ORF CZ17580

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160096.1
Annotathon code: ORF_CZ17580
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : claidith
Annotated on : 2008-03-19 18:52:37
  • CATTENOZ judith
  • LAFON claire

Synopsis

Genomic Sequence

>AACY01160096.1 ORF_CZ17580 genomic DNA
TCTGCGCCAAACTGGACGTTCCTAGGACAAATAGCATAATCATCACCCAGATCCGGAACAAATGATTAATCAATTGAGTCAAATTCATCCACTGATTGTC
GCACTCTTTTTGAGTGTGTCGGTAGTGAATCTTACATTTGCCGCGCCAGAAGAAGATCGCTGGATTCGTGTGGACAACGGAGATGTCGCCTTTTCTACCA
ACCTAGGTGAATCTGAAGCACTAGAGCTAGAACGCTCAATTCGCCTATTCTCCGCGTTTAGCAAAACTTTTTTGCCAGTTAGGGAAAATTATTCGATACC
ACTAGAGTTAATTGTTTTCGCGAAGAAAGCTGATTTTGAGGACACGGTAAAACCTAGAAAATTTGCTTCCTACACCAATTCTGAACTGGATGGTGTTCTC
ATCGTCGCTGCTCCCTCTACCAGCAAAGATGTCGATCTTCTAGAAAATCTGAAGCACGAGCTCGCGCACTATCACATGCGTCATACTTCGATTAATTATC
CACTTTGGTACGAAGAGGGAATGGCAACCCTGTTATCCGAGGCAACACTTACATTTGTAGACGACGCCATCAAAGCCGAATTCAAAACTCCCAAGCCCAC
GGCAGGTTTTCCATTAAAACGATCTACAAAAATGGTAAGAAAAGCCTGGTTGGTTGAACATCTTAAACGAAGAAGTCTGCGTAATCTGAACTTAAGGATC
ATTCACAACTTCTATAATGATAGTCATCGACTGGCCAACTTCTTCCATTTTAACGAAAGTGATGATTCCAGATTCTCGATGAAAGCACTGAATCAATATC
TATTAAACCAATCAAGTACTCTTTTCTCCTCTCTTAATGTGACGCCAGACGAATT

Translation

[35 - 853/855]   direct strand
>ORF_CZ17580 Translation [35-853   direct strand]
HNHHPDPEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVRENYSIPLELIVFAKKAD
FEDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTAGFPLKRSTKM
VRKAWLVEHLKRRSLRNLNLRIIHNFYNDSHRLANFFHFNESDDSRFSMKALNQYLLNQSSTLFSSLNVTPDE

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny


Annotator commentaries

Recherche d'ORF: Nous avons fait une recherche d'ORF avec SMS. Avec any codon on trouve une ORF de 819 pb soit 273 acides aminés. Elle débute à la position 35 et se termine à la position 853 sur le brin direct sur le deuxième cadre de lecture. Notre ORF est incomplète en 5' et 3' puisqu'elle ne contient pas de codon d'initiation, ni de codon stop. Donc notre séquence semble codante.

Blast:

Nous avons fait un premier Blastp vs Swissprot qui ne nous a donné que 5 séquences homologues dont la plus petite e-value est de 0,68. Les résultats obtenus ne sont pas valables.

Nous avons donc fait un deuxième Blastp vs NR qui cette fois nous a donné 8 séquences homologues dont la plus petite e-value est de 0,062. Les résultats obtenus sont cette fois encore insatisfaisants.

En dernier recours nous avons soumis sur NCBI notre séquence génomique pour faire un Blastx vs nr. Les résultats obtenus donnent 12 séquences homologues dont la plus petite e-value est de 0,010. Les résultats sont également négatifs.

Les trois Blast n'ayant rien donnés on peut penser que la protéine est inconnue.


Nous avons recherché des domaines protéiques, avec Interpro, sur chacune des 9 ORF que nous a donné ORF finder SMS. Nous n'obtenons que des domaines protéiques structuraux en cours d'études, sur 7 séquences.Ces domaines structuraux sont des signaux peptides et des régions transmembranaires. Nous n'obtenons aucun domaine protéique pour les 2 autres séquences. Auncunes de nos ORF ne nous donnent de domaines protéiques fonctionnels.


