797339|ref|YP_761107.1|  amidohydrolase family protein [...   105    3e-21 
gi|68227645|ref|ZP_00566851.1|  putative D-aminoacylase [Frank...  94.4    6e-18
gi|14520359|ref|NP_125834.1|  d-aminoacylase (aspartate, gluta...  78.6    4e-13 
gi|103486952|ref|YP_616513.1|  N-acyl-D-amino-acid deacylase [...  75.5    3e-12 
gi|88806174|ref|ZP_01121692.1|  N-acyl-D-amino-acid deacylase ...  71.2    6e-11
gi|91201435|emb|CAJ74495.1|  silmilar to D-aminoacylase [Candi...  70.9    8e-11
gi|118470717|ref|YP_885579.1|  N-acyl-D-aspartate deacylase [M...  69.7    1e-10 
gi|116622646|ref|YP_824802.1|  D-aminoacylase domain protein [...  68.2    5e-10 
gi|90573406|ref|ZP_01229921.1|  hypothetical protein CdifQ_020...  67.8    6e-10
gi|115251912|emb|CAJ69747.1|  putative D-aminoacylase [Clostridiu  65.9    2e-09
gi|88706122|ref|ZP_01103829.1|  d-aminoacylase [gamma proteoba...  65.1    4e-09
gi|110601091|ref|ZP_01389293.1|  N-acyl-D-aspartate deacylase ...  64.3    6e-09
gi|69284217|ref|ZP_00616165.1|  N-acyl-D-amino-acid deacylase ...  63.5    1e-08
gi|3287876|sp|P72349|NDAD_ALCXX  D-aminoacylase (N-acyl-D-amin...  62.4    3e-08
gi|28948588|pdb|1M7J|A  Chain A, Crystal Structure Of D-Aminoa...  62.4    3e-08 
gi|48425342|pdb|1RJP|A  Chain A, Crystal Structure Of D-Aminoa...  62.0    3e-08 
gi|48425343|pdb|1RJQ|A  Chain A, The Crystal Structure Of The ...  62.0    3e-08 
gi|48425875|pdb|1V4Y|A  Chain A, The Functional Role Of The Bi...  62.0    4e-08 
gi|32471748|ref|NP_864741.1|  D-aminoacylase [Rhodopirellula b...  60.8    6e-08 
gi|83859044|ref|ZP_00952565.1|  hypothetical protein OA2633_11...  60.1    1e-07
gi|37545840|gb|AAM96826.1|  N-acyl-D-amino acid amidohydrolase [V  60.1    1e-07
gi|118469914|ref|YP_888080.1|  D-aminoacylase [Mycobacterium s...  59.3    2e-07 
gi|111019452|ref|YP_702424.1|  probable N-acyl-D-amino-acid de...  58.9    3e-07 
gi|116695153|ref|YP_840729.1|  N-Acyl-D-Amino Acid Deacylase [...  58.9    3e-07 
gi|106885980|ref|ZP_01353330.1|  N-acyl-D-glutamate deacylase ...  58.5    4e-07
gi|94970862|ref|YP_592910.1|  D-alanyl-D-alanine carboxypeptid...  58.5    4e-07 
gi|48374197|gb|AAT41901.1|  putative d-aminoacylase [Fremyella di  58.5    4e-07
gi|41409079|ref|NP_961915.1|  hypothetical protein MAP2981c [M...  58.5    4e-07 
gi|71366212|ref|ZP_00656757.1|  N-acyl-D-glutamate deacylase [...  58.2    5e-07
gi|15610050|ref|NP_217429.1|  POSSIBLE D-AMINO ACID AMINOHYDRO...  57.0    1e-06 
gi|89069229|ref|ZP_01156596.1|  Amidohydrolase [Oceanicola gra...  56.6    1e-06
gi|111613700|ref|ZP_01400780.1|  N-acyl-D-amino-acid deacylase...  56.2    2e-06
gi|111018529|ref|YP_701501.1|  N-acyl-D-glutamate deacylase [R...  56.2    2e-06 
gi|94314012|ref|YP_587221.1|  D-aminoacylase-like protein [Ral...  56.2    2e-06 
gi|111611070|ref|ZP_01398159.1|  D-aminoacylase [Verminephroba...  56.2    2e-06
gi|23126238|ref|ZP_00108140.1|  COG3653: N-acyl-D-aspartate/D-...  56.2    2e-06
gi|116622724|ref|YP_824880.1|  N-acyl-D-amino-acid deacylase [...  55.8    2e-06 
gi|92112226|ref|YP_572154.1|  N-acyl-D-amino-acid deacylase [C...  55.5    3e-06 
gi|116695068|ref|YP_840644.1|  N-Acyl-D-amino-acid deacylase [...  55.5    3e-06 
gi|118466776|ref|YP_882940.1|  N-acyl-D-glutamate amidohydrola...  55.1    4e-06 
gi|90575888|ref|ZP_01232363.1|  hypothetical protein CdifQ_020...  55.1    4e-06
gi|83950583|ref|ZP_00959316.1|  d-aminoacylase (aspartate, glu...  54.7    6e-06
gi|83590149|ref|YP_430158.1|  N-acyl-D-amino-acid deacylase [M...  53.9    1e-05 
gi|88944079|ref|ZP_01147412.1|  N-acyl-D-amino-acid deacylase ...  53.5    1e-05
gi|118569727|gb|ABL04478.1|  D-amino acid aminohydrolase [Mycobac  53.5    1e-05
gi|84502478|ref|ZP_01000614.1|  probable n-acyl-d-glutamate de...  53.1    1e-05
gi|114763157|ref|ZP_01442583.1|  N-acyl-D-amino-acid deacylase...  53.1    1e-05
gi|71279716|ref|YP_269405.1|  amidohydrolase family protein [C...  53.1    2e-05 
gi|116696060|ref|YP_841636.1|  N-Acyl-D-aspartate/D-glutamate ...  52.8    2e-05 
gi|89055736|ref|YP_511187.1|  N-acyl-D-amino-acid deacylase [J...  52.0    3e-05 
gi|88859506|ref|ZP_01134146.1|  Amidohydrolase [Pseudoalteromo...  52.0    3e-05
gi|90415666|ref|ZP_01223600.1|  hypothetical protein GB2207_10...  52.0    4e-05
gi|94969636|ref|YP_591684.1|  N-acyl-D-amino-acid deacylase [A...  51.6    5e-05 
gi|118472578|ref|YP_890362.1|  N-acyl-D-glutamate amidohydrola...  51.6    5e-05 
gi|73537853|ref|YP_298220.1|  N-acyl-D-amino-acid deacylase [R...  51.2    6e-05 
gi|29829824|ref|NP_824458.1|  D-aminoacylase [Streptomyces ave...  51.2    6e-05 
gi|84355751|ref|ZP_00980625.1|  COG3653: N-acyl-D-aspartate/D-...  50.8    7e-05
gi|67547194|ref|ZP_00425100.1|  N-acyl-D-amino-acid deacylase ...  50.4    1e-04
gi|89899782|ref|YP_522253.1|  N-acyl-D-amino-acid deacylase [R...  50.1    1e-04 
gi|90578685|ref|ZP_01234495.1|  probable N-acyl-D-glutamate de...  49.7    2e-04
gi|89076049|ref|ZP_01162412.1|  probable N-acyl-D-glutamate de...  49.7    2e-04
gi|94313364|ref|YP_586573.1|  D-aminoacylase-like protein [Ral...  49.7    2e-04 
gi|91786568|ref|YP_547520.1|  N-acyl-D-amino-acid deacylase [P...  49.3    2e-04 
gi|3287879|sp|P94212|NDDD_ALCXX  N-acyl-D-aspartate deacylase ...  49.3    2e-04
gi|27367023|ref|NP_762550.1|  N-acyl-D-aspartate/D-glutamate d...  48.5    4e-04 
gi|83719564|ref|YP_441103.1|  N-acyl-D-amino-acid deacylase fa...  48.5    4e-04 
gi|54026483|ref|YP_120725.1|  hypothetical protein nfa45100 [N...  48.5    4e-04 
gi|84386136|ref|ZP_00989165.1|  probable N-acyl-D-glutamate de...  48.1    4e-04
gi|118040297|ref|ZP_01511693.1|  D-aminoacylase-like [Burkhold...  47.8    7e-04
gi|109644929|ref|ZP_01368849.1|  Amidohydrolase 3 [Desulfitoba...  47.4    7e-04
gi|89894550|ref|YP_518037.1|  hypothetical protein DSY1804 [De...  47.4    7e-04 
gi|90409783|ref|ZP_01217800.1|  hypothetical deacylase [Photob...  47.4    8e-04
gi|108759509|ref|YP_630444.1|  hypothetical protein MXAN_2223 ...  47.4    8e-04 
gi|107023675|ref|YP_622002.1|  N-acyl-D-amino-acid deacylase [...  47.4    8e-04 
gi|37676805|ref|NP_937201.1|  probable N-acyl-D-glutamate deac...  47.0    0.001 
gi|71068206|gb|AAZ23061.1|  probable D-aminoacylase [Streptomyces  47.0    0.001
gi|91790639|ref|YP_551591.1|  N-acyl-D-amino-acid deacylase [P...  46.6    0.001 
gi|66043682|ref|YP_233523.1|  N-acyl-D-amino-acid deacylase [P...  46.6    0.001 
gi|118044760|ref|ZP_01513461.1|  Amidohydrolase 3 [Burkholderi...  46.6    0.002
gi|89899734|ref|YP_522205.1|  N-acyl-D-amino-acid deacylase [R...  46.6    0.002 
