ORF EK17600

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160096.1
Annotathon code: ORF_EK17600
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : PARCOU
Annotated on : 2008-03-19 18:52:37
  • COUPAYE Léo
  • PARDOUX romain

Synopsis

Genomic Sequence

>AACY01160096.1 ORF_EK17600 genomic DNA
ATCTGCGCCAAACTGGACGTTCCTAGGACAAATAGCATAATCATCACCCAGATCCGGAACAAATGATTAATCAATTGAGTCAAATTCATCCACTGATTGT
CGCACTCTTTTTGAGTGTGTCGGTAGTGAATCTTACATTTGCCGCGCCAGAAGAAGATCGCTGGATTCGTGTGGACAACGGAGATGTCGCCTTTTCTACC
AACCTAGGTGAATCTGAAGCACTAGAGCTAGAACGCTCAATTCGCCTATTCTCCGCGTTTAGCAAAACTTTTTTGCCAGTTAGGGAAAATTATTCGATAC
CACTAGAGTTAATTGTTTTCGCGAAGAAAGCTGATTTTGAGGACACGGTAAAACCTAGAAAATTTGCTTCCTACACCAATTCTGAACTGGATGGTGTTCT
CATCGTCGCTGCTCCCTCTACCAGCAAAGATGTCGATCTTCTAGAAAATCTGAAGCACGAGCTCGCGCACTATCACATGCGTCATACTTCGATTAATTAT
CCACTTTGGTACGAAGAGGGAATGGCAACCCTGTTATCCGAGGCAACACTTACATTTGTAGACGACGCCATCAAAGCCGAATTCAAAACTCCCAAGCCCA
CGGCAGGTTTTCCATTAAAACGATCTACAAAAATGGTAAGAAAAGCCTGGTTGGTTGAACATCTTAAACGAAGAAGTCTGCGTAATCTGAACTTAAGGAT
CATTCACAACTTCTATAATGATAGTCATCGACTGGCCAACTTCTTCCATTTTAACGAAAGTGATGATTCCAGATTCTCGATGAAAGCACTGAATCAATAT
CTATTAAACCAATCAAGTACTCTTTTCTCCTCTCTTAATGTGACGCCAGACGAATTGAT

Translation

[63 - 854/859]   direct strand


Phylogeny


Annotator commentaries

Pour détecter l’éventuel existence d’ORF au sein de notre séquence nous avons utilisé le logiciel SMS. Celui-ci scanne la séquence à la recherche d’un codon atg qui initie la transcription. Dans la recherche d’une ORF nous avons pris en compte à la fois le brin direct et indirect puisque la transcription peut se faire aussi bien sur l’un comme sur l’autre. D’autre part un aa étant codé par un codon, autrement dit 3 nucléotides, il y a pour chaque brin 3 cadres de lecture différent. Ainsi, il y a 6 possibilités différentes de lire une séquence d’ADN et celles-ci ont donc été prise en compte dans notre recherche.

A l’issue de notre recherche le logiciel a détecté 2 ORF de plus de 60 codons,l'une sur le brin direct et l'autre sur le brin indirect.

Pour déterminer si les ORF sont codantes ou non codantes nous avons comparé notre séquence à plusieurs autres rassemblés dans une banque appelé BLAST. Les résultats par BLASTp mais aussi par BLASTx ont montrés que trés peu de séquences étaient homologue à la notre et que leurs degrés de similarité étaient trés faible (déterminé par l'E-value) suggérant que les deux ORF sont vraissemblablement des faux positifs ou du moins qu'aucunes séquences homologues à la notre n'est actuellement connue.