Nous pouvons donc faire deux hypothèses: -Soit notre séquence est intergénique et donc non codante, -Soit il n'y a aucune homologie dans le monde des vivants séquencés aujourd'hui.

Etant donné que la plus grande ORF obtenue est de 819 pb, soit important, il y a de forte chance pour qu'il soit codant. Donc la deuxième hypothèse est la plus probable.

La protéine est inconnue pour l'instant, néanmoins pour la forme de la fiche nous avons décidé de garder la plus grande ORF et de la noter comme codante afin d'avoir quelques informations si dans le futur des homologies seraient séquencées.


Multiple Alignement


BLAST

Blastp vs Swissprot:

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1164883183-11075-62856359045.BLASTQ2


Database: Non-redundant SwissProt sequences
           217,875 sequences; 82,042,039 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  Translation of ORF number 1 in reading frame 2 on the direct strand.
Length=273

                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|22095932|sp|O94681|ODO2_SCHPO  Probable dihydrolipoyllysine...  33.9    0.68 
gi|126404|sp|P09439|LOX2_SOYBN  Seed lipoxygenase-2 (L-2)          32.3    1.9  
gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisom  31.2    3.5  
gi|6685546|sp|O88986|KBL_MOUSE  2-amino-3-ketobutyrate coenzym...  30.4    7.3    
gi|83308972|sp|Q49YH4|Y1020_STAS1  UPF0354 protein SSP1020         30.4    7.5    


Alignements deux à deux:


>gi|22095932|sp|O94681|ODO2_SCHPO  Probable dihydrolipoyllysine-residue succinyltransferase component 
of 2-oxoglutarate dehydrogenase complex, mitochondrial 
precursor (E2) (Probable dihydrolipoamide succinyltransferase 
component of 2-oxoglutarate dehydrogenase complex)
Length=452

 Score = 33.9 bits (76),  Expect = 0.68, Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query  177  DAIKAEFKTPKP--TAGFPLKRS----TKMVRKAWLVEHLKRRSLRNLNLRIIHNFYNDS  230
            DA + EF +PKP      P+K+S    T+  R +    +  R  +  + LRI        
Sbjct  181  DAKEPEFSSPKPKPAKSEPVKQSKPKATETARPSSFSRNEDRVKMNRMRLRIAERLKESQ  240

Query  231  HRLANFFHFNESDDS  245
            +R A+   FNE D S
Sbjct  241  NRAASLTTFNECDMS  255


>gi|126404|sp|P09439|LOX2_SOYBN  Seed lipoxygenase-2 (L-2)
Length=865

 Score = 32.3 bits (72),  Expect = 1.9, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query  232  RLANFFHFNESDDSRFSMKALNQYLLNQSSTLFSSLNVTPDE  273
            R  NF H   SD   + +K+L+QY+L    ++F  LN TP+E
Sbjct  271  RDENFGHLKSSDFLAYGIKSLSQYVLPAFESVF-DLNFTPNE  311


>gi|267149|sp|Q00942|TOP2_ASFB7  DNA topoisomerase 2 (DNA topoisomerase II)
Length=1192

 Score = 31.2 bits (69),  Expect = 3.5, Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 18/103 (17%)

Query  68   SIRLFSAFSKTFLPVRENYSIPLEL-----------IVFAKKADFEDTVKPRKFASYTN-  115
            S++L S F KT  P  +++ +P              +     A  E    P +   YT  
Sbjct  802  SVQLASEFIKTMFPAEDSWLLPYVFEDGQRAEPEYYVPVLPLAIMEYGANPSEGWKYTTW  861

Query  116  -SELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPL  157
              +L+ +L +      KD     N KHEL HY ++H     PL
Sbjct  862  ARQLEDILALVRAYVDKD-----NPKHELLHYAIKHKITILPL  899


>gi|6685546|sp|O88986|KBL_MOUSE  2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursor 
(AKB ligase) (Glycine acetyltransferase)
Length=416