gi|1581022|prf||2116330A  N-acyl-D-Glu amidohydrolase              46.2    0.002
gi|54301697|ref|YP_131690.1|  hypothetical deacylase [Photobac...  46.2    0.002 
gi|88706042|ref|ZP_01103750.1|  D-aminoacylase family protein ...  46.2    0.002
gi|3287878|sp|P94211|NDED_ALCXX  N-acyl-D-glutamate deacylase ...  45.8    0.002
gi|83950030|ref|ZP_00958763.1|  N-acyl-D-amino acid deacylase ...  45.4    0.003
gi|115252239|emb|CAJ70079.1|  D-aminoacylase [Clostridium diffici  45.4    0.003
gi|99908613|ref|ZP_01316282.1|  hypothetical protein Bpse1_030...  45.4    0.003
gi|53718273|ref|YP_107259.1|  D-aminoacylase [Burkholderia pse...  45.4    0.003 
gi|100124982|ref|ZP_01330401.1|  hypothetical protein BpseS_03...  45.4    0.003
gi|67739050|ref|ZP_00489656.1|  COG3653: N-acyl-D-aspartate/D-...  45.4    0.003
gi|88711428|ref|ZP_01105516.1|  amidohydrolase family protein ...  45.4    0.003
gi|84362911|ref|ZP_00987522.1|  COG3653: N-acyl-D-aspartate/D-...  45.1    0.004
gi|118070856|ref|ZP_01539054.1|  N-acyl-D-glutamate amidohydro...  45.1    0.004
gi|118073885|ref|ZP_01542060.1|  Amidohydrolase 3 [Shewanella ...  45.1    0.004
gi|90573200|ref|ZP_01229718.1|  hypothetical protein CdifQ_020...  45.1    0.004
gi|115352841|ref|YP_774680.1|  N-acyl-D-amino-acid deacylase [...  45.1    0.004 
gi|78356316|ref|YP_387765.1|  N-acyl-D-amino-acid deacylase [D...  44.3    0.007 
gi|118466719|ref|YP_882145.1|  N-acyl-D-glutamate amidohydrola...  44.3    0.007 
gi|116619882|ref|YP_822038.1|  N-acyl-D-amino-acid deacylase [...  44.3    0.007 
gi|28872230|ref|NP_794849.1|  N-acyl-D-amino acid deacylase fa...  44.3    0.007 
gi|41407576|ref|NP_960412.1|  hypothetical protein MAP1478 [My...  43.9    0.009 
gi|71734330|ref|YP_272708.1|  N-acyl-D-amino acid deacylase fa...  43.9    0.010 
gi|92907542|ref|ZP_01276322.1|  conserved hypothetical protein...  43.5    0.010
gi|54308465|ref|YP_129485.1|  Putative N-acyl-D-aspartate/D-gl...  43.5    0.012 
gi|115423498|emb|CAJ50032.1|  N-acyl-D-glutamate deacylase [Borde  43.5    0.013
gi|94313694|ref|YP_586903.1|  Amidohydrolase 3 [Ralstonia meta...  43.1    0.014 
gi|70734272|ref|YP_257912.1|  N-acyl-D-amino acid deacylase fa...  43.1    0.016 
gi|118471513|ref|YP_886361.1|  N-acyl-D-glutamate amidohydrola...  42.7    0.020 
gi|94494994|ref|ZP_01301575.1|  amidohydrolase family protein ...  42.7    0.020
gi|115359186|ref|YP_776324.1|  N-acyl-D-amino-acid deacylase [...  42.7    0.021 
gi|94500494|ref|ZP_01307025.1|  hypothetical protein RED65_155...  42.4    0.025
gi|92912721|ref|ZP_01281351.1|  conserved hypothetical protein...  42.4    0.027
gi|94500674|ref|ZP_01307204.1|  hypothetical protein RED65_042...  42.4    0.029
gi|33602261|ref|NP_889821.1|  N-acyl-D-glutamate deacylase [Bo...  42.0    0.036 
gi|90204392|ref|ZP_01207035.1|  conserved hypothetical protein...  42.0    0.036
gi|58271136|ref|XP_572724.1|  D-aminoacylase [Cryptococcus neo...  42.0    0.038 
gi|50256619|gb|EAL19342.1|  hypothetical protein CNBH0360 [Cry...  42.0    0.038
gi|84520150|ref|ZP_01007287.1|  COG3653: N-acyl-D-aspartate/D-...  41.6    0.040
gi|67738919|ref|ZP_00489541.1|  COG3653: N-acyl-D-aspartate/D-...  41.6    0.041
gi|53716937|ref|YP_105708.1|  hypothetical protein BMAA1042 [B...  41.6    0.041 
gi|53722144|ref|YP_111129.1|  hypothetical protein BPSS1116 [B...  41.6    0.041 
gi|83716453|ref|YP_439486.1|  N-acyl-D-glutamate amidohydrolas...  41.6    0.042 
gi|67647101|ref|ZP_00445348.1|  COG3653: N-acyl-D-aspartate/D-...  41.6    0.042
gi|83624999|ref|ZP_00935237.1|  COG3653: N-acyl-D-aspartate/D-...  41.2    0.051
gi|90414788|ref|ZP_01222756.1|  Putative N-acyl-D-aspartate/D-...  41.2    0.052
gi|76817516|ref|YP_335234.1|  hypothetical protein BURPS1710b_...  41.2    0.055 
gi|33592336|ref|NP_879980.1|  N-acyl-D-glutamate deacylase [Bo...  41.2    0.056 
gi|77456951|ref|YP_346456.1|  Amidohydrolase [Pseudomonas fluo...  40.8    0.077 
gi|107025694|ref|YP_623205.1|  N-acyl-D-amino-acid deacylase [...  40.8    0.080 
gi|116693124|ref|YP_838657.1|  N-acyl-D-amino-acid deacylase [...  40.8    0.085 
gi|78067537|ref|YP_370306.1|  N-acyl-D-amino-acid deacylase [B...  40.4    0.099 
gi|116694482|ref|YP_728693.1|  N-Acyl-D-amino-acid deacylase [...  40.0    0.13  
gi|113937013|ref|ZP_01422899.1|  N-acyl-D-glutamate deacylase ...  39.7    0.17 
gi|33596448|ref|NP_884091.1|  N-acyl-D-glutamate deacylase [Bo...  39.7    0.18  
gi|17549408|ref|NP_522748.1|  PROBABLE N-ACYL-D-GLUTAMATE DEAC...  39.7    0.18  
gi|78697027|ref|ZP_00861535.1|  D-aminoacylase [Bradyrhizobium...  39.3    0.21 
gi|21223359|ref|NP_629138.1|  D-aminoacylase [Streptomyces coe...  38.9    0.30  
gi|51894305|ref|YP_076996.1|  D-Aminoacylase [Symbiobacterium ...  38.9    0.31  
gi|116619202|ref|YP_821358.1|  N-acyl-D-amino-acid deacylase [...  38.5    0.40  
gi|83745626|ref|ZP_00942684.1|  D-aminoacylase [Ralstonia sola...  38.5    0.42 
gi|118069073|ref|ZP_01537321.1|  Amidohydrolase 3 [Serratia pr...  38.1    0.47 
gi|55376805|ref|YP_134656.1|  urease subunit [Haloarcula maris...  37.0    1.2   
gi|115422046|emb|CAJ48569.1|  D-aminoacylase [Bordetella avium 19  37.0    1.2  
gi|27363493|ref|NP_759021.1|  D-glutamate deacylase [Vibrio vu...  36.6    1.4   
gi|89341046|ref|ZP_01193292.1|  N-acyl-D-aspartate/D-glutamate...  36.6    1.4  
gi|89902544|ref|YP_525015.1|  GCN5-related N-acetyltransferase...  36.6    1.5   
gi|542474|pir||S42834  F40F12.5 protein - Caenorhabditis elegans   36.2    1.8  
gi|37520876|ref|NP_924253.1|  probable D-aminoacylase [Gloeoba...  36.2    1.9   
gi|25395946|pir||F88568  protein F40F12.5 [imported] - Caenorhabd  35.8    2.2  
gi|71985623|ref|NP_001022570.1|  F40F12.5 [Caenorhabditis eleg...  35.8    2.3   
gi|89100944|ref|ZP_01173791.1|  YyaA [Bacillus sp. NRRL B-1491...  35.8    2.6  
gi|67639245|ref|ZP_00438125.1|  COG3653: N-acyl-D-aspartate/D-...  35.8    2.7  
gi|91781787|ref|YP_556993.1|  N-acyl-D-amino-acid deacylase [B...  35.4    2.9   
gi|58039630|ref|YP_191594.1|  D-glutamate deacylase [Gluconoba...  35.0    4.2   
gi|114765514|ref|ZP_01444622.1|  phenylalanyl-tRNA synthetase ...  34.7    5.1  
gi|27367117|ref|NP_762644.1|  D-glutamate deacylase [Vibrio vu...  34.3    6.7   
gi|77683559|ref|ZP_00799006.1|  N-acyl-D-amino-acid deacylase ...  34.3    7.8  
gi|118028061|ref|ZP_01499524.1|  Amidohydrolase 3 [Burkholderi...  33.9    8.6  
gi|88703317|ref|ZP_01101033.1|  D-aminoacylase [gamma proteoba...  33.9    9.0  
gi|83592376|ref|YP_426128.1|  Glu/Leu/Phe/Val dehydrogenase [R...  33.9    9.8   



