ORF EL16020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01159979.1
Annotathon code: ORF_EL16020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : carozou
Annotated on : 2008-03-19 18:52:37
  • ACIEN caroline
  • BENIKHLEF zoubida

Synopsis

Genomic Sequence

>AACY01159979.1 ORF_EL16020 genomic DNA
GGTCTTTATGGTGGCTTTACGAATGATTTTACAGAGCACTGGATCCGAGGCCTGATCTACATGGTCTCGGTAATGGCAATTTTGTCGGCGCATGAAGCAG
GGCACTTTGTTGCAGCATGGCGTCATCGAATTCCTGCAACGCTTCCATTTTTCTTACCGCTTCCAGTGATGCTAACTGGGACACTTGGCGCCGTAATTGG
CATGGAAGGATCTCGGGCAGACAGAAAACAGTTATTTGATATCGCCTTAGCTGGACCTCTCGCTGGTCTTCTTGTTGCGATTCCTGTTTTTGTAGCGGGG
CTGGTGCTTGCTCAACCGGCAGATAGCAGCCTGTTTTCAATGCCTTTACTTGCAACATGGCTTTTGAGACTTGTTCGGCCAGATTTACCAGTAGGCCAGG
TGCTTATCCCAAATGCGTTCTTGCTGGCTGGCTGGGTAGGTTTTCTTGTAACTGGACTGAATATGATTCCCCTCAGCCAACTCGATGGTGGGCATATTAG
CCATGCTGTTTTTGGTCGGCGTTCGTGCTGGGTGGCCAGAAGTGTCCTCCTCGGAGCAATAACCGCTATTATTCTTGTAGGAGCTGATCATTGGGTTTTA
ATGGTTGTTTTAGTCACGTTTATGGGTGTCGATCACCCGCCCATTCGAAATGAATCGCAGCCGTTGGGCACCGCGAGAACAATTCTGGGCATTGCTTCAT
TTGTCATTCCGGTGATTACATTCATGCCGGAGCCGCTGCTGCTGCCCGGATTCATTTTCATTCGTTGACGCCCTGCCATTCCGCTCACACAATAGATTAA
GATTGTTTTAGATGGAGTCAGACGCACTGGTTCCAAGGCTGCTACATAACCGAGAGGTGATCCGTGAACTTTGTTGAACTAAAAGACCCTGCAATTTGGT
CATCAA

Translation

[1 - 765/906]   direct strand
>ORF_EL16020 Translation [1-765   direct strand]
GLYGGFTNDFTEHWIRGLIYMVSVMAILSAHEAGHFVAAWRHRIPATLPFFLPLPVMLTGTLGAVIGMEGSRADRKQLFDIALAGPLAGLLVAIPVFVAG
LVLAQPADSSLFSMPLLATWLLRLVRPDLPVGQVLIPNAFLLAGWVGFLVTGLNMIPLSQLDGGHISHAVFGRRSCWVARSVLLGAITAIILVGADHWVL
MVVLVTFMGVDHPPIRNESQPLGTARTILGIASFVIPVITFMPEPLLLPGFIFIR

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

    ((Pfuriosus:0.30526,(Tkodaka:0.53332,(Lborgpe:1.01680,((Caurant:1.19301,
((ORF_EL1602:0.48718,Bmarina:1.15732):0.46990,(Mxanthus:1.03630,
Selongatus:1.26340):0.07723):0.04356):0.04431,((((Maceti:0.26945,
Mbarkeri:0.29795):0.53815,Umethano:0.82575):0.06192,Hsp:0.94363):0.29708,
Ckuenenia:0.70509):0.04773):0.08995):0.70530):0.26118):0.05944,
Phorikoshi:0.19789,Pabyssi:0.17951);

Annotator commentaries

Recherche d'ORF:on a fait une recherche d'ORF avec ATG et any codon. Nous avons gardé l'ORF la plus longue avec any codon, c'est celle qui nous semblait la plus intéressante car nous soupçonnons que séquence est partielle, en effet elle commence au nucléotide numéro1 et donc on peut supposer qu'elle commence avant. Pour l'étude du Blast on a fait un Blast P contre swissprot et il y avait très peu d'homologies donc on a fait un Blast P contre nr où ici il y a beaucoup d'homologies. Notre ORF n'étant pas similaire à un groupe taxonomique particulier nous avons pris un groupe d'étude plus large et différents groupes extérieurs. Arbre: On a fait un arbre avec la méthode de parcimonie mais cela n'a rien donné de concluant. Nous avons gardé l'arbre avec le traitement neighbor. Nous avons pris comme groupe extérieur P.abyssi. Nous avons effectué deux arbres avec deux groupes extérieurs différents mais aucune différence majeure n'a été observée. Nous pouvons tirer de cette arbre deux hypothèses: HYPO I :Toutes les protéines appartenant aux différents groupes taxonomiques proches de notre ORF n'ont pas de symboles prédéfinis donc nous ne pouvons pas attribuer de symboles à notre ORF.

HYPO II: Nous soupçonnons que notre protéine est une peptidase ( par rapport aux fonctions hypothétiques des groupes taxonomiques voisins)

Domaine protéique : il nous a renseigné sur la fonction: c' est une metallo endopeptidase.

Conclusion: nous ne pouvons pas dire à quel groupe taxonomique notre ORF appartient mais nous pouvons prédire la fonction de la protéine qui est une peptidase.

Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Pabyssi          --------------------------------------------MVKGIYECISCGHREV
Phorikoshi       ------------------------------------------------------------
Pfuriosus        -----------------------------------MVREGRWRLLPRGIYECVNCKHREV
Tkodaka          --------------------------------------------MPRGIYECVNCGHREV
Maceti           ------------------------------------------------------------
Mbarkeri         ------------------------------------------------------------
Umethano         ------------------------------------------------------------
Ckuenenia        ------------------------------------------------------------
ORF_EL16020      ------------------------------------------------------------
Bmarina          ------------------------------------------------------------
Caurant          ------------------------------------------------------------
Hsp              ------------------------------------------------------------
Mxanthus         ------------------------------------------------------------
Selongatus       MLFLLLWLILLAVGSYWMLQRNVPRLSRTPVWLLWLVLMMPAFIWIGWGLLLGQQGGQLP
Lborgpe          ------------------------------------------------------------
                                                                             

Pabyssi          RDSTKPLLPNACPVCGGDMILVGYEID-------------------------------IE
Phorikoshi       ------------------MILVGYEID-------------------------------VE
Pfuriosus        LDKTQPLLPGRCPVCGGDMILVGYELD-------------------------------IE
Tkodaka          LDSTEPVIERACPKCGGDMILVGYAVSGVESPNVRSGREEVPAPEGSGVSPGVEVPRESP
Maceti           ----------------MKQRRKGQENS-------------------------------DT
Mbarkeri         --------------MNQENHNKGKGIF-------------------------------NA
Umethano         ------------------------------------------------------------
Ckuenenia        ------------------------------------------------------------
ORF_EL16020      ------------------------------------------------------------
Bmarina          ------------------------------------------------------------
Caurant          -----------------------------------------------------MFDFDPT
Hsp              --------------------------------------------------------MPPE
Mxanthus         ------------------------------------------------------------
Selongatus       FVIFLLPLLISSLLYWTLLQWGRLPPSRSLPTNETEAAAIAAASETLQVASAPPARSLTA
Lborgpe          ------------------------------------------------------------
                                                                             

Pabyssi          GEEHPGIEEFLRKYYELGQLLEARGDTYVYEVISIKEKNFEKVLSEAEKIGY------WL
Phorikoshi       EEEHG-VEEALRKFYELGSLLERRGEVYVYEVLGIIEKDFEKVLKEMEKLGY------WV
Pfuriosus        EEEKPSFEDFLREHYDLGELIEHRGEVYAYEVLGIKTENFEEVLREAEKFGY------WL
Tkodaka          HGLPPEVEAKLNEFYSLRFYG-FDGHVAVFEVLDIYEKNFERVLRELENLGY------WA
Maceti           EEMISRIYPYITRVFDIYEIQKSGEILYFFGTPKTDAENVMGELWAPLEQRG------LG
Mbarkeri         EETVSRLYPYIVRVFDVYEVQNSGEALYFFGTPRTNTENITGELWEPLQQFG------FG
Umethano         -MIEKDDLAVVSQVFQVYETHENEPYVHLYGEPLVDSNVFYGKVYDHFRAKG------KS
Ckuenenia        ------------------------------------------------------------
ORF_EL16020      ------------------------------------------------------------
Bmarina          ----------MTGMTDSSPPEPTQRETLDSYDSVPPTPAVSRAEGAPAAAPS------RP
Caurant          SALRILAAEVMLVHSSEELANGDQRAVRCRGQLLLEAQAAHDTIVARAQALG------YT
Hsp              SPADAPSPAAFGDRFDVYDVQHRDGELLYFGQPGADRATIERELWPLFREHG------YD
Mxanthus         -------------------------------MSRSVRDTWYRSGWAAARCNA------HL
Selongatus       EEEAQVRQCFPFDRFNLQRLEYRYQAVICRGNLRGDPATVYEQVQTAVQQQFGDRFLVML
Lborgpe          ------------------------------------------------------------
                                                                             

Pabyssi          ALKRAKDGRIILYAFPAQKIESRE-NPLIGILLFILTLLSTFFAGYILSTLYVTTLEE--
Phorikoshi       ALKRSKD-KTLLYVFPAKNVESRE-NPLIGIILFVLTLFSTFFAGYILSSLYVATLNE--
Pfuriosus        ALKRREG-KIVLYVFPAQLYEDKE-NPLVGIALFILTLLSTFFAGYILSLNYVKTLED--
Tkodaka          ALKKRDG-RIVLFVFPAGKIPP-D-NPWLPWLFLVLTVLSTFFAGYYLALNYIATLEH--
Maceti           GTLKYELGEHVLIVTPVKKAKE---KHWVNLALFIATVFTTMICGAWLFG----------
Mbarkeri         CTLKYELGEYVLLVFPEKKAKE---KTWINLVLFIATFFTTMVCGAWMSG----------
Umethano         VWVEHRLGEYVLTIAPAKKESA-----WINVALAVATFLTTMLTGSMMYG----------
Ckuenenia        -----------MTREDQKSPPFFK-KVRIHVLLFIATFLTTY------------------
ORF_EL16020      -----------------------------GLYGGFTNDFTEH------------------
Bmarina          VRQRRVLLPILLFVATCLSTFFVG-WTRWQPTMLLGGMVDAEYDPLLSDPLVEG------
Caurant          PLFQHDPIGAAILFIPTPPKAPPS-RLWLAVLLFVLTIASTMLVGGQEYIESTG------
Hsp              VRLTDRTGERVLVATPADAADTDTGVPWTNVALFLATLASTLFVGANWYYVDPFS-----
Mxanthus         LLLANLEAPFMDTVSAARPAPRYWVHLLLLVLTVGTTFTSYLLYFHFQRPYSLG------
Selongatus       REDNAGKPFFALIPNPLRQQPRLALKPMLALVLLGLTLLTTTLVGFVLSYAGQLAEIQPQ
Lborgpe          ---------------------MKQSRFSTHIILFILTFLTLTFQSEFFELPFLS------
                                                                             