 Score = 30.4 bits (67),  Expect = 7.3, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query  137  ENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTAGFPLKR  196
            +NL+ ++AH+H R  +I YP  ++      L EA LT  D  +  E        G  L +
Sbjct  110  KNLEAKIAHFHQREDAILYPSCFDANAG--LFEALLTPEDAVLSDELNHASIIDGIRLCK  167

Query  197  STK  199
            + K
Sbjct  168  AHK  170


>gi|83308972|sp|Q49YH4|Y1020_STAS1  UPF0354 protein SSP1020
Length=287

 Score = 30.4 bits (67),  Expect = 7.5, Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query  173  TFVDDAIKAEFKTPKPTAGFPLKRSTKMVRKAWLVE-HLKRRSLRNL---NLRIIHNFYN  228
            +FV DA  AE           L +S +++ +A L E  L ++ L+ +   N+R + N Y 
Sbjct  105  SFVIDAHTAETNI---YYAVDLGKSYRLIDEAMLEELKLTKQQLKEMALFNVRKLENKYT  161

Query  229  DSHRLANFFHFNESDDSRFSMKALNQYLLNQ  259
                  N F+F  S+D   + + LN   LN+
Sbjct  162  TDEVKGNIFYFVNSNDGYDASRILNTSFLNE  192







Blastp vs nr

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1164883508-24404-145674187830.BLASTQ2


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,196,452 sequences; 1,444,328,266 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  Translation of ORF number 1 in reading frame 2 on the direct strand.
Length=273


                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 ...  40.8    0.062  
gi|116253222|ref|YP_769060.1|  putative transmembrane protein ...  38.5    0.37   
gi|86160014|ref|YP_466799.1|  hypothetical protein Adeh_3596 [...  35.4    2.7    
gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein...  35.0    3.5  
gi|114769594|ref|ZP_01447204.1|  cobaltochelatase [alpha prote...  35.0    4.1  
gi|86160013|ref|YP_466798.1|  hypothetical protein Adeh_3595 [...  34.7    5.0    
gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 ...  34.7    5.1    
gi|108756961|ref|YP_630691.1|  hypothetical protein MXAN_2471 ...  33.9    8.0    


Alignements deux à deux:

>gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
 gi|108467493|gb|ABF92678.1|  hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
Length=524

 Score = 40.8 bits (94),  Expect = 0.062, Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 13/158 (8%)

Query  43   WIRVDNGDVAFSTNLGESEALE-LERSIRLFSAFSKTFLP--VRENYSIPLELIVFAKKA  99
            W+R+D+      T+L   EA E ++R  R  +A   +  P  +R+  +  L++ V     
Sbjct  38   WLRLDSDHYTLHTDLLAEEAREAMQRLERTRAAILTSMWPQSLRQQMT-KLDVYVIQSPR  96

Query  100  DFEDTVKPRKFASYTNSELDGVLIVAA-----PSTSKDVDLLEN--LKHELAHYHMRHTS  152
            +FE     R  A +  S+ + +++++        T   + L  +  L HELAHY   +  
Sbjct  97   EFEGLYPRRVRAFFFRSDSEALIVLSGRPGTWEQTFSGLSLASSSPLNHELAHYLSAYPL  156

Query  153  INYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTA  190
               P W  EGMA  L   TL    D   A    P  TA
Sbjct  157  SRQPRWLSEGMAEYLE--TLRISKDGRTAVVGAPHWTA  192


>gi|116253222|ref|YP_769060.1|  putative transmembrane protein [Rhizobium leguminosarum bv. viciae 
3841]
 gi|115257870|emb|CAK08968.1|  putative transmembrane protein [Rhizobium leguminosarum bv. viciae 
3841]
Length=370

 Score = 38.5 bits (88),  Expect = 0.37, Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 44/94 (46%), Gaps = 10/94 (10%)

Query  6    DPEQMINQLSQIHPLIVALFLSVSVVNLTFAA---PEEDRWIRVDNGDVAFSTNLGESEA  62
            DP+   N     HPL++A+   V  + L   A      DR  R    D+AF  +LG + A
Sbjct  195  DPQFFSN-----HPLLLAVAFLVCALGLFATALYFDLGDRLRRTTRSDIAFWLHLGAAPA  249