>gi|68232257|ref|ZP_00571409.1|  Amidohydrolase [Frankia sp. EAN1pec]
 gi|68200130|gb|EAN14350.1|  Amidohydrolase [Frankia sp. EAN1pec]
Length=567

 Score =  159 bits (401),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 104/282 (36%), Positives = 162/282 (57%), Gaps = 20/282 (7%)

Query  1    FGNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSIN  60
             GNCGVTFAP +  ++ +LA MME+VEDIP + I+ G+ W+W SYG YL AL      +N
Sbjct  86   LGNCGVTFAPVRPGEQRYLAEMMESVEDIPADTIMDGIDWSWESYGDYLKALGRRQLGVN  145

Query  61   VCGLVGHCATRFYVMGERAVEEA-ATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPD  119
            V G++GHCA R+YVMG R+++EA AT ++I ++A + G+++  GA+GFST+R   H +PD
Sbjct  146  VGGMIGHCALRYYVMGARSLDEAPATDEDIARMAAVVGEAIDGGALGFSTSRSFMHTVPD  205

Query  120  GRSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFE--------AEMDLIADEARAS  170
            GR++PGT+A   EL A+A  +   G G ++ V    + +        AE+  + + +RAS
Sbjct  206  GRAVPGTYALEAELAAIAGALASRGRGTIEVVPRIGERDGPERQNSVAELAWMEEVSRAS  265

Query  171  RGALFSSAVEIGKER-------LDERVSAMRAEGLNVTSVTVPRSGGGVGGLYTDNFFRT  223
             G   + A+     R       +DE V+A R  G ++   T  R  G + GL     +  
Sbjct  266  -GRPLTFAIMQSDRRPGLWSWVMDE-VAAARGRGADLRPQTAARGSGILYGLVGRTPYDA  323

Query  224  -PAWDEVRALEFGERVRAIRDPSMRQRLVDEVKAQPEIENTM  264
             P W +     + ER+ A+RD  +R+ LV+E +   E+   +
Sbjct  324  LPGWAKFMEQPWAERLAALRDAEVRRALVEEAENPVELSGPL  365


>gi|114570191|ref|YP_756871.1|  Amidohydrolase 3 [Maricaulis maris MCS10]
 gi|114340653|gb|ABI65933.1|  Amidohydrolase 3 [Maricaulis maris MCS10]
Length=590

 Score =  157 bits (397),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 109/322 (33%), Positives = 169/322 (52%), Gaps = 35/322 (10%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP +E+D + L  +ME VEDIP  A+  GL W+W S+  YLDALS++  +I++
Sbjct  87   GNCGVGFAPVREADHDKLIKLMEGVEDIPGTALHEGLTWDWESFPDYLDALSKIPRTIDI  146

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
              +V H   R YVMG+RAV  E A   +I ++  L  ++++ GAVGF+T R   H+  DG
Sbjct  147  AAMVPHDPLRVYVMGDRAVHSEPANDADIAEMRRLTREALEAGAVGFATGRSDVHKTADG  206

Query  121  RSIPGTFAERDELRAVAKEV-GKHGGLMQTVSDFD------DFEAEMDLIADEARASRGA  173
               P + + R+EL  +AK   G   G++Q VSDF+      DF+ E  +IAD A+AS G 
Sbjct  207  EWTPSSESTREELTGIAKAFNGLDFGVVQAVSDFNLERGEQDFDDEWSIIADYAKAS-GR  265

Query  174  LFSSAV---EIGKE---RLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYTD--NFFRTPA  225
             FS ++   +   +   +L ER   ++ EG++      PR+ G   G       F   P+
Sbjct  266  PFSFSLMQRDFAPDQWLKLIERTETLKDEGVDARMQVAPRAIGVFLGFNCTFHPFMGYPS  325

Query  226  WDEVRALEFGERVRAIRDPSMRQRLVDEVKAQ----------------PEIENTMNRWFY  269
            +  +  L   ERV  ++DP+ + +++ E   +                  IE    ++F 
Sbjct  326  YKTIADLPLDERVTRMKDPAFKAQILSETTDKLSGPGSSVPPLADMLMEHIEFVAEKFFQ  385

Query  270  MGDQSRPCYTQSLDQSLTGMAK  291
            +G+   P Y QS + SL   A+
Sbjct  386  LGNP--PDYEQSGENSLAARAR  405


>gi|114798786|ref|YP_762196.1|  amidohydrolase family protein/D-aminoacylase domain protein [Hyphomonas 
neptunium ATCC 15444]
 gi|114738960|gb|ABI77085.1|  amidohydrolase family protein/D-aminoacylase domain protein [Hyphomonas 
neptunium ATCC 15444]
Length=579

 Score =  153 bits (386),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 143/270 (52%), Gaps = 12/270 (4%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPCK  D + L  +ME VEDIP   +  GLPW W S+  YLD LS      +V
Sbjct  89   GNCGVGFAPCKTEDHDRLIRLMEGVEDIPFPVLSQGLPWAWESFPDYLDFLSTRRFDTDV  148

Query  62   CGLVGHCATRFYVMGER-AVEEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
            C  + H A R +VMG+R A  E ATP++I  +A+LA ++V  GA+GF+T+R   HR  DG
Sbjct  149  CAQLPHAALRVFVMGDRGANREDATPEDIAAMAKLAKEAVIAGAMGFTTSRTLNHRTSDG  208

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDL----IADEARASRGALF  175
            +  P   A   EL  +   + + G G++Q VSDFDD + E  +    +    R    +L 
Sbjct  209  QPTPTLTASEAELTGIGMGLAEAGRGVLQFVSDFDDPQKEAAMLRRIVEKTGRPLSVSLA  268

Query  176  SSAVEI-GKERLDERVSAMRAEGLNVTSVTVPRSGGGVGG--LYTDNFFRTPAWDEVRAL  232
             S V   G   L   + A  A+G+ + +   PR  G + G  L  + F   P + E+  L
Sbjct  269  QSDVAPNGWRHLLGAIEAAAADGIPIRAQVAPRPVGVLLGLDLTMNPFSAHPTYREIADL  328

Query  233  EFGERVRAIRDPSMRQRLVDEVKAQPEIEN  262
               ERV  +RDP  R RL+ +    P+ +N
Sbjct  329  PLPERVARLRDPEFRARLLADA---PQTDN  355


>gi|83859220|ref|ZP_00952741.1|  hypothetical protein OA2633_12485 [Oceanicaulis alexandrii HTCC2633]
 gi|83852667|gb|EAP90520.1|  hypothetical protein OA2633_12485 [Oceanicaulis alexandrii HTCC2633]
Length=594

 Score =  150 bits (379),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 96/268 (35%), Positives = 143/268 (53%), Gaps = 16/268 (5%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP ++SD E L  +ME VEDIP  A+  GL W+W S+  YLDAL +   +++V
Sbjct  89   GNCGVGFAPVRKSDHERLIKLMEGVEDIPGTALAEGLSWDWESFPDYLDALEKTPRTLDV  148

Query  62   CGLVGHCATRFYVMGERA-VEEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
              +VGH   R YVM ERA  ++ A  +EI ++ +L  +++  GA+GF+T R   HR  DG
Sbjct  149  AAMVGHDPLRVYVMDERASFDQQANDNEIAKMRDLVSEALDAGAIGFATGRSDLHRTADG  208

Query  121  RSIPGTFAERDELRAVAKEV-GKHGGLMQTVSDFD------DFEAEMDLIADEARASRGA  173
               P + A   EL  +A    G+  G++Q VSDFD       FE E  ++ +  RA+ G 
Sbjct  209  EWTPASEATTKELTGIASAFKGRDHGVIQAVSDFDLERDQSRFEEEWKVVEEYVRAAGGR  268

Query  174  LFSSAVEIGKERLDE------RVSAMRAEGLNVTSVTVPRSGGGVGGLYTD--NFFRTPA  225
             FS ++       D+       + A+  EG  V +   PR+ G   GL      F   PA
Sbjct  269  PFSMSLMQRDFAPDQWRKILNGLEALDKEGYTVRAQVAPRAIGVFLGLQCTFHPFMGFPA  328

Query  226  WDEVRALEFGERVRAIRDPSMRQRLVDE  253
            + E+  L   ERV  ++  + RQ+++ +
Sbjct  329  YKEIAHLPLDERVAVMKTDAFRQKILSQ  356


>gi|90201504|ref|ZP_01204150.1|  Amidohydrolase:Amidohydrolase-like [Mycobacterium vanbaalenii 
PYR-1]
 gi|90198383|gb|EAS25142.1|  Amidohydrolase:Amidohydrolase-like [Mycobacterium vanbaalenii 
PYR-1]
Length=583

 Score =  149 bits (377),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 99/292 (33%), Positives = 155/292 (53%), Gaps = 21/292 (7%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+ +D + L  +M  VEDIP   ++ GLPW+W ++  +LDAL      I+V
Sbjct  96   GNCGVGFAPCRPADHDVLVDVMAGVEDIPGVVMVDGLPWHWETFPEFLDALDAGARDIDV  155

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H   R YVMG R V+ E A P+++  + +LA ++V+ GA+GF+++RF  H+   G
Sbjct  156  AAFLPHSPLRVYVMGRRGVDREPAGPEDLAMMRKLAAEAVQAGALGFASSRFTLHKTESG  215

Query  121  RSIPGTFAERDELRAVAKEVGKH-GGLMQTVSDF--DDFEAEMDLIADEARASRGALFSS  177
            R IP   A+R E+ A+A+ V    GGL+Q V D    D+E  +  + D A A  G   + 
Sbjct  216  RPIPSYDADRAEIEAIARGVDDAGGGLIQFVPDLVAGDYEPVLQTVFDVA-ADVGLPVTF  274

Query  178  AVEIGKERLDERVSAMR------AEGLNVTSVTVPRSGGGVGGLYTDN--FFRTPAWDEV  229
             + IG       + A+R      + G ++++   PR  G + GL      F   P++ E+
Sbjct  275  TLAIGNAGDPFFLDALRMVEKANSNGGHISAQIFPRPIGLMLGLELSGNPFVMYPSYREI  334

Query  230  RALEFGERVRAIRDPSMRQRLVDEVKAQPEIEN-----TMNRWFYMGDQSRP  276
             AL   ERV  +R P +R+R++++   +PE +          W YM     P
Sbjct  335  AALPLAERVAQMRKPEVRERILND---KPESDGHPLMFAAQAWNYMFPLGEP  383


>gi|94495249|ref|ZP_01301830.1|  hypothetical protein SKA58_02110 [Sphingomonas sp. SKA58]
 gi|94425515|gb|EAT10535.1|  hypothetical protein SKA58_02110 [Sphingomonas sp. SKA58]
Length=570

 Score =  148 bits (374),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 101/307 (32%), Positives = 156/307 (50%), Gaps = 21/307 (6%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+  DRE L  +ME VEDIP+  +  GLPWNW S+  YL +L       +V
Sbjct  89   GNCGVGFAPCRPKDREALVNVMEGVEDIPEAVMAKGLPWNWESFPDYLKSLEARAWDADV  148