Pabyssi          --LNLPGIKNTYLNALAFSLGIISILGTHEMGHKIAASIHNVKSTFPYFIPFPS-FIGTL
Phorikoshi       --LNLPGIKNVYLNALAFSLGIISILGTHEMGHKIAATLHNVKSTFPYFIPFPS-FIGTL
Pfuriosus        --LNLPGIKNLYLNALAFSLGIISILGSHEMGHKIAATIHNVKSTFPYFIPFPS-FIGTL
Tkodaka          --YGLPGLRNPYIIALSFSVSVMAIIGTHELGHKIAATYHGVKATMPYFIPFPN-ILGTL
Maceti           --VDLWSEPLQIFQGLPFTLAILAVLGSHEMAHYAMARHHGMKTSLPYFIPFPT-FIGTM
Mbarkeri         --ADLENDLFQLFRGLPFTLAIMAVLGSHEMAHYVMARYHGMKASLPYFIPFPT-FIGTM
Umethano         --VNPITDPLDVYKGLPFAIAIMVALGSHELGHYIVSRKYGIDATLPYFIPFPFSPIGTM
Ckuenenia        -----------YVNGIWYSLAIMSILLSHELGHFFMCRKYHVDATLPYFLPLPLPPFGTF
ORF_EL16020      -----------WIRGLIYMVSVMAILSAHEAGHFVAAWRHRIPATLPFFLPLPVMLTGTL
Bmarina          --IRLVLRHVSVSDGLIYMACLLAILFAHEMGHFLMTVRYRIHASYPYFIPIPISPIGTM
Caurant          ------QIVFNWGYALSFSASLLAILLAHELGHFIVARREGVAVSYPFFIPMPFFLLGTM
Hsp              ---------PAVVRAIPFTLAVMGVLGTHELGHYVMSKHHDVDATLPYFIPFPS-LFGTM
Mxanthus         -----EVSPEAAFRALAFSLSLLAILGTHEMGHYVLARWHRVETSLPYFIPLPVLGVGTL
Selongatus       LARSLEDNPAALLRGLPYALSLLAILGVHEFGHFWAARKHRLQASLPYFIPVPA-FLGTF
Lborgpe          ----IQSLKELFFLRLPYSLSLIIILSAHEMGHFLAARYYGIKATWPYFIPIPFAPIGTM
                                : :   ::  :  ** .*        :  : *:*:*.*    **:

Pabyssi          GAVIRVKSPIPTRNAEVDLGVSGPIAGLLVAIPVTIIGLKLSAVVPINYLEKGE------
Phorikoshi       GAVIRVKSPIPTRNAAVDLGASGPIAGLLVAIPVTIIGLKLSVIVPVDYLKQGE------
Pfuriosus        GAIIRVKSPIPTRNAAIDLGASGPLVGLIVAIPVTAIGLRLSPLVPVDYLQGEG------
Tkodaka          GAVIRVKSPLPTRNAAIDLGVSGPIAGFLVAVPVTVLGLKLSVLVPMSMVPSTEG-----
Maceti           GAVIRYRGPIPDRKALFDVGIAGPLVGLLVSIVVTIIGLNLDVPAVKPLPDSLMF-----
Mbarkeri         GALIRYRGPVPSRKALFDVGVAGPLVGLFMSVAVTVIGLNLEASAVNPFSKFVMP-----
Umethano         GAIIRQKGPVPNRKALFDVGIAGPLVGLAVSVVIIVIGLMLPAPEIDTTSGTYMQ-----
Ckuenenia        GAVIKMKGHIPHKRALFDIGAAGPLMGLVFAIPAIVVGLILSDVRPVPADSSNY------
ORF_EL16020      GAVIGMEGSRADRKQLFDIALAGPLAGLLVAIPVFVAGLVLAQPADSSLFS---------
Bmarina          GAVIGMDGLKANRRQLFDIGLAGPLAGLVIAIPVLYVG-ILQMDLTKTAPSPYSL-----
Caurant          GAFIAIKDLVPNRRALLAIGIAGPLAGLVVAIPVLAIGLSISEVKQVVPLPGSFT-----
Hsp              GAVIRMRGRMPSRNALFDIGAAGPLAGLVAAVVVSVIGLVLPPVTVPPGVANSAS-----
Mxanthus         GAVIRIRDRIPNRNALVDIGAAGPLAGLVVALPILFWGLAHSTVVDAPDIPSTLFPGDGS
Selongatus       GAFVRIRSPIPDRKALFDVGVSGPLAGLVITLPLLIWGLTQSQVVPMPERSGLLN-----
Lborgpe          GAVIRILEPIRNKKQLFDIGIWGPLMSLILSVPCYIVGIYLSSLGPIDSVRENPG-----
                 **.:        :.  . :.  **: .:  ::     *                      

Pabyssi          ---------------------------TIYF---GSSLLFYGLMKLVLGDLPQNVGIILH
Phorikoshi       ---------------------------TIYF---GTSILFYALTKFVLGNLPQGSGIILH
Pfuriosus        ---------------------------TIYF---GMNLIFYGLSKLVIGDVPEGFGIILH
Tkodaka          ---------------------------GLYF---GTNLLFEALQRLVLN-VQGDYVIFLH
Maceti           ---------------------------ELGL---PPLFVMLQKLVGVTG-------SNLH
Mbarkeri         ---------------------------SG-L---PPLFVFIQNLVGATG-------ENLH
Umethano         ---------------------------IN-----TPLLFDFLAWVVHPG----ETLTSVN
Ckuenenia        ----------------------------LGL---GEPVLFSFIAKLLFGTLPEGMDIYLH
ORF_EL16020      -----------------------------------MPLLATWLLRLVRPDLPVGQVLIPN
Bmarina          ---------------------------DVPL---GLAWAMAWFQVPGYSLGDPVAQAQLN
Caurant          ---------------------------EG-N---SLLYAAMKILIFGRFLPSGGEDVYLH
Hsp              ---------------------------AVHVDFGYPLLLRGIAAVLGEQFAYADPRTAVN
Mxanthus         LWVIGRDVFTWVMDRVTNAPPAPETPFNGVQTLFGDSLLMQGLTRLALGPLPEGKDILVH
Selongatus       ---------------------------FSALDPGVSILMGLISHLSLGDRLGLNQALQLH
Lborgpe          -----------------------------IISFGESIFTITMNQWILGPFDPAAQDVWIH
                                                                            :