Query  63   LELERSIRLFSAFSKTFLPVRENYSIPLELIVFA  96
            L    S+RL  +F   FL V +  SI   +IV +
Sbjct  250  LLF--SVRLLMSFDGNFLDVAQAVSIKTPVIVIS  281


>gi|86160014|ref|YP_466799.1|  hypothetical protein Adeh_3596 [Anaeromyxobacter dehalogenans 
2CP-C]
 gi|85776525|gb|ABC83362.1|  hypothetical protein Adeh_3596 [Anaeromyxobacter dehalogenans 
2CP-C]
Length=498

 Score = 35.4 bits (80),  Expect = 2.7, Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 53/136 (38%), Gaps = 3/136 (2%)

Query  43   WIRVDNGDVAFSTNLGESEALELERSI-RLFSAFSKTFLPVRENYSIPLELIVFAKKADF  101
            W  +   ++   T+L   +A +L R + R++                P+ ++ F  + +F
Sbjct  36   WRELRTANILLQTDLSSGKAQDLARELDRIYDVVRIALFRRPPPTVAPMRVVAFQSEEEF  95

Query  102  EDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEE  161
                 P+   +Y  S      ++  P    D   +  + HE+ H+         P W+ E
Sbjct  96   H-LFAPKDATAYHMSGTRLGAVMLTPGLLADSQRIVAV-HEITHHVTTPLFARQPRWFAE  153

Query  162  GMATLLSEATLTFVDD  177
            G+A  +    +T VD+
Sbjct  154  GLACYMESMAMTGVDN  169


>gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108800252|ref|YP_640449.1|  hypothetical protein Mmcs_3286 [Mycobacterium sp. MCS]
 gi|92440295|gb|EAS98139.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108770671|gb|ABG09393.1|  conserved hypothetical protein [Mycobacterium sp. MCS]
Length=275

 Score = 35.0 bits (79),  Expect = 3.5, Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query  123  IVAAPSTS--KDVDLLENLKHELAHYHMR-HTSINYPLWYEEGMATLLSEATLTFVDDAI  179
            IV AP  +   D DL   L+HEL H+ +R  T+ + P W  EG+A  L+    T   DA 
Sbjct  137  IVFAPGAAAMTDEDLRIVLRHELFHHAVREQTAADAPRWLTEGVADHLARPRTTPAPDAE  196

Query  180  KA-----EFKTPKPTAGFPLKRSTKMVRKAWLVEHLKRRSLRNLNLR  221
             A     +  TP         R+ +     ++ +      LR L LR
Sbjct  197  TALPTDSDLDTPGAVRSQAYDRAWRFA--TYVADRYGPERLRALYLR  241


>gi|114769594|ref|ZP_01447204.1|  cobaltochelatase [alpha proteobacterium HTCC2255]
 gi|114549299|gb|EAU52181.1|  cobaltochelatase [alpha proteobacterium HTCC2255]
Length=1239

 Score = 35.0 bits (79),  Expect = 4.1, Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 81/197 (41%), Gaps = 34/197 (17%)

Query  7    PEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNG----DVAFSTNLGESEA  62
            PEQ +     I+PLI+       V  + F++  E  W    NG    D+A +  L E + 
Sbjct  272  PEQSVENSGAINPLIMEATQRAPVFQVVFSSSSETVWENELNGLNARDIAMNVALPEVDG  331

Query  63   LELERSIRLF-SAF--SKTFLPVRENYSIPLELIVFAKKADFEDTVKPRKFASYTNSELD  119
              L R+I     AF   KT  P+  +Y    + I +       D  K      +TN++  
Sbjct  332  RVLTRAISFKGEAFFDEKTQCPI-GSYRARGDRIEYVA-----DLTKNWVNLRHTNAKTK  385

Query  120  GVLIVAAPSTSKD---------------VDLLENLKHELAHYHMRHTSINYPLWYEEGMA  164
             V ++ A   +KD               VD+++ LKHE   YH +    + P   +E M 
Sbjct  386  KVSLILANYPNKDGRLANGVGLDTPQATVDMMKMLKHE--GYHTK----DLPNSSDELMK  439