Multiple Alignement


BLAST

_____________________________________________________________________________________________________
BLASTp NR                          
_____________________________________________________________________________________________________

                                        Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 ...  41.2    0.047  Gene info
gi|116253222|ref|YP_769060.1|  putative transmembrane protein ...  38.1    0.40   Gene info
gi|86160014|ref|YP_466799.1|  hypothetical protein Adeh_3596 [...  35.8    2.3    Gene info
gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein...  35.0    3.3  
gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 ...  35.0    3.6    Gene info
gi|86160013|ref|YP_466798.1|  hypothetical protein Adeh_3595 [...  35.0    3.7    Gene info
gi|108756961|ref|YP_630691.1|  hypothetical protein MXAN_2471 ...  34.3    5.9    Gene info

-------------------------------------------------------------------------------------------------------------
>gi|108763613|ref|YP_630548.1| Gene info hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
 gi|108467493|gb|ABF92678.1| Gene info hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
Length=524

 Score = 41.2 bits (95),  Expect = 0.047, Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 13/158 (8%)

Query  34   WIRVDNGDVAFSTNLGESEALE-LERSIRLFSAFSKTFLP--VRENYSIPLELIVFAKKA  90
            W+R+D+      T+L   EA E ++R  R  +A   +  P  +R+  +  L++ V     
Sbjct  38   WLRLDSDHYTLHTDLLAEEAREAMQRLERTRAAILTSMWPQSLRQQMT-KLDVYVIQSPR  96

Query  91   DFEDTVKPRKFASYTNSELDGVLIVAA-----PSTSKDVDLLEN--LKHELAHYHMRHTS  143
            +FE     R  A +  S+ + +++++        T   + L  +  L HELAHY   +  
Sbjct  97   EFEGLYPRRVRAFFFRSDSEALIVLSGRPGTWEQTFSGLSLASSSPLNHELAHYLSAYPL  156

Query  144  INYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTA  181
               P W  EGMA  L   TL    D   A    P  TA
Sbjct  157  SRQPRWLSEGMAEYLE--TLRISKDGRTAVVGAPHWTA  192


>gi|116253222|ref|YP_769060.1| Gene info putative transmembrane protein [Rhizobium leguminosarum bv. viciae 
3841]
 gi|115257870|emb|CAK08968.1| Gene info putative transmembrane protein [Rhizobium leguminosarum bv. viciae 
3841]
Length=370

 Score = 38.1 bits (87),  Expect = 0.40, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query  9    HPLIVALFLSVSVVNLTFAA---PEEDRWIRVDNGDVAFSTNLGESEALELERSIRLFSA  65
            HPL++A+   V  + L   A      DR  R    D+AF  +LG + AL    S+RL  +
Sbjct  202  HPLLLAVAFLVCALGLFATALYFDLGDRLRRTTRSDIAFWLHLGAAPALLF--SVRLLMS  259

Query  66   FSKTFLPVRENYSIPLELIVFA  87
            F   FL V +  SI   +IV +
Sbjct  260  FDGNFLDVAQAVSIKTPVIVIS  281


>gi|86160014|ref|YP_466799.1| Gene info hypothetical protein Adeh_3596 [Anaeromyxobacter dehalogenans 
2CP-C]
 gi|85776525|gb|ABC83362.1| Gene info hypothetical protein Adeh_3596 [Anaeromyxobacter dehalogenans 
2CP-C]
Length=498

 Score = 35.8 bits (81),  Expect = 2.3, Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 53/136 (38%), Gaps = 3/136 (2%)

Query  34   WIRVDNGDVAFSTNLGESEALELERSI-RLFSAFSKTFLPVRENYSIPLELIVFAKKADF  92
            W  +   ++   T+L   +A +L R + R++                P+ ++ F  + +F
Sbjct  36   WRELRTANILLQTDLSSGKAQDLARELDRIYDVVRIALFRRPPPTVAPMRVVAFQSEEEF  95

Query  93   EDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEE  152
                 P+   +Y  S      ++  P    D   +  + HE+ H+         P W+ E
Sbjct  96   H-LFAPKDATAYHMSGTRLGAVMLTPGLLADSQRIVAV-HEITHHVTTPLFARQPRWFAE  153

Query  153  GMATLLSEATLTFVDD  168
            G+A  +    +T VD+
Sbjct  154  GLACYMESMAMTGVDN  169

>gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108800252|ref|YP_640449.1| Gene info hypothetical protein Mmcs_3286 [Mycobacterium sp. MCS]
 gi|92440295|gb|EAS98139.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108770671|gb|ABG09393.1| Gene info conserved hypothetical protein [Mycobacterium sp. MCS]
Length=275