Pabyssi          PLAVAGWVGILVTFLNLIPAAQLDGGHVARALLPEKAHRVLTYTLGFLTIG---------
Phorikoshi       PLAVAGWVGILVTFLNLIPAAQLDGGHIARALMPERAHRILTYALGFITLG---------
Pfuriosus        PLAIAGWVGILVTFLNLLPAAQLDGGHIARAFLPEKVHRVLTYALGFVAIG---------
Tkodaka          PVAIAGWVGILVTFLNLIPVAQLDGGHILRAFISEKAHKMITYAAALLLVG---------
Maceti           PVAFAGWVGMFVTLLNLLPAGQLDGGHVLRAMLGKKADWVSSMMPRILLMIGIYVVYG--
Mbarkeri         PVAFAGWVGMFVTLLNLLPAGQLDGGHILRAMLGKKAEKISFMMPRVLFLIGLYVIYW--
Umethano         PIAFAGWVGLLVTVLNMIPVGQLDGGHVSRAVFGERANLISRVMPIIIMAFGLYGTFI--
Ckuenenia        PLAFAGWAGLFVTALNLLPIGQLDGGHIMYALLGKKSDIVYRIGIFIFCVIT--------
ORF_EL16020      AFLLAGWVGFLVTGLNMIPLSQLDGGHISHAVFGRRSCWVARSVLLGAITA---------
Bmarina          PYFMAGWVGLLVTGLNMLPISQLDGGHVAYTLFGKWSYFLAWGVIIAAVTA---------
Caurant          PVALAGWAGLLVTGLNLLPAGQLDGGHIFFALFGARAARIMSMIVAVALLG---------
Hsp              PVVMGGWIGMFVTFLNLLPVGQLDGGHILRSLVGETAGRFAPLVPTALLSLGAYLWIVRD
Mxanthus         PVVIAGWFGLLVTLLNLMPVGQLDGGHLAYALWGRRAHWVGRAVALVLLVLT--------
Selongatus       PVAIAGYLGLIVTALNLVPVGQLDGGHIVHAMFGQRQGAVIGQVARLCILALS-------
Lborgpe          PLAQAGWVGLLVTAINLLPFGQLDGGHVIYSVFGERYRNWIYYLFTAFLLLCLWN-----
                 .   .*: *::** :*::* .******:  :.                            

Pabyssi          LAYFWPGWILWGILILLMGRVGNPGALDEVSPLTTSRKILAIIIWIIFVICAVPVPFSQK
Phorikoshi       LSYFWPGWLLWGILILLMGRIGNPGALDEVTPLTPGRKALAILIWIIFAISAVPVPFSQR
Pfuriosus        LSYLWPGWFLWGLLILIMGRVGNPGALDEVTPLTWSRKVLAIIIWAVFIASATLVPFSTS
Tkodaka          MSYLWSGWLIWAILIIFIGSAGNPGALDEVSPISKGRIVLALTALVIFVITATPRPLWTA
Maceti           LKGDGFIWIFWALFLWAFAAAGHPSPLHDKMKLDRKRILIGILTFILGLLCFTLIPFKPI
Mbarkeri         LKEDGFIWISWALFLWIFAAIGHPSPLHDEVELDKKRILLGIITFILGLLCFTLIPFKPI
Umethano         LQQPGEIWILWGFLSALMSAGSHPKPTDDTQTIGVPRYILAAAAFVLALLCFTPFPITM-
Ckuenenia        -VFFYKGWILFAILLLIFGFR-HPSPADEYTPLDPRRKMLGIALFIIFLLSFTPVPLKF-
ORF_EL16020      IILVGADHWVLMVVLVTFMGVDHPPIRNESQPLGTARTILGIASFVIPVITFMPEPLLLP
Bmarina          MALGAGWTWILMLILVLVIGPSHPPTADDSVKIGAVRWIVGFTSLVIPILCFPPQAIIT-
Caurant          LGFLWSGWFIWAVMVALIGQQ-RSPLRNEISPLEGPWRWLAYLGLLTFILVFTPVPITVM
Hsp              AGNAAGIWLLWGVLASVVSLSGTVTPVDDR-PLDRRRVALGVVTFVLGALCFMPVPIQLG
Mxanthus         -LFVTASWGLWLLVTSKLVGFGHPEVVEPQEPLSPLRKWICALCLLALIGCAMPIPLRQV
Selongatus       ---FVRSELLLWALLLLLLPVADEPALNDLSELDDRRDGIGFLALFILILIVLPLPPVLQ
Lborgpe          -----FSWLLWGFLIYFIIKVEHPFVPDPAAPLDRIRKIGGLLVLFALIFIFVPSPIQLG
                              .   .         .    :                      .    