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H   R Y MG+R ++ E AT  ++ ++A+L  + +  GA+GF+T+R   HR  DG
Sbjct  149  GAYIPHSPLRVYAMGQRGLDREPATAADVARMAQLVAEGMAAGALGFATSRSLVHRRGDG  208

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFD--DFEAEMDLIADEARASRGAL---  174
              IP   A+ DEL A+A+ VG  G G++Q + + D  D+ +++DL+      S   L   
Sbjct  209  AFIPSFQADSDELVAIARSVGDAGRGVLQMIPNLDTADWASDLDLMKRMTSTSGRPLTYS  268

Query  175  ---FSSAVEIGKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYT--DNFFRTPAWDEV  229
               +S+  +  +  +D      R+    V +   PR  G + GL T  + F    ++  +
Sbjct  269  LAQWSTDPQGWRRTMDALAEHNRSGAAPVLAQVFPRPMGAMCGLSTSANAFSHCASYRAI  328

Query  230  RALEFGERVRAIRDPSMRQRLVDEVKAQP-EIENTMNRWFYMGDQ-----SRPCYTQSLD  283
                  E+V  +RDP+ R  L+ E   +P E    ++R     D      + P Y  S D
Sbjct  329  ADRPLAEKVAIMRDPAFRALLIAE---EPDETPTPLHRLLRTWDNIYPLGAEPDYEPSPD  385

Query  284  QSLTGMA  290
            QS+  +A
Sbjct  386  QSIAALA  392


>gi|33601761|ref|NP_889321.1|  hypothetical protein BB2785 [Bordetella bronchiseptica RB50]
 gi|33576198|emb|CAE33277.1|  conserved hypothetical protein [Bordetella bronchiseptica RB50]
Length=579

 Score =  148 bits (373),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 102/307 (33%), Positives = 159/307 (51%), Gaps = 19/307 (6%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP + +DR  L  +ME VEDIP  A+  GL W W ++  +L A   +   I+ 
Sbjct  92   GNCGVGFAPVRAADRGNLIELMEGVEDIPGIALHEGLDWAWETFPDFLRATERIEHDIDF  151

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
            C  + H A R YVMGERA+  E ATP++I ++  LA ++++ GA+GFST+R   HR   G
Sbjct  152  CAQLPHAALRVYVMGERALRLEMATPEDIARMRSLAAEAMRHGAIGFSTSRSINHRSVTG  211

Query  121  RSIPGTFAERDELRAVAKEVGKH-GGLMQTVSDFDD---FEAEMDLIADEARASRGALFS  176
              +P   A  +EL  +A  +    GG+++ + DFDD    EAE  ++      S   L  
Sbjct  212  DPMPSLRAAEEELTGIAMGLADAGGGVLEIIIDFDDPDMLEAEFGMMRRLVEKSGRPLSF  271

Query  177  SAVEI-----GKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYTDN--FFRTPAWDEV  229
            S ++      G  RL    +   A+GL + +   PR  G + GL      F    ++  +
Sbjct  272  SLMQKHGNKDGWRRLLALTAQAAADGLPIRAQVAPRGVGVLLGLQGSRNVFSDCASYKAI  331

Query  230  RALEFGERVRAIRDPSMRQRLVDEVKAQPEIE-----NTMNRWFYMGDQSRPCYTQSLDQ  284
              L   ERVR +RDP++R +L+ E++   +       N  +  F +G+   PCY    ++
Sbjct  332  AQLALDERVRRMRDPALRAQLLRELRESQDTPLGKRLNEFDNIFPLGNP--PCYDPGPER  389

Query  285  SLTGMAK  291
            S+  +A+
Sbjct  390  SIAALAR  396


>gi|89338748|ref|ZP_01191513.1|  Amidohydrolase-like [Mycobacterium flavescens PYR-GCK]
 gi|89320681|gb|EAS12170.1|  Amidohydrolase-like [Mycobacterium flavescens PYR-GCK]
Length=574

 Score =  146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 94/267 (35%), Positives = 145/267 (54%), Gaps = 13/267 (4%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+ +D + L  +M  VEDIP   ++ GLPW W ++  +LDA++     I+V
Sbjct  88   GNCGVGFAPCRPADHDVLVDVMAGVEDIPGVVMVDGLPWQWETFPEFLDAVASRQRDIDV  147

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H   R YVMG R V+ E AT +++  + +LA ++V  GA+GF+++RF  H+   G
Sbjct  148  AAFLPHSPLRVYVMGRRGVDREPATDEDLEMMRKLAAEAVHAGALGFASSRFTLHKTESG  207

Query  121  RSIPGTFAERDELRAVAKEVGK-HGGLMQTVSDF--DDFEAEMDLIADEARASRGALFSS  177
            + IP   A+  E+ A+A+ V    GGL+Q V D    D+E  +  + D A A  G   + 
Sbjct  208  QPIPSYNADYAEIEAIARGVQDGGGGLIQFVPDLVAGDYEPVLQTVFDAA-ADVGLPVTF  266

Query  178  AVEIGKER----LD--ERVSAMRAEGLNVTSVTVPRSGGGVGGLYTDN--FFRTPAWDEV  229
             + +G       LD    V    A G ++T+   PR  G V GL      F   P++ E+
Sbjct  267  TLAVGNAGDPFFLDALTMVEKANANGGDITAQIFPRPIGLVLGLELSGNPFVMYPSYREI  326

Query  230  RALEFGERVRAIRDPSMRQRLVDEVKA  256
             AL   ERV  +R P +R+R++++  A
Sbjct  327  AALPLAERVAEMRKPEVRERILNDTPA  353


>gi|33597284|ref|NP_884927.1|  hypothetical protein BPP2713 [Bordetella parapertussis 12822]
 gi|33573711|emb|CAE38006.1|  conserved hypothetical protein [Bordetella parapertussis]
Length=576

 Score =  145 bits (365),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 104/299 (34%), Positives = 158/299 (52%), Gaps = 16/299 (5%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP + +DR  L  +ME VEDIP  A+  GL W W ++  +L A   +   I+ 
Sbjct  92   GNCGVGFAPVRAADRGNLIELMEGVEDIPGIALHEGLDWAWETFPDFLRATERIEHDIDF  151

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
            C  + H A R YVMGERA+  E ATP++I ++  LA ++++ GA+GFST+R   HR   G
Sbjct  152  CAQLPHAALRVYVMGERALRLEMATPEDIARMRSLAAEAMRHGAIGFSTSRSINHRSVTG  211

Query  121  RSIPGTFAERDELRAVAKEVGKH-GGLMQTVSDFDD---FEAEMDLIADEARASRGALFS  176
              +P   A  +EL  +A  +    GG+++ + DFDD    EAE  ++      S   L  
Sbjct  212  DPMPLLRAAEEELTGIAMGLADAGGGVLEIIIDFDDPDMLEAEFGMMRRLVEKSGRPLSF  271

Query  177  SAVEI-----GKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLY-TDNFFRTPA-WDEV  229
            S ++      G  RL    +   A+GL + +   PR  G + GL  + N F   A +  +
Sbjct  272  SLMQKHGNKDGWRRLLALTAQAAADGLPIRAQVAPRGVGVLLGLQGSRNVFSDCASYKAI  331

Query  230  RALEFGERVRAIRDPSMRQRLVDEVKAQP--EIENTMNRWFYMGDQSRPCYTQSLDQSL  286
              L   ERVR +RDP++R +L+ E +  P  +  N  +  F +G+   PCY    ++S+
Sbjct  332  AQLALDERVRRMRDPALRAQLLRESQDTPLGKRLNEFDNIFPLGNP--PCYDPGPERSI  388


>gi|85374289|ref|YP_458351.1|  hypothetical protein ELI_07310 [Erythrobacter litoralis HTCC2594]
 gi|84787372|gb|ABC63554.1|  hypothetical protein ELI_07310 [Erythrobacter litoralis HTCC2594]
Length=584

 Score =  143 bits (361),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 93/270 (34%), Positives = 146/270 (54%), Gaps = 13/270 (4%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP K    E+L  +ME VEDIP  A+  G+ WNW ++  YLD L ++  +++V
Sbjct  89   GNCGVGFAPAKPDKHEWLIQLMEGVEDIPGTALAEGITWNWETFPEYLDELDKMPRAVDV  148

Query  62   CGLVGHCATRFYVMGERAVEEAA---TPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLP  118
               V H A R YV+G+R  EE     T DEI Q+A++    V+ GA+GFST+R   H+  
Sbjct  149  GTHVPHGAVRAYVLGDR--EEPGVVPTEDEIAQMAQIVEDGVRAGALGFSTSRTVLHKDV  206

Query  119  DGRSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARAS-RGALFS  176
            +G  +PGT A+ DEL  + + +G+ G G+ +  SD      E + + + +R +     F+
Sbjct  207  NGVLVPGTTAQADELVELGRAMGRAGHGVFEMASDLRREWNEFEWMGNLSRETGLPVTFA  266

Query  177  SAVEIGKE-RLDERVSAMRAE---GLNVTSVTVPRSGGGVGGLY--TDNFFRTPAWDEVR  230
            +   I KE  LDE++  MRAE   G N+ +    R  G +       + F   P+W ++ 
Sbjct  267  ALQSIAKELPLDEQIQTMRAENDNGANIVAQIALRGNGIIMAWQGTVNPFMLRPSWQDIA  326

Query  231  ALEFGERVRAIRDPSMRQRLVDEVKAQPEI  260
             L + E+   + DP+ + +L+ E     E+
Sbjct  327  ELSWEEQKAKLLDPAFKAKLLSEENDYSEV  356


>gi|88704218|ref|ZP_01101932.1|  D-aminoacylase [gamma proteobacterium KT 71]
 gi|88701269|gb|EAQ98374.1|  D-aminoacylase [Congregibacter litoralis KT71]
Length=593

 Score =  141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 94/268 (35%), Positives = 140/268 (52%), Gaps = 16/268 (5%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            G+CGV FAP +E+DRE L  +ME VEDIP  A+  GL W+W +   Y+DAL     SI+ 
Sbjct  88   GSCGVGFAPVREADREKLIRLMEGVEDIPGIALAEGLTWDWETLPEYMDALDAKPHSIDF  147