Query  165  TLLSEATLTFVDDAIKA  181
             +++  T    D AI++
Sbjct  440  KIMNGPTNWLTDRAIRS  456


>gi|86160013|ref|YP_466798.1|  hypothetical protein Adeh_3595 [Anaeromyxobacter dehalogenans 
2CP-C]
 gi|85776524|gb|ABC83361.1|  hypothetical protein Adeh_3595 [Anaeromyxobacter dehalogenans 
2CP-C]
Length=529

 Score = 34.7 bits (78),  Expect = 5.0, Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 56/142 (39%), Gaps = 17/142 (11%)

Query  35   FAAPEED--RWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVREN-YSIP--  89
            F  PE+    W  +    V   T+L   +A EL           +TF+ VR   +  P  
Sbjct  52   FRCPEQGGPDWHELRTEHVVLQTDLPSWKAKELA------GELERTFVVVRTGLFRNPPP  105

Query  90   ----LELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAH  145
                L ++ FA +++FE    P    +Y +       +V  P T  D      + HEL H
Sbjct  106  APGLLRVVAFASESEFE-RFAPMGAGAYYHRPPFFAPVVVMPGTLGDAQRTV-IAHELTH  163

Query  146  YHMRHTSINYPLWYEEGMATLL  167
            +         P W+ EG+A+ +
Sbjct  164  HLTAQLFARQPPWFREGLASFM  185


>gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
 gi|116227896|gb|ABJ86605.1|  hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
Length=597

 Score = 34.7 bits (78),  Expect = 5.1, Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 60/137 (43%), Gaps = 10/137 (7%)

Query  35   FAAPEEDRWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVRENYSIPLELIV  94
            F+AP+ D W+++ + +    T  GE    +L +      +F           + P  +I 
Sbjct  25   FSAPQ-DSWLKITSANFELYTTAGERSGRDLIKHFEQVRSFFTQAFGAHLAAARPARIIA  83

Query  95   FAKKADFEDTVKPRKFAS--YTNSEL-DGVLIVAAPSTSKDVDLLENLKHELAHYHMRHT  151
            F  + +++   +P +FAS  Y    + D +++  A S    V +     HE  H  +  +
Sbjct  84   FRNEKEYQ-PYRPGEFASAFYQPGAVHDFIVMSGASSEHYPVAI-----HEYTHLMIHQS  137

Query  152  SINYPLWYEEGMATLLS  168
             ++ P W  EG+A L S
Sbjct  138  GMDLPPWLNEGLAELYS  154


>gi|108756961|ref|YP_630691.1|  hypothetical protein MXAN_2471 [Myxococcus xanthus DK 1622]
 gi|108460841|gb|ABF86026.1|  hypothetical protein MXAN_2471 [Myxococcus xanthus DK 1622]
Length=507

 Score = 33.9 bits (76),  Expect = 8.0, Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query  90   LELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAP---STSKDVDLLENLKHELAHY  146
            +++IV   ++  E+    R     TN+E DG L+V A    + S+    +    HEL HY
Sbjct  76   VDIIVLHNRSALEEFTNIRIEGFSTNTE-DGPLLVLAGHAYALSEATADITTQAHELTHY  134

Query  147  HMRHTSINYPLWYEEGMATLLSEATL  172
                  +  P W  EG+A+ L    L
Sbjct  135  LSELALVRQPRWLSEGLASYLETIAL  160






Blastx vs nr:

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1164883967-22710-64791720928.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,196,452 sequences; 1,444,328,266 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  ORF_CZ17580 ADN g##nomique
Length=855