Pabyssi          A----------------------
Phorikoshi       L----------------------
Pfuriosus        S----------------------
Tkodaka          -----------------------
Maceti           T----------------------
Mbarkeri         P----------------------
Umethano         -----------------------
Ckuenenia        -----------------------
ORF_EL16020      GFIFIR-----------------
Bmarina          -----------------------
Caurant          TP---------------------
Hsp              -----------------------
Mxanthus         MT---------------------
Selongatus       QWLTAL-----------------
Lborgpe          TNMNRPGLAEEVWISLKSVYSSL
                                        

BLAST

BlastP contre nr:

Sequences producing significant alignments:                        (Bits)  Value

gi|87306567|ref|ZP_01088714.1|  hypothetical protein DSM3645_0...   189    1e-46
gi|91202377|emb|CAJ72016.1|  conserved hypothetical protein [C...   146    9e-34
gi|110619951|emb|CAJ35229.1|  putative metalloprotease (M50 fa...   139    1e-31
gi|57641182|ref|YP_183660.1|  membrane-associated metallopepti...   132    2e-29  
gi|108760121|ref|YP_634836.1|  peptidase, M50 (S2P protease) f...   132    2e-29  
gi|81298898|ref|YP_399106.1|  hypothetical protein Synpcc7942_...   129    2e-28  
gi|56751426|ref|YP_172127.1|  hypothetical protein syc1417_d [...   129    2e-28  
gi|14521814|ref|NP_127290.1|  hypothetical protein PAB1063 [Py...   129    2e-28  
gi|76258449|ref|ZP_00766104.1|  Peptidase M50 [Chloroflexus au...   127    4e-28
gi|118045307|ref|ZP_01513969.1|  peptidase M50 [Chloroflexus a...   127    5e-28
gi|115377636|ref|ZP_01464831.1|  peptidase, M50 family [Stigma...   127    6e-28
gi|20089141|ref|NP_615216.1|  hypothetical protein MA0243 [Met...   125    2e-27  
gi|116329531|ref|YP_799251.1|  Peptidase, M50 family [Leptospi...   125    2e-27  
gi|73668262|ref|YP_304277.1|  zinc metalloprotease [Methanosar...   124    3e-27  
gi|67923155|ref|ZP_00516644.1|  Peptidase M50 [Crocosphaera wa...   122    2e-26
gi|86160740|ref|YP_467525.1|  peptidase M50 [Anaeromyxobacter ...   121    3e-26  
gi|15790876|ref|NP_280700.1|  hypothetical protein VNG2012C [H...   121    3e-26  
gi|16331565|ref|NP_442293.1|  hypothetical protein slr0643 [Sy...   120    4e-26  
gi|14590262|ref|NP_142328.1|  hypothetical protein PH0351 [Pyr...   120    7e-26  
gi|106888483|ref|ZP_01355683.1|  Peptidase M50 [Roseiflexus sp...   120    8e-26
gi|18976764|ref|NP_578121.1|  metalloprotease [Pyrococcus furi...   119    1e-25  
gi|86606401|ref|YP_475164.1|  peptidase, M50B family [Synechoc...   119    1e-25  
gi|23127252|ref|ZP_00109126.1|  COG0750: Predicted membrane-as...   119    2e-25
gi|68551965|ref|ZP_00591358.1|  Peptidase M50 [Prosthecochlori...   119    2e-25
gi|17230910|ref|NP_487458.1|  hypothetical protein all3418 [No...   118    2e-25  
gi|75909644|ref|YP_323940.1|  Peptidase M50 [Anabaena variabil...   118    2e-25  
gi|91773435|ref|YP_566127.1|  peptidase M50 [Methanococcoides ...   118    3e-25  
gi|21227625|ref|NP_633547.1|  Zinc metalloprotease [Methanosar...   117    4e-25  
gi|68548817|ref|ZP_00588286.1|  Peptidase M50 [Pelodictyon pha...   117    5e-25
gi|48477315|ref|YP_023021.1|  zinc metalloprotease [Picrophilu...   115    2e-24  
gi|24212763|ref|NP_710244.1|  hypothetical protein LA0063 [Lep...   115    2e-24  
gi|22298414|ref|NP_681661.1|  hypothetical protein tll0871 [Th...   114    3e-24  
gi|55378407|ref|YP_136257.1|  hypothetical protein rrnAC1637 [...   113    7e-24  
gi|94968211|ref|YP_590259.1|  peptidase M50 [Acidobacteria bac...   113    1e-23  
gi|113477344|ref|YP_723405.1|  peptidase M50 [Trichodesmium er...   112    1e-23  
gi|76801782|ref|YP_326790.1|  probable metalloprotease [Natron...   112    2e-23  
gi|11497673|ref|NP_068894.1|  hypothetical protein AF0053 [Arc...   111    3e-23  
gi|118065171|ref|ZP_01533479.1|  peptidase M50 [Roseiflexus ca...   111    3e-23
gi|13541085|ref|NP_110773.1|  Predicted membrane-associated Zn...   111    4e-23  