Query  62   CGLVGHCATRFYVMGERAV-EEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               V H   R YVMG+RAV  E AT  +I  +  +  ++++ GA+GFST R   HR  DG
Sbjct  148  AVQVTHDPLRVYVMGDRAVCNEPATETDIAAMRRITREALEAGAIGFSTGRSDVHRSADG  207

Query  121  RSIPGTFAERDELRAVAKEV-GKHGGLMQTVSDF------DDFEAEMDLIADEARASRGA  173
               P + A  +EL  +A    G   G++Q V+DF      D F+ E D++   A+A  G 
Sbjct  208  EWTPSSEATTEELAGIASAFSGLSHGILQAVNDFDLEREGDAFDKEFDILESMAKAGEGR  267

Query  174  LFSSAVEIGK------ERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYTD--NFFRTPA  225
             FS ++           R+ ER     A+G+++   T PR  G + GL      F   P+
Sbjct  268  PFSLSLMQRDFAPDQWRRIIERAEKAEAKGVSMRLQTAPRGIGVITGLQCTFHPFIGFPS  327

Query  226  WDEVRALEFGERVRAIRDPSMRQRLVDE  253
            +  +  L   +RV  +R+P  + +++ E
Sbjct  328  YKAICDLPLEQRVARMREPEFKAQILTE  355


>gi|87201100|ref|YP_498357.1|  D-aminoacylase-like [Novosphingobium aromaticivorans DSM 12444]
 gi|87136781|gb|ABD27523.1|  D-aminoacylase-like [Novosphingobium aromaticivorans DSM 12444]
Length=570

 Score =  140 bits (352),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 104/308 (33%), Positives = 154/308 (50%), Gaps = 21/308 (6%)

Query  2    GNCGVTFAPCKE--SDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSI  59
            GNCGV FAPC+   + R+ +  +ME VEDIP   +  GLPW W ++  YLD L+     I
Sbjct  89   GNCGVGFAPCRRDAASRDAMVRLMEGVEDIPHPVLTEGLPWTWETFPDYLDFLASRTYDI  148

Query  60   NVCGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLP  118
            +V   V H   R YVMG+R  + E AT  +I ++  L  Q++  GA+G +T+R   HR  
Sbjct  149  DVAAYVPHAPLRVYVMGQRGADREPATQTDIAEMCRLLEQALDRGALGIATSRSLFHRSS  208

Query  119  DGRSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARAS-RGALFS  176
            DG +IP   A + EL A A+ +   G G+ Q V D     A +D + + AR S R   FS
Sbjct  209  DGTAIPTYQAAQAELMAFAEVLRAKGKGVFQIVEDIHVPGASLDNMRELARTSGRPLTFS  268

Query  177  SAV----EIGKERLDERVSAMRAEGLNVTSVTVPRSGGGVGG--LYTDNFFRTPAWDEVR  230
                     G  RL + ++A  AEGL +    +PR  G + G  L  + F+ T  +  + 
Sbjct  269  IGTGNTGPYGYPRLLDELAAANAEGLVMKGQLMPRGIGMILGFELTLNPFYTTSTFARLA  328

Query  231  ALEFGERVRAIRDPSMRQRLVDEVKAQPEIENTMNR-------WFYMGDQSRPCYTQSLD  283
             L   ER+  +R P +R  ++ E    P+    + R        F +GD   P Y Q  +
Sbjct  329  PLPLAERLEQLRRPEIRAAILSE-PMDPDPALVLGRAVRDFDHMFLLGDD--PDYEQPPE  385

Query  284  QSLTGMAK  291
            +S+ G A+
Sbjct  386  RSIAGRAR  393


>gi|87199453|ref|YP_496710.1|  hypothetical protein Saro_1432 [Novosphingobium aromaticivorans 
DSM 12444]
 gi|87135134|gb|ABD25876.1|  conserved hypothetical protein [Novosphingobium aromaticivorans 
DSM 12444]
Length=582

 Score =  138 bits (347),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 151/269 (56%), Gaps = 13/269 (4%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP      ++L G+ME VEDIP  A+  G+ W+W S+  YLD+L ++  +++V
Sbjct  89   GNCGVGFAPAAPDRHDWLIGLMEGVEDIPGTALAEGMAWDWESFPEYLDSLEKMPRAVDV  148

Query  62   CGLVGHCATRFYVMGERAVEEAA-TPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               V H A R YV+GER    A  T ++IR+++E+  + V+ GA+GFST+R   H+  DG
Sbjct  149  GTHVPHGAVRAYVLGEREKPGAVPTAEDIRKMSEIVEEGVRAGALGFSTSRTVIHKSVDG  208

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARASRGALFSSAV  179
              +PGT A  +EL  + + +G+ G G+ +  SD      E   +   +R +   +  +A+
Sbjct  209  EVVPGTTATAEELIEIGRAMGRVGHGVFEMASDMKREWDEFGWMGALSRETGLPVTYAAL  268

Query  180  E-IGKER-LDERVSAMR---AEGLNVTSVTVPRSGGGV----GGLYTDNFFRTPAWDEVR  230
            + I KE  L+E+++ MR   A+G N+ +    R  G +    G ++   F   P++  + 
Sbjct  269  QSIAKEMPLEEQIAEMRHQNAQGANIVAQIALRGNGVIMAWRGTIHPFRF--RPSYAAIA  326

Query  231  ALEFGERVRAIRDPSMRQRLVDEVKAQPE  259
             L + E++  ++DP+ R +++ E    P+
Sbjct  327  ELPWEEQLVQLKDPAFRAKVLAEANVYPD  355


>gi|27376115|ref|NP_767644.1|  hypothetical protein bll1004 [Bradyrhizobium japonicum USDA 110]
 gi|27349254|dbj|BAC46269.1|  bll1004 [Bradyrhizobium japonicum USDA 110]
Length=572

 Score =  137 bits (346),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 99/304 (32%), Positives = 158/304 (51%), Gaps = 17/304 (5%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPCK +D   L  +ME VEDIP+  +  G+PW W S+  Y+  LS+    I+V
Sbjct  89   GNCGVGFAPCKPADHTRLIQLMEGVEDIPEPVLSAGIPWAWESFPDYMGWLSKRDFDIDV  148

Query  62   CGLVGHCATRFYVMGER-AVEEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H A R YVMGER A  + +T ++   +A+LAG++V+ GA+GFST+R   HR   G
Sbjct  149  GAQLPHAALRVYVMGERGARRDPSTVEDNAAMAKLAGEAVRSGALGFSTSRTLNHRTSTG  208

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARASRGALFSSAV  179
               P   A  DEL A+A  + + G  ++Q V D    + ++ ++   A  ++  +  S  
Sbjct  209  DFTPTLKAGEDELTAIAGAMHREGRSVLQFVLDLSTIDDDLPMMLRVADTTKCPISFSIT  268

Query  180  EIGK------ERLDERVSAMRAEGLNVTSVTVPRSGGGVGGL-YTDNFFRT-PAWDEVRA  231
            +  K      + LDE ++A    GL++T+    R  G + GL  + N F+T P++  +  
Sbjct  269  QNDKAPQRWRQTLDE-INAAAQRGLSITAQIAARPVGLLLGLELSRNPFQTHPSYRAIAH  327

Query  232  LEFGERVRAIRDPSMRQRLVDEVKAQPE----IENTMNRWFYMGDQSRPCYTQSLDQSLT  287
            L   ER+  +  P +RQ ++ E     +         ++ F +GD   P Y Q  + +L 
Sbjct  328  LPLKERLARLHQPEVRQAILSETATATDDPLFFRPNYDKMFLLGDP--PDYEQPPENALG  385

Query  288  GMAK  291
              A+
Sbjct  386  PQAR  389


>gi|78698635|ref|ZP_00863136.1|  conserved hypothetical protein [Bradyrhizobium sp. BTAi1]
 gi|78513479|gb|EAP26789.1|  conserved hypothetical protein [Bradyrhizobium sp. BTAi1]
Length=572

 Score =  137 bits (345),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 99/305 (32%), Positives = 154/305 (50%), Gaps = 19/305 (6%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+ +D + L  +ME VEDIP+  +  G+PW W S+  Y+  L      +++
Sbjct  89   GNCGVGFAPCRPADHQRLIQLMEGVEDIPEPVLEAGIPWEWESFPDYMAWLGRREFDLDI  148

Query  62   CGLVGHCATRFYVMGER-AVEEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H A R YVMGER A  + AT D+ R +A LA  +VK GA+GFST+R   HR   G
Sbjct  149  GAQLPHAALRVYVMGERGARRDPATADDNRAMAVLARDAVKAGALGFSTSRTLNHRTSTG  208

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARASRGALFSSAV  179
               P   A  DEL  +A+ +   G  ++Q V D      ++ ++   A  +R  +  S  
Sbjct  209  DYTPTLIAGEDELTTIAEAMQSAGRSVLQFVLDISTIHEDLPMMLRIADKTRCPISFSVT  268

Query  180  EIGKERLDER-------VSAMRAEGLNVTSVTVPRSGGGVGGL-YTDNFFRT-PAWDEVR  230
            +   +R  +R       +++  A GL+VT+    R  G + GL  + N  +T P++  + 
Sbjct  269  Q--NDRAPQRWRQTLAEINSAAARGLSVTAQIAARPVGLLLGLELSRNPLQTHPSYQAIA  326

Query  231  ALEFGERVRAIRDPSMRQRLVDEVKAQPE----IENTMNRWFYMGDQSRPCYTQSLDQSL  286
             L   ERV  +RDP +R  ++ E     +         ++ + +GD   P Y Q  +QSL
Sbjct  327  HLPLAERVARMRDPQLRAAILSEQARATDDPLFFRPNYDKMYLLGDP--PDYEQPPEQSL  384

Query  287  TGMAK  291
               A+
Sbjct  385  GARAR  389


>gi|78060699|ref|YP_367274.1|  Amidohydrolase-like [Burkholderia sp. 383]
 gi|77965249|gb|ABB06630.1|  Amidohydrolase-like [Burkholderia sp. 383]
Length=581