                                                                   Score     E
Sequences producing significant alignments:                        (Bits)  Value

gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 ...  43.9    0.010  
gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 ...  41.2    0.062  
gi|108756961|ref|YP_630691.1|  hypothetical protein MXAN_2471 ...  38.9    0.31   
gi|114769594|ref|ZP_01447204.1|  cobaltochelatase [alpha prote...  36.2    2.0  
gi|86160014|ref|YP_466799.1|  hypothetical protein Adeh_3596 [...  36.2    2.0    
gi|86160013|ref|YP_466798.1|  hypothetical protein Adeh_3595 [...  35.0    4.4    
gi|18033721|gb|AAL57224.1|  gamma-glutamylcysteine synthetase ...  35.0    4.4  
gi|4713921|gb|AAD28293.1|  gamma-glutamylcysteine synthetase [Pla  35.0    4.4  
gi|68070807|ref|XP_677317.1|  gamma-glutamylcysteine synthetas...  35.0    4.4    
gi|68059036|ref|XP_671496.1|  hypothetical protein PB301533.00...  35.0    4.4    
gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein...  33.9    9.9  
gi|37665590|dbj|BAC99041.1|  replication protein [Lactobacillus s  33.9    9.9  



Alignement deux à deux:

>gi|108763613|ref|YP_630548.1|  hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
 gi|108467493|gb|ABF92678.1|  hypothetical protein MXAN_2327 [Myxococcus xanthus DK 1622]
Length=524

 Score = 43.9 bits (102),  Expect = 0.010
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 13/158 (8%)
 Frame = +2

Query  161  WIRVDNGDVAFSTNLGESEALE-LERSIRLFSAFSKTFLP--VRENYSIPLELIVFAKKA  331
            W+R+D+      T+L   EA E ++R  R  +A   +  P  +R+  +  L++ V     
Sbjct  38   WLRLDSDHYTLHTDLLAEEAREAMQRLERTRAAILTSMWPQSLRQQMT-KLDVYVIQSPR  96

Query  332  DFEDTVKPRKFASYTNSELDGVLIVAA-----PSTSKDVDLLEN--LKHELAHYHMRHTS  490
            +FE     R  A +  S+ + +++++        T   + L  +  L HELAHY   +  
Sbjct  97   EFEGLYPRRVRAFFFRSDSEALIVLSGRPGTWEQTFSGLSLASSSPLNHELAHYLSAYPL  156

Query  491  INYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPTA  604
               P W  EGMA  L   TL    D   A    P  TA
Sbjct  157  SRQPRWLSEGMAEYLE--TLRISKDGRTAVVGAPHWTA  192


>gi|116624734|ref|YP_826890.1|  hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
 gi|116227896|gb|ABJ86605.1|  hypothetical protein Acid_5658 [Solibacter usitatus Ellin6076]
Length=597

 Score = 41.2 bits (95),  Expect = 0.062
 Identities = 31/137 (22%), Positives = 59/137 (43%), Gaps = 10/137 (7%)
 Frame = +2

Query  137  FAAPEEDRWIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVRENYSIPLELIV  316
            F+AP+ D W+++ + +    T  GE    +L +      +F           + P  +I 
Sbjct  25   FSAPQ-DSWLKITSANFELYTTAGERSGRDLIKHFEQVRSFFTQAFGAHLAAARPARIIA  83

Query  317  FAKKADFEDTVKPRKFAS---YTNSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHT  487
            F  + +++   +P +FAS      +  D +++  A S    V +     HE  H  +  +
Sbjct  84   FRNEKEYQP-YRPGEFASAFYQPGAVHDFIVMSGASSEHYPVAI-----HEYTHLMIHQS  137

Query  488  SINYPLWYEEGMATLLS  538
             ++ P W  EG+A L S
Sbjct  138  GMDLPPWLNEGLAELYS  154


>gi|108756961|ref|YP_630691.1|  hypothetical protein MXAN_2471 [Myxococcus xanthus DK 1622]
 gi|108460841|gb|ABF86026.1|  hypothetical protein MXAN_2471 [Myxococcus xanthus DK 1622]
Length=507

 Score = 38.9 bits (89),  Expect = 0.31
 Identities = 36/138 (26%), Positives = 56/138 (40%), Gaps = 14/138 (10%)
 Frame = +2

Query  161  WIRVDNGDVAFSTNLGESEALELERSIRLF-----SAFSKTFLPVRENYSIPLELIVFAK  325
            W+ V +      TNL    A E  + + L       A+  +F P        +++IV   
Sbjct  29   WVEVRSPHFTVRTNLDTETAEEAAQELELLREGLLQAWGGSFDPPGT-----VDIIVLHN  83