 Score = 35.0 bits (79),  Expect = 3.3, Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query  114  IVAAPSTS--KDVDLLENLKHELAHYHMR-HTSINYPLWYEEGMATLLSEATLTFVDDAI  170
            IV AP  +   D DL   L+HEL H+ +R  T+ + P W  EG+A  L+    T   DA 
Sbjct  137  IVFAPGAAAMTDEDLRIVLRHELFHHAVREQTAADAPRWLTEGVADHLARPRTTPAPDAE  196

Query  171  KA-----EFKTPKPTAGFPLKRSTKMVRKAWLVEHLKRRSLRNLNLR  212
             A     +  TP         R+ +     ++ +      LR L LR
Sbjct  197  TALPTDSDLDTPGAVRSQAYDRAWRFA--TYVADRYGPERLRALYLR  241


>gi|116624734|ref|YP_826890.1| Gene info hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
 gi|116227896|gb|ABJ86605.1| Gene info hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
Length=597

 Score = 35.0 bits (79),  Expect = 3.6, Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 60/137 (43%), Gaps = 10/137 (7%)

Query  26   FAAPEEDRWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVRENYSIPLELIV  85
            F+AP+ D W+++ + +    T  GE    +L +      +F           + P  +I 
Sbjct  25   FSAPQ-DSWLKITSANFELYTTAGERSGRDLIKHFEQVRSFFTQAFGAHLAAARPARIIA  83

Query  86   FAKKADFEDTVKPRKFAS--YTNSEL-DGVLIVAAPSTSKDVDLLENLKHELAHYHMRHT  142
            F  + +++   +P +FAS  Y    + D +++  A S    V +     HE  H  +  +
Sbjct  84   FRNEKEYQ-PYRPGEFASAFYQPGAVHDFIVMSGASSEHYPVAI-----HEYTHLMIHQS  137

Query  143  SINYPLWYEEGMATLLS  159
             ++ P W  EG+A L S
Sbjct  138  GMDLPPWLNEGLAELYS  154


>gi|86160013|ref|YP_466798.1| Gene info hypothetical protein Adeh_3595 [Anaeromyxobacter dehalogenans 
2CP-C]
 gi|85776524|gb|ABC83361.1| Gene info hypothetical protein Adeh_3595 [Anaeromyxobacter dehalogenans 
2CP-C]
Length=529

 Score = 35.0 bits (79),  Expect = 3.7, Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 56/142 (39%), Gaps = 17/142 (11%)

Query  26   FAAPEED--RWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVREN-YSIP--  80
            F  PE+    W  +    V   T+L   +A EL           +TF+ VR   +  P  
Sbjct  52   FRCPEQGGPDWHELRTEHVVLQTDLPSWKAKELA------GELERTFVVVRTGLFRNPPP  105

Query  81   ----LELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAH  136
                L ++ FA +++FE    P    +Y +       +V  P T  D      + HEL H
Sbjct  106  APGLLRVVAFASESEFE-RFAPMGAGAYYHRPPFFAPVVVMPGTLGDAQRTV-IAHELTH  163

Query  137  YHMRHTSINYPLWYEEGMATLL  158
            +         P W+ EG+A+ +
Sbjct  164  HLTAQLFARQPPWFREGLASFM  185


>gi|108756961|ref|YP_630691.1| Gene info hypothetical protein MXAN_2471 [Myxococcus xanthus DK 1622]
 gi|108460841|gb|ABF86026.1| Gene info hypothetical protein MXAN_2471 [Myxococcus xanthus DK 1622]
Length=507

 Score = 34.3 bits (77),  Expect = 5.9, Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query  81   LELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAP---STSKDVDLLENLKHELAHY  137
            +++IV   ++  E+    R     TN+E DG L+V A    + S+    +    HEL HY
Sbjct  76   VDIIVLHNRSALEEFTNIRIEGFSTNTE-DGPLLVLAGHAYALSEATADITTQAHELTHY  134