 Score =  135 bits (339),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 101/312 (32%), Positives = 156/312 (50%), Gaps = 31/312 (9%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+ + R+ L  +ME VEDIP+  +  G+PWNW ++  YLD L      I+ 
Sbjct  99   GNCGVGFAPCRSTQRDTLVKVMEGVEDIPEIVMTEGIPWNWETFPEYLDTLKARRYDIDF  158

Query  62   CGLVGHCATRFYVMGERAVEEAATPD--EIRQIAELAGQSVKEGAVGFSTNRFPPHRLPD  119
               V H A R YVM     +    PD  ++RQ+ E+   +++ GA G S+++   HR  +
Sbjct  159  ATQVPHSAIRVYVMN----DGDGPPDAAQLRQMTEIVRDAIRAGAFGVSSSQHAGHRTVE  214

Query  120  GRSIPGTFAERDELRAVAKEVGK-HGGLMQTVSD----FDDFEAEMDLIADEARASRGAL  174
            G   P   A  DEL A+A+ + +  GG+ Q ++D      D   +M LI   A  S   +
Sbjct  215  GDLAPSVKAATDELFALAEGLKEADGGVFQVITDGYSAKSDAAKQMALIRRIAEISGRPV  274

Query  175  FSSAVEIGKERLDERVSAM-------RAEGLNVTSVTVPRSGG---GVGGLYTDNFFRTP  224
              S ++  K+   +   AM       +A+GL + +   PR  G   G+G  +    FR P
Sbjct  275  SYSLLQ--KDHCVDLPEAMLALNRHAQADGLPIRAQVFPRPVGLMFGLGLSFHPFRFR-P  331

Query  225  AWDEVRALEFGERVRAIRDPSMRQRLVDEVKAQP-----EIENTMNRWFYMGDQSRPCYT  279
            +++ + AL   +RV A+RDP+ R+ ++ E  A P      I       F +GD   P Y 
Sbjct  332  SYEAIHALPLDQRVAAMRDPARRRAILSETPAHPNPVFVNIVKDFEDSFVLGDP--PNYE  389

Query  280  QSLDQSLTGMAK  291
             + DQS+   A+
Sbjct  390  PTPDQSIRAQAR  401


>gi|73539075|ref|YP_299442.1|  hypothetical protein Reut_B5252 [Ralstonia eutropha JMP134]
 gi|72122412|gb|AAZ64598.1|  conserved hypothetical protein [Ralstonia eutropha JMP134]
Length=569

 Score =  135 bits (339),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 84/265 (31%), Positives = 145/265 (54%), Gaps = 9/265 (3%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP + +DR +L  +ME VEDIP + +  G+ W+W ++  YLDAL     ++++
Sbjct  87   GNCGVGFAPVRPADRSWLIKVMEGVEDIPGSVLSEGIEWDWETFPEYLDALDRRPKALDI  146

Query  62   CGLVGHCATRFYVMGERAV-EEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H A R YVMGER +  + ATP ++ Q+  L  + +  GA+GFST+R   H+  + 
Sbjct  147  GAQIPHAALRAYVMGERGIHHDEATPQDLDQMCRLMREGMAAGALGFSTSRTFLHKYDER  206

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARASR-GALFS-S  177
            +  PGTFA  DE+ ++ + +G+ G G+ Q  ++      E+  +   AR ++   LF+  
Sbjct  207  KYPPGTFASGDEIMSLGRVLGEAGHGVFQMTANHVSMGNELPWLERLARHNKLPVLFNLQ  266

Query  178  AVEIGKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYT-----DNFFRTPAWDEVRAL  232
              +   +   + ++A+         +    SG  +G L++       F   PA+ E+  L
Sbjct  267  QTDPAPDLWRDLLAALDQAHAGGVPLYGGISGRPLGLLFSWQSSLHPFIACPAFQELAGL  326

Query  233  EFGERVRAIRDPSMRQRLVDEVKAQ  257
             F  RV  +RDP++R+R++ E +A+
Sbjct  327  SFEARVTRLRDPAVRERVLTEPRAR  351


>gi|85708872|ref|ZP_01039938.1|  hypothetical protein NAP1_06515 [Erythrobacter sp. NAP1]
 gi|85690406|gb|EAQ30409.1|  hypothetical protein NAP1_06515 [Erythrobacter sp. NAP1]
Length=588

 Score =  133 bits (335),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 90/272 (33%), Positives = 142/272 (52%), Gaps = 15/272 (5%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP K    E+L  +ME VEDIP  A+  G+ W+W ++  YLDAL +L  ++++
Sbjct  89   GNCGVGFAPAKPDRHEWLISLMEGVEDIPGTALAEGITWDWETFPEYLDALEKLPRTVDI  148

Query  62   CGLVGHCATRFYVMGERAVEEAA-TPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               V H A R YV+G+R    A  T ++I +++ +  + V+ GA+GFST+R   H+  DG
Sbjct  149  GTHVPHGAVRAYVLGDREQPGAVPTSEDIAKMSAIVEEGVRAGALGFSTSRTVLHKSVDG  208

Query  121  RSIPGTFAERDELRAV------AKEVGKHGGLMQTVSDFDDFEAEMDLIADEAR-ASRGA  173
              +PGT A  +EL A+      AK+ G H  + +  SD      E + +   +R A    
Sbjct  209  ELVPGTTATPEELVAIGHAMGRAKDAGGH-AVFEMASDLQRDWNEFEWMGKLSREAGIPV  267

Query  174  LFSSAVEIGKER-LDERVSAMRAE---GLNVTSVTVPRSGGGVGGLY--TDNFFRTPAWD  227
             F++   I KE  L E++  MRAE   G N+ +    R  G +       + F   P+W 
Sbjct  268  TFAALESIAKEMPLKEQIETMRAENDNGANIVAQIALRGNGIIMAWQGTVNPFVYRPSWQ  327

Query  228  EVRALEFGERVRAIRDPSMRQRLVDEVKAQPE  259
             +  L + E+   + DP+ +++L+ E     E
Sbjct  328  AIAELPWEEQKAKLLDPAFKKQLLSEANDYSE  359


>gi|118472407|ref|YP_885286.1|  amidohydrolase family protein [Mycobacterium smegmatis str. MC2 
155]
 gi|118173694|gb|ABK74590.1|  amidohydrolase family protein [Mycobacterium smegmatis str. MC2 
155]
Length=580

 Score =  131 bits (330),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 84/267 (31%), Positives = 140/267 (52%), Gaps = 15/267 (5%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+  D + L  +M  VEDIP   +  GL W+W ++  YLDAL+     I+V
Sbjct  90   GNCGVGFAPCRAEDHDVLVDVMAGVEDIPGVVMTEGLNWHWETFPEYLDALAARRLDIDV  149

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H   R YVMG+R  + E AT D++ ++  LA ++++ GA+GF+++R   HR   G
Sbjct  150  AAYLPHSPLRVYVMGQRGADREPATADDLARMRALAREAIEAGALGFASSRLATHRTEGG  209

Query  121  RSIPGTFAERDELRAVAKEVGK-HGGLMQTVSDF--DDFEAEMDLIADEARASRGALFSS  177
            R IP   A  +E+R +A+ +    GGL+Q V D     ++  +  + D A  +   +  S
Sbjct  210  RQIPSFEAAYEEIREIARGIADGGGGLIQFVPDIPAGGYQPVLQQVFDAAGETGLPVTFS  269

Query  178  AVEIGK---------ERLDERVSAMRAEGLNVTSVTVPRSGGGVGG--LYTDNFFRTPAW  226
             + +           E +++  ++  +    VT+   PR  G + G  L  + F   P++
Sbjct  270  LLVLNAGEPLWREAMEMVEKANTSATSAAPRVTAQVFPRPIGLMIGLELSANPFVLYPSY  329

Query  227  DEVRALEFGERVRAIRDPSMRQRLVDE  253
             E+  L   ERV  +R P +R+R++ +
Sbjct  330  QEIAGLPLPERVAQMRKPEVRERILSD  356


>gi|91782245|ref|YP_557451.1|  hypothetical protein Bxe_A3590 [Burkholderia xenovorans LB400]
 gi|91686199|gb|ABE29399.1|  Conserved hypothetical protein [Burkholderia xenovorans LB400]
Length=574

 Score =  128 bits (322),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 87/267 (32%), Positives = 126/267 (47%), Gaps = 12/267 (4%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP +  DR+ L  +ME VEDIP  A+  GL W W  +  ++ AL      I+ 
Sbjct  90   GNCGVGFAPVRVQDRDRLIELMEGVEDIPGIALHEGLDWQWEGFASFMAALERRPHDIDF  149

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
            C  V H A R YVMG RA   E ATP+++ ++  L  ++V+ GA+G ST+R   H+   G
Sbjct  150  CAHVPHAALRVYVMGARAARLEMATPEDVAEMRRLTAEAVRAGAIGVSTSRSINHKSVKG  209

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFD-------DFEAEMDLIADEARASRG  172
               P   A  +EL  +A  V   G G++Q + DFD       DF     L+    R    
Sbjct  210  DPTPSLRAAENELLGLALGVKDAGRGVLQMIMDFDDPTEIHSDFAMMRRLVEQSGRPLSF  269

Query  173  ALFSSAVEI-GKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYTDN--FFRTPAWDEV  229
            +L        G  +L         +GL + +   PR  G + GL T    F   P + + 
Sbjct  270  SLMQKHGNTDGWRKLLALTEEANRDGLQMRAQVAPRGIGVLLGLQTSRNIFSECPTYRKF  329

Query  230  RALEFGERVRAIRDPSMRQRLVDEVKA  256
                   R+  +R P +R+ L+ E+ A
Sbjct  330  ANEPLASRIAQMRKPEIREALIAELVA  356


>gi|83744454|gb|ABC42544.1|  unknown [Streptomyces hygroscopicus]
Length=579

 Score =  128 bits (322),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 99/309 (32%), Positives = 152/309 (49%), Gaps = 20/309 (6%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAP +    ++L G+ME VEDIP  ++  G+ W W ++  YLDA+  L   ++V
Sbjct  87   GNCGVGFAPAQPDRHDWLIGLMEGVEDIPGASLSEGITWEWETFPEYLDAVERLPRVMDV  146