gi|86607717|ref|YP_476479.1|  peptidase, M50B family [Synechoc...   109    1e-22  
gi|16082612|ref|NP_394800.1|  Predicted membrane-associated Zn...   108    3e-22  
gi|67919415|ref|ZP_00512993.1|  Peptidase M50 [Chlorobium limi...   108    3e-22
gi|71482040|ref|ZP_00661741.1|  Peptidase M50 [Prosthecochlori...   108    3e-22
gi|110667076|ref|YP_656887.1|  probable membrane associated me...   106    9e-22  
gi|10640687|emb|CAC12465.1|  conserved hypothetical membrane p...   106    1e-21  
gi|55379738|ref|YP_137588.1|  hypothetical protein rrnAC3176 [...   105    2e-21  
gi|69268506|ref|ZP_00609238.1|  Peptidase M50 [Ferroplasma aci...   104    4e-21
gi|78187529|ref|YP_375572.1|  zinc protease, putative [Pelodic...   102    1e-20  
gi|67938062|ref|ZP_00530592.1|  Peptidase M50 [Chlorobium phae...   100    4e-20
gi|118195386|gb|ABK78304.1|  membrane-associated Zn-dependent ...  99.0    2e-19
gi|116624251|ref|YP_826407.1|  peptidase M50 [Solibacter usita...  98.2    3e-19  
gi|23128478|ref|ZP_00110323.1|  COG0750: Predicted membrane-as...  97.1    7e-19
gi|110597188|ref|ZP_01385477.1|  Peptidase M50 [Chlorobium fer...  96.7    8e-19
gi|67923178|ref|ZP_00516666.1|  Peptidase M50 [Crocosphaera wa...  96.7    9e-19
gi|21674522|ref|NP_662587.1|  zinc protease, putative [Chlorob...  93.6    8e-18  
gi|83815374|ref|YP_445072.1|  peptidase, M50 family protein [S...  92.0    2e-17  
gi|75907293|ref|YP_321589.1|  Peptidase M50 [Anabaena variabil...  92.0    2e-17  
gi|17229606|ref|NP_486154.1|  hypothetical protein alr2114 [No...  89.4    1e-16  
gi|15238440|ref|NP_198372.1|  EGY1 (ETHYLENE-DEPENDENT GRAVITR...  85.9    2e-15  
gi|13541649|ref|NP_111337.1|  Predicted membrane-associated Zn...  85.5    2e-15  
gi|115455845|ref|NP_001051523.1|  Os03g0792400 [Oryza sativa (...  84.7    4e-15  
gi|49457926|gb|AAO37991.2|  expressed protein [Oryza sativa (j...  84.3    5e-15  
gi|116060343|emb|CAL55679.1|  unnamed protein product [Ostreococc  84.0    6e-15
gi|16330216|ref|NP_440944.1|  hypothetical protein sll0862 [Sy...  84.0    6e-15  
gi|86607310|ref|YP_476073.1|  peptidase, M50 family [Synechoco...  82.8    1e-14  
gi|15239226|ref|NP_196193.1|  metalloendopeptidase [Arabidopsi...  81.3    4e-14  
gi|86608731|ref|YP_477493.1|  hypothetical protein CYB_1255 [S...  80.5    6e-14  
gi|42573279|ref|NP_974736.1|  metalloendopeptidase [Arabidopsis t  80.5    7e-14  
gi|113474292|ref|YP_720353.1|  peptidase M50 [Trichodesmium er...  79.3    2e-13  
gi|116062581|dbj|BAA79899.2|  hypothetical protein [Aeropyrum per  78.6    2e-13
gi|8978356|dbj|BAA98209.1|  unnamed protein product [Arabidopsis   78.2    3e-13
gi|54290179|dbj|BAD61067.1|  unknown protein [Oryza sativa (japon  77.8    4e-13  
gi|115434462|ref|NP_001041989.1|  Os01g0142100 [Oryza sativa (...  77.8    5e-13  
gi|14601068|ref|NP_147594.1|  hypothetical protein APE0915 [Aerop  77.4    6e-13  
gi|16081895|ref|NP_394299.1|  hypothetical protein Ta0839 [The...  75.9    2e-12  
gi|37521282|ref|NP_924659.1|  hypothetical protein glr1713 [Gl...  75.1    3e-12  
gi|56751543|ref|YP_172244.1|  hypothetical protein syc1534_d [...  72.8    2e-11  
gi|67934827|ref|ZP_00527853.1|  zinc protease, putative [Chlor...  72.4    2e-11
gi|110637322|ref|YP_677529.1|  zinc protease [Cytophaga hutchi...  71.6    3e-11  
gi|115455101|ref|NP_001051151.1|  Os03g0729000 [Oryza sativa (...  70.9    6e-11  
gi|22298733|ref|NP_681980.1|  hypothetical protein tll1190 [Th...  70.5    8e-11  
gi|81301385|ref|YP_401593.1|  hypothetical protein Synpcc7942_...  69.7    1e-10  
gi|69270399|ref|ZP_00610431.1|  Peptidase M50 [Ferroplasma aci...  65.1    3e-09
gi|30692714|ref|NP_851094.1|  DNA binding / metalloendopeptida...  65.1    3e-09  
gi|110740640|dbj|BAE98423.1|  hypothetical protein [Arabidopsis t  62.4    2e-08
gi|15220875|ref|NP_173229.1|  unknown protein [Arabidopsis tha...  62.0    2e-08  
gi|42780644|ref|NP_977891.1|  hypothetical protein BCE_1570 [B...  54.7    4e-06  
gi|49184372|ref|YP_027624.1|  hypothetical protein BAS1355 [Ba...  53.1    1e-05  