Query  138  HMRHTSINYPLWYEEGMATLLSEATL  163
                  +  P W  EG+A+ L    L
Sbjct  135  LSELALVRQPRWLSEGLASYLETIAL  160



____________________________________________________________________________________
BLASTp SWISSPROT
_________________________________________________________________________________________________

                                                                  Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|126404|sp|P09439|LOX2_SOYBN  Seed lipoxygenase-2 (L-2)          32.3    1.7  
gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisom  31.6    3.2  
gi|6685546|sp|O88986|KBL_MOUSE  2-amino-3-ketobutyrate coenzym...  30.4    6.9 

-------------------------------------------------------------------------------------------------

>gi|126404|sp|P09439|LOX2_SOYBN  Seed lipoxygenase-2 (L-2)
Length=865

 Score = 32.3 bits (72),  Expect = 1.7, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query  223  RLANFFHFNESDDSRFSMKALNQYLLNQSSTLFSSLNVTPDE  264
            R  NF H   SD   + +K+L+QY+L    ++F  LN TP+E
Sbjct  271  RDENFGHLKSSDFLAYGIKSLSQYVLPAFESVF-DLNFTPNE  311


>gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisomerase II)
Length=1192

 Score = 31.6 bits (70),  Expect = 3.2, Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 18/103 (17%)

Query  59   SIRLFSAFSKTFLPVRENYSIPLEL-----------IVFAKKADFEDTVKPRKFASYTN-  106
            S++L S F KT  P  +++ +P              +     A  E    P +   YT  
Sbjct  802  SVQLASEFIKTMFPAEDSWLLPYVFEDGQRAEPEYYVPVLPLAIMEYGANPSEGWKYTTW  861

Query  107  -SELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPL  148
              +L+ +L +      KD     N KHEL HY ++H     PL
Sbjct  862  ARQLEDILALVRAYVDKD-----NPKHELLHYAIKHKITILPL  899


>gi|6685546|sp|O88986|KBL_MOUSE Gene info 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursor 
(AKB ligase) (Glycine acetyltransferase)
Length=416

 Score = 30.4 bits (67),  Expect = 6.9, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query  128  ENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTAGFPLKR  187
            +NL+ ++AH+H R  +I YP  ++      L EA LT  D  +  E        G  L +
Sbjct  110  KNLEAKIAHFHQREDAILYPSCFDANAG--LFEALLTPEDAVLSDELNHASIIDGIRLCK  167

Query  188  STK  190
            + K
Sbjct  168  AHK  170




________________________________________________________________________________________


Modif du :1/12/06
____________________________________________________________________________________
Blastx NR
____________________________________________________________________________________

gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 ...  43.9    0.010 
gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 ...  41.2    0.062 
gi|108756961|ref|YP_630691.1|  hypothetical protein MXAN_2471 ...  38.9    0.31  
gi|114769594|ref|ZP_01447204.1|  cobaltochelatase [alpha prote...  36.2    2.0  
gi|86160014|ref|YP_466799.1|  hypothetical protein Adeh_3596 [...  36.2    2.0   
gi|86160013|ref|YP_466798.1|  hypothetical protein Adeh_3595 [...  35.0    4.5   
gi|18033721|gb|AAL57224.1|  gamma-glutamylcysteine synthetase ...  35.0    4.5  
gi|4713921|gb|AAD28293.1|  gamma-glutamylcysteine synthetase [Pla  35.0    4.5  
gi|68070807|ref|XP_677317.1|  gamma-glutamylcysteine synthetas...  35.0    4.5   
gi|68059036|ref|XP_671496.1|  hypothetical protein PB301533.00...  35.0    4.5   
gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein...  33.9    9.9  
gi|37665590|dbj|BAC99041.1|  replication protein [Lactobacillus s  33.9    9.9  

-------------------------------------------------------------------------------------------

>gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
 gi|108467493|gb|ABF92678.1|  hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
Length=524

 Score = 43.9 bits (102),  Expect = 0.010
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 13/158 (8%)
 Frame = +3