Query  62   CGLVGHCATRFYVMGER-AVEEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               V H A R YVMG+R A  E  T +++R++  L  Q ++ GA+GFST+R   H    G
Sbjct  147  AAQVPHGALRAYVMGDRGAANEPPTEEDLRRMCALVRQGLQAGAIGFSTSRTVTHLAITG  206

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTV------SDFDDFEAEMD----LIADEARA  169
              +PGTFA  DEL A+   +G+ G G+ Q V         DD   E+     L A   R 
Sbjct  207  DPVPGTFAAEDELFALGGVLGEVGTGVFQLVPLGAGGEKVDDPLGEIKWMRRLSAAVGRP  266

Query  170  SRGALFSSAVEI-GKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGL-YTDNFFRTPAWD  227
                LF +  +  G   L +      A G ++      R    +  L  T  F R P++ 
Sbjct  267  ITFGLFQNDNDPDGWRELLQVAEDAVASGADLHPQVAGRPFSIIISLDSTHPFRRRPSYK  326

Query  228  EVRALEFGERVRAIRDPSMRQRLVDEVKAQPEIENTM-----NRWFYMGDQSRPCYTQSL  282
             +  L   ER  A+RDP++R++++ E     +  +++      R F M   ++P Y    
Sbjct  327  RIAHLPAAERRAAMRDPALREKILGEAPDDADPRSSLFPQGYERHFPM-KANQPDYEPGA  385

Query  283  DQSLTGMAK  291
            D+S   +A+
Sbjct  386  DESFDAIAR  394


>gi|91222020|ref|ZP_01257605.1|  hypothetical protein P700755_33605 [Psychroflexus torquis ATCC 
700755]
 gi|91180172|gb|EAS67587.1|  hypothetical protein P700755_33605 [Psychroflexus torquis ATCC 
700755]
Length=299

 Score =  128 bits (321),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 77/197 (39%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPCK  DR  L  +ME VEDIP   +  GL W W ++  Y+ AL +    I++
Sbjct  96   GNCGVGFAPCKPEDRVKLVELMEGVEDIPAPVMHEGLNWQWETFEEYIKALEKNKLDIDI  155

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
            C L+ H A R YVMGERA++ E AT  +++ + +LA ++V+ GA GFST+R   H+   G
Sbjct  156  CALLPHAALRVYVMGERAIKHEVATKADMQIMRKLAKEAVEAGAFGFSTSRTISHKSLKG  215

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFD--DFEAEMDLIAD-EARASRGALFS  176
               P   A  DEL A+A  +   G G ++ VSD++  D E E +++     R+ R  +FS
Sbjct  216  EYTPTLRAHEDELTAIAMGLADAGSGFIEIVSDWNEPDPETEFEVLKRIVKRSGRPLVFS  275

Query  177  SAVEIGKERLDERVSAM  193
                  +    E + AM
Sbjct  276  CTQRHDRPHFWEDLMAM  292


>gi|16127690|ref|NP_422254.1|  hypothetical protein CC3460 [Caulobacter crescentus CB15]
 gi|13425178|gb|AAK25422.1|  hypothetical protein [Caulobacter crescentus CB15]
Length=581

 Score =  126 bits (316),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 103/302 (34%), Positives = 153/302 (50%), Gaps = 13/302 (4%)

Query  2    GNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINV  61
            GNCGV FAPC+  D + L  +ME VEDIP   +  GLPW W S+  YLD L+     ++V
Sbjct  91   GNCGVGFAPCRPDDHDRLIRLMEGVEDIPFPVLTEGLPWAWESFPDYLDFLAGRAFDVDV  150

Query  62   CGLVGHCATRFYVMGERAVE-EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG  120
               + H A R YVMG+R  + E AT  +I  +A +A ++V+ GA+GFST+R   HR  DG
Sbjct  151  GAQLPHAALRVYVMGDRGADREPATDADIAAMAAIARRAVEAGALGFSTSRTLNHRTSDG  210

Query  121  RSIPGTFAERDELRAVAKEVGKHG-GLMQTVSDFDDFEAEMDLIADEARASRGALFSSAV  179
            +  P   A  DEL  +A  +   G G++Q VSDF D  AE+ ++      S   L  S V
Sbjct  211  QPTPTLTAGEDELTGIALGLAAAGKGVLQVVSDFVDGAAELAMLRRIVERSGRPLSFSLV  270

Query  180  EI-----GKERLDERVSAMRAEGLNVTSVTVPRSGGGVGG--LYTDNFFRTPAWDEVRAL  232
            +      G   L + V+A    GL + +    R  G + G  L  + F + P + E++  
Sbjct  271  QSPKAPEGWRGLLDGVAAAVDAGLPMKAQVCGRPVGVLFGLELTLNPFSQNPVFAELKDR  330

Query  233  EFGERVRAIRDPSMRQRLV--DEVKAQPEIENTMNRW--FYMGDQSRPCYTQSLDQSLTG  288
               ++V A+ DP+ R RL+  D     P   + +  W   Y      P Y  + D+++  
Sbjct  331  PLADKVAALSDPAFRARLLAHDGDARGPFAGSALRAWDNLYPMGGVDPDYEPTADKTVAA  390

Query  289  MA  290
            +A
Sbjct  391  IA  392


ORF finding

ORF Finder ATG direct : 

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 84 to base 605.
ATGGTGTTTTCTATTTCTGGCTGCGCTTTGACTTCGTCAACTAGTCTTTGTCGCATCGAT
GGGTCTCTTATTGCACGTACCCTTTCGCCAAATTCGAGTGCCCTTACTTCGTCCCAGGCG
GGTGTTCGAAAAAAGTTATCTGTGTATAAACCACCGACACCACCTCCGCTTCTAGGTACG
GTTACCGAGGTCACGTTCAAACCCTCCGCTCGCATTGCTGATACGCGTTCGTCGAGTCGT
TCTTTTCCAATTTCTACTGCGCTGCTAAACAAAGCGCCCCGCGAGGCTCTTGCTTCGTCT
GCGATGAGGTCCATTTCTGCCTCGAAGTCATCGAAGTCAGAGACGGTTTGCATCAAACCT
CCATGTTTGCCAACTTCTTTAGCGACCGCTCTCAGTTCATCGCGCTCCGCAAAAGTACCT
GGGATTGAGCGCCCATCGGGTAGTCGATGCGGTGGAAATCGATTGGTAGAGAATCCTACA
GCTCCTTCTTTGACCGATTGCCCAGCCAGTTCGGCTATTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MVFSISGCALTSSTSLCRIDGSLIARTLSPNSSALTSSQAGVRKKLSVYKPPTPPPLLGT
VTEVTFKPSARIADTRSSSRSFPISTALLNKAPREALASSAMRSISASKSSKSETVCIKP
PCLPTSLATALSSSRSAKVPGIERPSGSRCGGNRLVENPTAPSLTDCPASSAI*


ORF Finder ATG reverse : 


No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 65 to base 874.
ATGATGGAGACTGTGGAGGACATACCTAAGAACGCCATACTGCATGGTCTCCCTTGGAAT
TGGACATCCTATGGCGGCTACCTTGACGCCCTATCGGAGCTCGGACCATCAATCAATGTT
TGTGGGCTGGTCGGCCACTGCGCCACTCGCTTTTACGTGATGGGAGAACGTGCTGTCGAA
GAAGCAGCCACCCCGGACGAAATTCGTCAAATAGCCGAACTGGCTGGGCAATCGGTCAAA
GAAGGAGCTGTAGGATTCTCTACCAATCGATTTCCACCGCATCGACTACCCGATGGGCGC
TCAATCCCAGGTACTTTTGCGGAGCGCGATGAACTGAGAGCGGTCGCTAAAGAAGTTGGC
AAACATGGAGGTTTGATGCAAACCGTCTCTGACTTCGATGACTTCGAGGCAGAAATGGAC
CTCATCGCAGACGAAGCAAGAGCCTCGCGGGGCGCTTTGTTTAGCAGCGCAGTAGAAATT
GGAAAAGAACGACTCGACGAACGCGTATCAGCAATGCGAGCGGAGGGTTTGAACGTGACC
TCGGTAACCGTACCTAGAAGCGGAGGTGGTGTCGGTGGTTTATACACAGATAACTTTTTT
CGAACACCCGCCTGGGACGAAGTAAGGGCACTCGAATTTGGCGAAAGGGTACGTGCAATA
AGAGACCCATCGATGCGACAAAGACTAGTTGACGAAGTCAAAGCGCAGCCAGAAATAGAA
AACACCATGAATCGCTGGTTCTATATGGGTGATCAATCGCGCCCGTGCTATACGCAATCT
CTCGATCAGAGCCTCACAGGCATGGCTAAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINVCGLVGHCATRFYVMGERAVE
EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDGRSIPGTFAERDELRAVAKEVG
KHGGLMQTVSDFDDFEAEMDLIADEARASRGALFSSAVEIGKERLDERVSAMRAEGLNVT
SVTVPRSGGGVGGLYTDNFFRTPAWDEVRALEFGERVRAIRDPSMRQRLVDEVKAQPEIE
NTMNRWFYMGDQSRPCYTQSLDQSLTGMAK

No ORFs were found in reading frame 3.