gi|30261543|ref|NP_843920.1|  hypothetical protein BA1465 [Bac...  53.1    1e-05  
gi|49477237|ref|YP_035663.1|  membrane metalloprotease [Bacill...  53.1    1e-05  
gi|68055730|ref|ZP_00539872.1|  Peptidase M50 [Exiguobacterium...  52.4    2e-05
gi|89208787|ref|ZP_01187274.1|  Peptidase M50 [Bacillus weihen...  52.0    2e-05
gi|52143901|ref|YP_082927.1|  membrane metalloprotease [Bacill...  52.0    3e-05  
gi|75762467|ref|ZP_00742331.1|  Membrane endopeptidase, M50 fa...  51.6    3e-05
gi|30019595|ref|NP_831226.1|  Membrane metalloprotease [Bacill...  51.6    3e-05  
gi|89202924|ref|ZP_01181628.1|  Peptidase M50 [Bacillus cereus...  51.6    4e-05
gi|65318810|ref|ZP_00391769.1|  COG1994: Zn-dependent proteases [  51.2    4e-05
gi|47569114|ref|ZP_00239802.1|  membrane metalloprotease [Baci...  50.8    6e-05
gi|48477496|ref|YP_023202.1|  hypothetical zinc metalloproteas...  49.7    1e-04  
gi|107025401|ref|YP_622912.1|  peptidase M50 [Burkholderia cen...  49.7    1e-04  
gi|84353019|ref|ZP_00977961.1|  COG1994: Zn-dependent protease...  49.3    1e-04
gi|20094249|ref|NP_614096.1|  Predicted membrane-associated Zn...  48.5    3e-04  
gi|78061178|ref|YP_371086.1|  Peptidase M50 [Burkholderia sp. ...  48.5    3e-04  
gi|115359427|ref|YP_776565.1|  peptidase M50 [Burkholderia cep...  48.1    4e-04  
gi|89894538|ref|YP_518025.1|  hypothetical protein DSY1792 [De...  45.4    0.002  
gi|76880925|gb|ABA56095.1|  conserved hypothetical protein [Sinor  44.3    0.005
gi|110634550|ref|YP_674758.1|  peptidase M50 [Mesorhizobium sp...  42.4    0.020  
gi|82747519|ref|ZP_00910015.1|  hypothetical protein CbeiDRAFT...  42.0    0.025
gi|16263062|ref|NP_435855.1|  hypothetical protein SMa1126 [Si...  42.0    0.029  
gi|23123766|ref|ZP_00105812.1|  COG0457: FOG: TPR repeat [Nostoc   40.4    0.072
gi|113874864|ref|ZP_01414991.1|  conserved hypothetical protei...  40.4    0.083
gi|87308520|ref|ZP_01090660.1|  hypothetical protein DSM3645_1...  40.0    0.11 
gi|87162734|gb|ABD28529.1|  Peptidase M, neutral zinc metallop...  39.7    0.12 
gi|94969622|ref|YP_591670.1|  peptidase M50 [Acidobacteria bac...  38.9    0.20   
gi|16264796|ref|NP_437588.1|  hypothetical protein SMb20925 [S...  38.5    0.31   
gi|91773681|ref|YP_566373.1|  peptidase M50 [Methanococcoides ...  38.1    0.43   
gi|87308431|ref|ZP_01090572.1|  hypothetical protein DSM3645_1...  37.7    0.45 
gi|88944714|ref|ZP_01147938.1|  conserved hypothetical transme...  37.7    0.56 
gi|11497944|ref|NP_069168.1|  hypothetical protein AF0332 [Arc...  37.4    0.63   
gi|55379374|ref|YP_137223.1|  hypothetical protein rrnAC2755 [...  37.4    0.67   
gi|17547243|ref|NP_520645.1|  hypothetical protein RSc2524 [Ra...  37.0    0.90   
gi|32474065|ref|NP_867059.1|  conserved hypothetical protein-p...  36.6    1.2    
gi|52549240|gb|AAU83089.1|  Zn-dependent proteases [uncultured ar  35.4    2.4  
gi|57234442|ref|YP_181501.1|  protease family protein [Dehaloc...  35.4    2.8    
gi|83649451|ref|YP_437886.1|  Zn-dependent protease [Hahella c...  35.0    2.9    
gi|89362770|ref|ZP_01200573.1|  conserved hypothetical membran...  35.0    3.0  
gi|20094489|ref|NP_614336.1|  Zn-dependent protease [Methanopy...  35.0    3.2    
gi|77359107|ref|YP_338682.1|  metalloprotease [Pseudoalteromon...  34.7    4.3    
gi|73670566|ref|YP_306581.1|  sterol-regulatory element-bindin...  34.3    5.0    
gi|20091280|ref|NP_617355.1|  sterol-regulatory element-bindin...  34.3    5.4    
gi|21229111|ref|NP_635033.1|  Membrane metalloprotease [Methan...  34.3    5.5    
gi|20088906|ref|NP_614981.1|  hypothetical protein MA0007 [Met...  34.3    5.9    
gi|89341924|ref|ZP_01194165.1|  PDZ/DHR/GLGF:Peptidase M50 [My...  34.3    6.1  
gi|82617280|emb|CAI64185.1|  conserved hypothetical membrane prot  33.9    6.7  
gi|88858599|ref|ZP_01133240.1|  putative metalloprotease; prob...  33.9    6.7  
gi|91772313|ref|YP_565005.1|  peptidase M50 [Methanococcoides ...  33.9    7.6    
gi|55379732|ref|YP_137582.1|  M50 metallopeptidase [Haloarcula...  33.9    7.9    