Query  162  WIRVDNGDVAFSTNLGESEALE-LERSIRLFSAFSKTFLP--VRENYSIPLELIVFAKKA  332
            W+R+D+      T+L   EA E ++R  R  +A   +  P  +R+  +  L++ V     
Sbjct  38   WLRLDSDHYTLHTDLLAEEAREAMQRLERTRAAILTSMWPQSLRQQMT-KLDVYVIQSPR  96

Query  333  DFEDTVKPRKFASYTNSELDGVLIVAA-----PSTSKDVDLLEN--LKHELAHYHMRHTS  491
            +FE     R  A +  S+ + +++++        T   + L  +  L HELAHY   +  
Sbjct  97   EFEGLYPRRVRAFFFRSDSEALIVLSGRPGTWEQTFSGLSLASSSPLNHELAHYLSAYPL  156

Query  492  INYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTA  605
               P W  EGMA  L   TL    D   A    P  TA
Sbjct  157  SRQPRWLSEGMAEYLE--TLRISKDGRTAVVGAPHWTA  192


>gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
 gi|116227896|gb|ABJ86605.1|  hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
Length=597

 Score = 41.2 bits (95),  Expect = 0.062
 Identities = 31/137 (22%), Positives = 59/137 (43%), Gaps = 10/137 (7%)
 Frame = +3

Query  138  FAAPEEDRWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVRENYSIPLELIV  317
            F+AP+ D W+++ + +    T  GE    +L +      +F           + P  +I 
Sbjct  25   FSAPQ-DSWLKITSANFELYTTAGERSGRDLIKHFEQVRSFFTQAFGAHLAAARPARIIA  83

Query  318  FAKKADFEDTVKPRKFAS---YTNSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHT  488
            F  + +++   +P +FAS      +  D +++  A S    V +     HE  H  +  +
Sbjct  84   FRNEKEYQP-YRPGEFASAFYQPGAVHDFIVMSGASSEHYPVAI-----HEYTHLMIHQS  137

Query  489  SINYPLWYEEGMATLLS  539
             ++ P W  EG+A L S
Sbjct  138  GMDLPPWLNEGLAELYS  154





___________________________________________________________________________________
Blastx swissprot
___________________________________________________________________________________

gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisom  32.7    1.6  
gi|113058|sp|P18845|ACHA3_CARAU  Neuronal acetylcholine recept...  31.2    4.6  
gi|62287630|sp|Q67QF3|SYFA_SYMTH  Phenylalanyl-tRNA synthetase...  30.4    7.8  
gi|2498959|sp|Q63769|SRPX_RAT  Sushi repeat-containing protein...  30.4    7.8   
gi|113061|sp|P04757|ACHA3_RAT  Neuronal acetylcholine receptor...  30.4    7.8   
gi|62901487|sp|Q8R4G9|ACHA3_MOUSE  Neuronal acetylcholine rece...  30.4    7.8   


---------------------------------------------------------------------------------------

>gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisomerase II)
Length=1192

 Score = 32.7 bits (73),  Expect = 1.6
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 18/103 (17%)
 Frame = +3

Query  237  SIRLFSAFSKTFLPVRENYSIPLEL-----------IVFAKKADFEDTVKPRKFASYTN-  380
            S++L S F KT  P  +++ +P              +     A  E    P +   YT  
Sbjct  802  SVQLASEFIKTMFPAEDSWLLPYVFEDGQRAEPEYYVPVLPLAIMEYGANPSEGWKYTTW  861

Query  381  -SELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPL  506
              +L+ +L +      KD     N KHEL HY ++H     PL
Sbjct  862  ARQLEDILALVRAYVDKD-----NPKHELLHYAIKHKITILPL  899


>gi|113058|sp|P18845|ACHA3_CARAU  Neuronal acetylcholine receptor protein subunit alpha-3 precursor 
(GF-alpha-3)
Length=512

 Score = 31.2 bits (69),  Expect = 4.6
 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = -3

Query  122  RHTQKECDNQWMNLTQLINHLFRIWVMIMLFVLGTSSL  9
            R+  KE ++ W  +  +I+ +F +WV +++ VLGT  L
Sbjct  466  RNKAKEVEDDWKYVAMVIDRIF-LWVFVLVCVLGTLGL  502