Query  326  KADFEDTVKPRKFASYTNSELDGVLIVAAP---STSKDVDLLENLKHELAHYHMRHTSIN  496
            ++  E+    R     TN+E DG L+V A    + S+    +    HEL HY      + 
Sbjct  84   RSALEEFTNIRIEGFSTNTE-DGPLLVLAGHAYALSEATADITTQAHELTHYLSELALVR  142

Query  497  YPLWYEEGMATLLSEATL  550
             P W  EG+A+ L    L
Sbjct  143  QPRWLSEGLASYLETIAL  160


>gi|114769594|ref|ZP_01447204.1|  cobaltochelatase [alpha proteobacterium HTCC2255]
 gi|114549299|gb|EAU52181.1|  cobaltochelatase [alpha proteobacterium HTCC2255]
Length=1239

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 50/197 (25%), Positives = 81/197 (41%), Gaps = 34/197 (17%)
 Frame = +2

Query  53   PEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNG----DVAFSTNLGESEA  220
            PEQ +     I+PLI+       V  + F++  E  W    NG    D+A +  L E + 
Sbjct  272  PEQSVENSGAINPLIMEATQRAPVFQVVFSSSSETVWENELNGLNARDIAMNVALPEVDG  331

Query  221  LELERSIRL-FSAF--SKTFLPVRENYSIPLELIVFAKKADFEDTVKPRKFASYTNSELD  391
              L R+I     AF   KT  P+  +Y    + I +       D  K      +TN++  
Sbjct  332  RVLTRAISFKGEAFFDEKTQCPI-GSYRARGDRIEYV-----ADLTKNWVNLRHTNAKTK  385

Query  392  GVLIVAAPSTSKD---------------VDLLENLKHELAHYHMRHTSINYPLWYEEGMA  526
             V ++ A   +KD               VD+++ LKHE   YH +    + P   +E M 
Sbjct  386  KVSLILANYPNKDGRLANGVGLDTPQATVDMMKMLKHE--GYHTK----DLPNSSDELMK  439

Query  527  TLLSEATLTFVDDAIKA  577
             +++  T    D AI++
Sbjct  440  KIMNGPTNWLTDRAIRS  456


>gi|86160014|ref|YP_466799.1|  hypothetical protein Adeh_3596 [Anaeromyxobacter dehalogenans 
2CP-C]
 gi|85776525|gb|ABC83362.1|  hypothetical protein Adeh_3596 [Anaeromyxobacter dehalogenans 
2CP-C]
Length=498

 Score = 36.2 bits (82),  Expect = 2.0
 Identities = 26/136 (19%), Positives = 53/136 (38%), Gaps = 3/136 (2%)
 Frame = +2

Query  161  WIRVDNGDVAFSTNLGESEALELERSI-RLFSAFSKTFLPVRENYSIPLELIVFAKKADF  337
            W  +   ++   T+L   +A +L R + R++                P+ ++ F  + +F
Sbjct  36   WRELRTANILLQTDLSSGKAQDLARELDRIYDVVRIALFRRPPPTVAPMRVVAFQSEEEF  95

Query  338  EDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEE  517
                 P+   +Y  S      ++  P    D   +  + HE+ H+         P W+ E
Sbjct  96   H-LFAPKDATAYHMSGTRLGAVMLTPGLLADSQRIVAV-HEITHHVTTPLFARQPRWFAE  153

Query  518  GMATLLSEATLTFVDD  565
            G+A  +    +T VD+
Sbjct  154  GLACYMESMAMTGVDN  169


>gi|86160013|ref|YP_466798.1|  hypothetical protein Adeh_3595 [Anaeromyxobacter dehalogenans 
2CP-C]
 gi|85776524|gb|ABC83361.1|  hypothetical protein Adeh_3595 [Anaeromyxobacter dehalogenans 
2CP-C]
Length=529

 Score = 35.0 bits (79),  Expect = 4.4
 Identities = 35/142 (24%), Positives = 57/142 (40%), Gaps = 17/142 (11%)
 Frame = +2