BlastP contre Swissprot:(très peu de résultats)
Sequences producing significant alignments:                        (Bits)  Value

gi|2499925|sp|Q55518|Y528_SYNY3  Putative zinc metalloprotease sl  33.1    0.84   
gi|81651261|sp|Q6GHH3|Y1238_STAAR  Putative zinc metalloprotease   32.0    2.0    
gi|38605593|sp|Q8NWZ4|Y1145_STAAW  Putative zinc metalloprotea...  32.0    2.0    
gi|54040032|sp|P63333|Y1105_STAAN  Putative zinc metalloprotea...  32.0    2.0    
gi|81694637|sp|Q5HGG9|Y1281_STAAC  Putative zinc metalloprotease   32.0    2.1    
gi|74626334|sp|Q9Y7U4|NSE3_SCHPO  Non-structural maintenance o...  32.0    2.1  
gi|48475024|sp|Q9USW4|YHZ9_SCHPO  Protein C21B10.09 in chromosome  30.0    7.6  
gi|51315812|sp|O75460|ERN1_HUMAN  Serine/threonine-protein kin...  30.0    8.1    

ORF finding

SMS->any codon->sens->codon universel
>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 768.
GGTCTTTATGGTGGCTTTACGAATGATTTTACAGAGCACTGGATCCGAGGCCTGATCTAC
ATGGTCTCGGTAATGGCAATTTTGTCGGCGCATGAAGCAGGGCACTTTGTTGCAGCATGG
CGTCATCGAATTCCTGCAACGCTTCCATTTTTCTTACCGCTTCCAGTGATGCTAACTGGG
ACACTTGGCGCCGTAATTGGCATGGAAGGATCTCGGGCAGACAGAAAACAGTTATTTGAT
ATCGCCTTAGCTGGACCTCTCGCTGGTCTTCTTGTTGCGATTCCTGTTTTTGTAGCGGGG
CTGGTGCTTGCTCAACCGGCAGATAGCAGCCTGTTTTCAATGCCTTTACTTGCAACATGG
CTTTTGAGACTTGTTCGGCCAGATTTACCAGTAGGCCAGGTGCTTATCCCAAATGCGTTC
TTGCTGGCTGGCTGGGTAGGTTTTCTTGTAACTGGACTGAATATGATTCCCCTCAGCCAA
CTCGATGGTGGGCATATTAGCCATGCTGTTTTTGGTCGGCGTTCGTGCTGGGTGGCCAGA
AGTGTCCTCCTCGGAGCAATAACCGCTATTATTCTTGTAGGAGCTGATCATTGGGTTTTA
ATGGTTGTTTTAGTCACGTTTATGGGTGTCGATCACCCGCCCATTCGAAATGAATCGCAG
CCGTTGGGCACCGCGAGAACAATTCTGGGCATTGCTTCATTTGTCATTCCGGTGATTACA
TTCATGCCGGAGCCGCTGCTGCTGCCCGGATTCATTTTCATTCGTTGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
GLYGGFTNDFTEHWIRGLIYMVSVMAILSAHEAGHFVAAWRHRIPATLPFFLPLPVMLTG
TLGAVIGMEGSRADRKQLFDIALAGPLAGLLVAIPVFVAGLVLAQPADSSLFSMPLLATW
LLRLVRPDLPVGQVLIPNAFLLAGWVGFLVTGLNMIPLSQLDGGHISHAVFGRRSCWVAR
SVLLGAITAIILVGADHWVLMVVLVTFMGVDHPPIRNESQPLGTARTILGIASFVIPVIT
FMPEPLLLPGFIFIR*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


SMS->any codon->reverse->codon universel
>ORF number 1 in reading frame 1 on the reverse strand extends from base 310 to base 522.
AACCCAATGATCAGCTCCTACAAGAATAATAGCGGTTATTGCTCCGAGGAGGACACTTCT
GGCCACCCAGCACGAACGCCGACCAAAAACAGCATGGCTAATATGCCCACCATCGAGTTG
GCTGAGGGGAATCATATTCAGTCCAGTTACAAGAAAACCTACCCAGCCAGCCAGCAAGAA
CGCATTTGGGATAAGCACCTGGCCTACTGGTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
NPMISSYKNNSGYCSEEDTSGHPARTPTKNSMANMPTIELAEGNHIQSSYKKTYPASQQE
RIWDKHLAYW*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 29 to base 274.
TTCAACAAAGTTCACGGATCACCTCTCGGTTATGTAGCAGCCTTGGAACCAGTGCGTCTG
ACTCCATCTAAAACAATCTTAATCTATTGTGTGAGCGGAATGGCAGGGCGTCAACGAATG
AAAATGAATCCGGGCAGCAGCAGCGGCTCCGGCATGAATGTAATCACCGGAATGACAAAT
GAAGCAATGCCCAGAATTGTTCTCGCGGTGCCCAACGGCTGCGATTCATTTCGAATGGGC
GGGTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
FNKVHGSPLGYVAALEPVRLTPSKTILIYCVSGMAGRQRMKMNPGSSSGSGMNVITGMTN
EAMPRIVLAVPNGCDSFRMGG*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 320 to base 595.
TCAGCTCCTACAAGAATAATAGCGGTTATTGCTCCGAGGAGGACACTTCTGGCCACCCAG
CACGAACGCCGACCAAAAACAGCATGGCTAATATGCCCACCATCGAGTTGGCTGAGGGGA
ATCATATTCAGTCCAGTTACAAGAAAACCTACCCAGCCAGCCAGCAAGAACGCATTTGGG
ATAAGCACCTGGCCTACTGGTAAATCTGGCCGAACAAGTCTCAAAAGCCATGTTGCAAGT
AAAGGCATTGAAAACAGGCTGCTATCTGCCGGTTGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
SAPTRIIAVIAPRRTLLATQHERRPKTAWLICPPSSWLRGIIFSPVTRKPTQPASKNAFG
ISTWPTGKSGRTSLKSHVASKGIENRLLSAG*

>ORF number 3 in reading frame 2 on the reverse strand extends from base 596 to base 784.
GCAAGCACCAGCCCCGCTACAAAAACAGGAATCGCAACAAGAAGACCAGCGAGAGGTCCA
GCTAAGGCGATATCAAATAACTGTTTTCTGTCTGCCCGAGATCCTTCCATGCCAATTACG
GCGCCAAGTGTCCCAGTTAGCATCACTGGAAGCGGTAAGAAAAATGGAAGCGTTGCAGGA
ATTCGATGA

>Translation of ORF number 3 in reading frame 2 on the reverse strand.
ASTSPATKTGIATRRPARGPAKAISNNCFLSARDPSMPITAPSVPVSITGSGKKNGSVAG
IR*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 504 to base 878.
GCACCTGGCCTACTGGTAAATCTGGCCGAACAAGTCTCAAAAGCCATGTTGCAAGTAAAG
GCATTGAAAACAGGCTGCTATCTGCCGGTTGAGCAAGCACCAGCCCCGCTACAAAAACAG
GAATCGCAACAAGAAGACCAGCGAGAGGTCCAGCTAAGGCGATATCAAATAACTGTTTTC
TGTCTGCCCGAGATCCTTCCATGCCAATTACGGCGCCAAGTGTCCCAGTTAGCATCACTG
GAAGCGGTAAGAAAAATGGAAGCGTTGCAGGAATTCGATGACGCCATGCTGCAACAAAGT
GCCCTGCTTCATGCGCCGACAAAATTGCCATTACCGAGACCATGTAGATCAGGCCTCGGA
TCCAGTGCTCTGTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
APGLLVNLAEQVSKAMLQVKALKTGCYLPVEQAPAPLQKQESQQEDQREVQLRRYQITVF
CLPEILPCQLRRQVSQLASLEAVRKMEALQEFDDAMLQQSALLHAPTKLPLPRPCRSGLG
SSAL*