>gi|62287630|sp|Q67QF3|SYFA_SYMTH  Phenylalanyl-tRNA synthetase alpha chain (Phenylalanine--tRNA 
ligase alpha chain) (PheRS)
Length=343

 Score = 30.4 bits (67),  Expect = 7.8
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 6/82 (7%)
 Frame = -3

Query  785  FHRESGIITF--VKMEEVGQSMTIIIEVVNDP*VQITQTSSFKMFNQPG----FSYHFCR  624
            FH+  G++    + M  +  ++T +   +  P V I    S+  F +P      S  FC 
Sbjct  212  FHQVEGLVIDKGITMASLKGALTEMARALFGPDVGIRLRPSYFPFTEPSAEMDISCIFCG  271

Query  623  SF*WKTCRGLGSFEFGFDGVVY  558
                +TC+G G  E G  G+V+
Sbjct  272  GKGCRTCKGSGWIEIGGSGMVH  293

ORF finding

_____________________________________________________________________________
sms>any codon>60 codons>code universel>3 orf>direct
_____________________________________________________________________________


No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 63 to base 857.
ATGATTAATCAATTGAGTCAAATTCATCCACTGATTGTCGCACTCTTTTTGAGTGTGTCG
GTAGTGAATCTTACATTTGCCGCGCCAGAAGAAGATCGCTGGATTCGTGTGGACAACGGA
GATGTCGCCTTTTCTACCAACCTAGGTGAATCTGAAGCACTAGAGCTAGAACGCTCAATT
CGCCTATTCTCCGCGTTTAGCAAAACTTTTTTGCCAGTTAGGGAAAATTATTCGATACCA
CTAGAGTTAATTGTTTTCGCGAAGAAAGCTGATTTTGAGGACACGGTAAAACCTAGAAAA
TTTGCTTCCTACACCAATTCTGAACTGGATGGTGTTCTCATCGTCGCTGCTCCCTCTACC
AGCAAAGATGTCGATCTTCTAGAAAATCTGAAGCACGAGCTCGCGCACTATCACATGCGT
CATACTTCGATTAATTATCCACTTTGGTACGAAGAGGGAATGGCAACCCTGTTATCCGAG
GCAACACTTACATTTGTAGACGACGCCATCAAAGCCGAATTCAAAACTCCCAAGCCCACG
GCAGGTTTTCCATTAAAACGATCTACAAAAATGGTAAGAAAAGCCTGGTTGGTTGAACAT
CTTAAACGAAGAAGTCTGCGTAATCTGAACTTAAGGATCATTCACAACTTCTATAATGAT
AGTCATCGACTGGCCAACTTCTTCCATTTTAACGAAAGTGATGATTCCAGATTCTCGATG
AAAGCACTGAATCAATATCTATTAAACCAATCAAGTACTCTTTTCTCCTCTCTTAATGTG
ACGCCAGACGAATTG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALELERSI
RLFSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAPST
SKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPT
AGFPLKRSTKMVRKAWLVEHLKRRSLRNLNLRIIHNFYNDSHRLANFFHFNESDDSRFSM
KALNQYLLNQSSTLFSSLNVTPDEL

_____________________________________________________________________________
sms>any codon>60 codons>code universel>3 orf>indirect
_____________________________________________________________________________

>ORF number 1 in reading frame 1 on the reverse strand extends from base 157 to base 363.
ATGATCCTTAAGTTCAGATTACGCAGACTTCTTCGTTTAAGATGTTCAACCAACCAGGCT
TTTCTTACCATTTTTGTAGATCGTTTTAATGGAAAACCTGCCGTGGGCTTGGGAGTTTTG
AATTCGGCTTTGATGGCGTCGTCTACAAATGTAAGTGTTGCCTCGGATAACAGGGTTGCC
ATTCCCTCTTCGTACCAAAGTGGATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MILKFRLRRLLRLRCSTNQAFLTIFVDRFNGKPAVGLGVLNSALMASSTNVSVASDNRVA
IPSSYQSG*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.