ORF Finder ATG,CTG,TTG,GTG direct : 


No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 84 to base 605.
ATGGTGTTTTCTATTTCTGGCTGCGCTTTGACTTCGTCAACTAGTCTTTGTCGCATCGAT
GGGTCTCTTATTGCACGTACCCTTTCGCCAAATTCGAGTGCCCTTACTTCGTCCCAGGCG
GGTGTTCGAAAAAAGTTATCTGTGTATAAACCACCGACACCACCTCCGCTTCTAGGTACG
GTTACCGAGGTCACGTTCAAACCCTCCGCTCGCATTGCTGATACGCGTTCGTCGAGTCGT
TCTTTTCCAATTTCTACTGCGCTGCTAAACAAAGCGCCCCGCGAGGCTCTTGCTTCGTCT
GCGATGAGGTCCATTTCTGCCTCGAAGTCATCGAAGTCAGAGACGGTTTGCATCAAACCT
CCATGTTTGCCAACTTCTTTAGCGACCGCTCTCAGTTCATCGCGCTCCGCAAAAGTACCT
GGGATTGAGCGCCCATCGGGTAGTCGATGCGGTGGAAATCGATTGGTAGAGAATCCTACA
GCTCCTTCTTTGACCGATTGCCCAGCCAGTTCGGCTATTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MVFSISGCALTSSTSLCRIDGSLIARTLSPNSSALTSSQAGVRKKLSVYKPPTPPPLLGT
VTEVTFKPSARIADTRSSSRSFPISTALLNKAPREALASSAMRSISASKSSKSETVCIKP
PCLPTSLATALSSSRSAKVPGIERPSGSRCGGNRLVENPTAPSLTDCPASSAI*


ORF Finder ATG,CTG,TTG,GTG reverse :


>ORF number 1 in reading frame 1 on the reverse strand extends from base 184 to base 396.
TTGTGGGCTGGTCGGCCACTGCGCCACTCGCTTTTACGTGATGGGAGAACGTGCTGTCGA
AGAAGCAGCCACCCCGGACGAAATTCGTCAAATAGCCGAACTGGCTGGGCAATCGGTCAA
AGAAGGAGCTGTAGGATTCTCTACCAATCGATTTCCACCGCATCGACTACCCGATGGGCG
CTCAATCCCAGGTACTTTTGCGGAGCGCGATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LWAGRPLRHSLLRDGRTCCRRSSHPGRNSSNSRTGWAIGQRRSCRILYQSISTASTTRWA
LNPRYFCGAR*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 65 to base 874.
ATGATGGAGACTGTGGAGGACATACCTAAGAACGCCATACTGCATGGTCTCCCTTGGAAT
TGGACATCCTATGGCGGCTACCTTGACGCCCTATCGGAGCTCGGACCATCAATCAATGTT
TGTGGGCTGGTCGGCCACTGCGCCACTCGCTTTTACGTGATGGGAGAACGTGCTGTCGAA
GAAGCAGCCACCCCGGACGAAATTCGTCAAATAGCCGAACTGGCTGGGCAATCGGTCAAA
GAAGGAGCTGTAGGATTCTCTACCAATCGATTTCCACCGCATCGACTACCCGATGGGCGC
TCAATCCCAGGTACTTTTGCGGAGCGCGATGAACTGAGAGCGGTCGCTAAAGAAGTTGGC
AAACATGGAGGTTTGATGCAAACCGTCTCTGACTTCGATGACTTCGAGGCAGAAATGGAC
CTCATCGCAGACGAAGCAAGAGCCTCGCGGGGCGCTTTGTTTAGCAGCGCAGTAGAAATT
GGAAAAGAACGACTCGACGAACGCGTATCAGCAATGCGAGCGGAGGGTTTGAACGTGACC
TCGGTAACCGTACCTAGAAGCGGAGGTGGTGTCGGTGGTTTATACACAGATAACTTTTTT
CGAACACCCGCCTGGGACGAAGTAAGGGCACTCGAATTTGGCGAAAGGGTACGTGCAATA
AGAGACCCATCGATGCGACAAAGACTAGTTGACGAAGTCAAAGCGCAGCCAGAAATAGAA
AACACCATGAATCGCTGGTTCTATATGGGTGATCAATCGCGCCCGTGCTATACGCAATCT
CTCGATCAGAGCCTCACAGGCATGGCTAAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSINVCGLVGHCATRFYVMGERAVE
EAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDGRSIPGTFAERDELRAVAKEVG
KHGGLMQTVSDFDDFEAEMDLIADEARASRGALFSSAVEIGKERLDERVSAMRAEGLNVT
SVTVPRSGGGVGGLYTDNFFRTPAWDEVRALEFGERVRAIRDPSMRQRLVDEVKAQPEIE
NTMNRWFYMGDQSRPCYTQSLDQSLTGMAK

No ORFs were found in reading frame 3.


ORF Finder any codon direct : 

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 305 to base 511.
TACGCGTTCGTCGAGTCGTTCTTTTCCAATTTCTACTGCGCTGCTAAACAAAGCGCCCCG
CGAGGCTCTTGCTTCGTCTGCGATGAGGTCCATTTCTGCCTCGAAGTCATCGAAGTCAGA
GACGGTTTGCATCAAACCTCCATGTTTGCCAACTTCTTTAGCGACCGCTCTCAGTTCATC
GCGCTCCGCAAAAGTACCTGGGATTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
YAFVESFFSNFYCAAKQSAPRGSCFVCDEVHFCLEVIEVRDGLHQTSMFANFFSDRSQFI
ALRKSTWD*

>ORF number 1 in reading frame 3 on the direct strand extends from base 72 to base 605.
AACCAGCGATTCATGGTGTTTTCTATTTCTGGCTGCGCTTTGACTTCGTCAACTAGTCTT
TGTCGCATCGATGGGTCTCTTATTGCACGTACCCTTTCGCCAAATTCGAGTGCCCTTACT
TCGTCCCAGGCGGGTGTTCGAAAAAAGTTATCTGTGTATAAACCACCGACACCACCTCCG
CTTCTAGGTACGGTTACCGAGGTCACGTTCAAACCCTCCGCTCGCATTGCTGATACGCGT
TCGTCGAGTCGTTCTTTTCCAATTTCTACTGCGCTGCTAAACAAAGCGCCCCGCGAGGCT
CTTGCTTCGTCTGCGATGAGGTCCATTTCTGCCTCGAAGTCATCGAAGTCAGAGACGGTT
TGCATCAAACCTCCATGTTTGCCAACTTCTTTAGCGACCGCTCTCAGTTCATCGCGCTCC
GCAAAAGTACCTGGGATTGAGCGCCCATCGGGTAGTCGATGCGGTGGAAATCGATTGGTA
GAGAATCCTACAGCTCCTTCTTTGACCGATTGCCCAGCCAGTTCGGCTATTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
NQRFMVFSISGCALTSSTSLCRIDGSLIARTLSPNSSALTSSQAGVRKKLSVYKPPTPPP
LLGTVTEVTFKPSARIADTRSSSRSFPISTALLNKAPREALASSAMRSISASKSSKSETV
CIKPPCLPTSLATALSSSRSAKVPGIERPSGSRCGGNRLVENPTAPSLTDCPASSAI*


ORF Finder any codon reverse :

>ORF number 1 in reading frame 1 on the reverse strand extends from base 151 to base 396.
CGCCCTATCGGAGCTCGGACCATCAATCAATGTTTGTGGGCTGGTCGGCCACTGCGCCAC
TCGCTTTTACGTGATGGGAGAACGTGCTGTCGAAGAAGCAGCCACCCCGGACGAAATTCG
TCAAATAGCCGAACTGGCTGGGCAATCGGTCAAAGAAGGAGCTGTAGGATTCTCTACCAA
TCGATTTCCACCGCATCGACTACCCGATGGGCGCTCAATCCCAGGTACTTTTGCGGAGCG
CGATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
RPIGARTINQCLWAGRPLRHSLLRDGRTCCRRSSHPGRNSSNSRTGWAIGQRRSCRILYQ
SISTASTTRWALNPRYFCGAR*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 874.
TTTGGCAACTGCGGCGTCACTTTCGCGCCCTGTAAAGAATCGGATCGTGAATTCCTAGCG
GGGATGATGGAGACTGTGGAGGACATACCTAAGAACGCCATACTGCATGGTCTCCCTTGG
AATTGGACATCCTATGGCGGCTACCTTGACGCCCTATCGGAGCTCGGACCATCAATCAAT
GTTTGTGGGCTGGTCGGCCACTGCGCCACTCGCTTTTACGTGATGGGAGAACGTGCTGTC
GAAGAAGCAGCCACCCCGGACGAAATTCGTCAAATAGCCGAACTGGCTGGGCAATCGGTC
AAAGAAGGAGCTGTAGGATTCTCTACCAATCGATTTCCACCGCATCGACTACCCGATGGG
CGCTCAATCCCAGGTACTTTTGCGGAGCGCGATGAACTGAGAGCGGTCGCTAAAGAAGTT
GGCAAACATGGAGGTTTGATGCAAACCGTCTCTGACTTCGATGACTTCGAGGCAGAAATG
GACCTCATCGCAGACGAAGCAAGAGCCTCGCGGGGCGCTTTGTTTAGCAGCGCAGTAGAA
ATTGGAAAAGAACGACTCGACGAACGCGTATCAGCAATGCGAGCGGAGGGTTTGAACGTG
ACCTCGGTAACCGTACCTAGAAGCGGAGGTGGTGTCGGTGGTTTATACACAGATAACTTT
TTTCGAACACCCGCCTGGGACGAAGTAAGGGCACTCGAATTTGGCGAAAGGGTACGTGCA
ATAAGAGACCCATCGATGCGACAAAGACTAGTTGACGAAGTCAAAGCGCAGCCAGAAATA
GAAAACACCATGAATCGCTGGTTCTATATGGGTGATCAATCGCGCCCGTGCTATACGCAA
TCTCTCGATCAGAGCCTCACAGGCATGGCTAAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
FGNCGVTFAPCKESDREFLAGMMETVEDIPKNAILHGLPWNWTSYGGYLDALSELGPSIN
VCGLVGHCATRFYVMGERAVEEAATPDEIRQIAELAGQSVKEGAVGFSTNRFPPHRLPDG
RSIPGTFAERDELRAVAKEVGKHGGLMQTVSDFDDFEAEMDLIADEARASRGALFSSAVE
IGKERLDERVSAMRAEGLNVTSVTVPRSGGGVGGLYTDNFFRTPAWDEVRALEFGERVRA
IRDPSMRQRLVDEVKAQPEIENTMNRWFYMGDQSRPCYTQSLDQSLTGMAK

No ORFs were found in reading frame 3.