Query  137  FAAPEEDR--WIRVDNGDVAFSTNLGESEALELERSIRLFSAFSKTFLPVREN-YSIP--  301
            F  PE+    W  +    V   T+L   +A EL   +       +TF+ VR   +  P  
Sbjct  52   FRCPEQGGPDWHELRTEHVVLQTDLPSWKAKELAGELE------RTFVVVRTGLFRNPPP  105

Query  302  ----LELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAPSTSKDVDLLENLKHELAH  469
                L ++ FA +++FE    P    +Y +       +V  P T  D      + HEL H
Sbjct  106  APGLLRVVAFASESEFE-RFAPMGAGAYYHRPPFFAPVVVMPGTLGDAQRTV-IAHELTH  163

Query  470  YHMRHTSINYPLWYEEGMATLL  535
            +         P W+ EG+A+ +
Sbjct  164  HLTAQLFARQPPWFREGLASFM  185


>gi|18033721|gb|AAL57224.1|  gamma-glutamylcysteine synthetase [Plasmodium berghei]
 gi|18033723|gb|AAL57225.1|  gamma-glutamylcysteine synthetase [Plasmodium berghei]
 gi|18033725|gb|AAL57226.1|  gamma-glutamylcysteine synthetase [Plasmodium berghei]
Length=967

 Score = 35.0 bits (79),  Expect = 4.4
 Identities = 37/179 (20%), Positives = 72/179 (40%), Gaps = 18/179 (10%)
 Frame = +2

Query  50   DPEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALEL  229
            D + + +QL+ I PL +A+      +   F    + RW  + N     S +    + L  
Sbjct  489  DAKYVYDQLAVIAPLFLAITACTPYLG-GFLTETDARWRVISN-----SVDCRTEDELSY  542

Query  230  ERSIRL--FSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPR--KFASYTNSEL---  388
                R    S +    LP+++NY    ++ +   K  ++  +K    ++ S   S L   
Sbjct  543  ISKPRYSGISLYISDELPLKKNYYFYNDIDIILNKNVYDKLIKENVDEYLSRHISSLFVR  602

Query  389  DGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDD  565
            D +++     + KD+  ++N+ HE           N  +W EE M  +       F++D
Sbjct  603  DPIVVFEGSFSEKDITTIQNIMHE-----KNENINNSKMWSEEEMNKIYLSDDFEFLED  656


>gi|4713921|gb|AAD28293.1|  gamma-glutamylcysteine synthetase [Plasmodium berghei]
Length=967

 Score = 35.0 bits (79),  Expect = 4.4
 Identities = 37/179 (20%), Positives = 72/179 (40%), Gaps = 18/179 (10%)
 Frame = +2

Query  50   DPEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALEL  229
            D + + +QL+ I PL +A+      +   F    + RW  + N     S +    + L  
Sbjct  489  DAKYVYDQLAVIAPLFLAITACTPYLG-GFLTETDARWRVISN-----SVDCRTEDELSY  542

Query  230  ERSIRL--FSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPR--KFASYTNSEL---  388
                R    S +    LP+++NY    ++ +   K  ++  +K    ++ S   S L   
Sbjct  543  ISKPRYSGISLYISDELPLKKNYYFYNDIDIILNKNVYDKLIKENVDEYLSRHISSLFVR  602

Query  389  DGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDD  565
            D +++     + KD+  ++N+ HE           N  +W EE M  +       F++D
Sbjct  603  DPIVVFEGSFSEKDITTIQNIMHE-----KNENINNSKMWSEEEMNKIYLSDDFEFLED  656


>gi|68070807|ref|XP_677317.1|  gamma-glutamylcysteine synthetase [Plasmodium berghei strain 
ANKA]
 gi|56497386|emb|CAH98696.1|  gamma-glutamylcysteine synthetase, putative [Plasmodium berghei]
Length=965

 Score = 35.0 bits (79),  Expect = 4.4
 Identities = 37/179 (20%), Positives = 72/179 (40%), Gaps = 18/179 (10%)
 Frame = +2

Query  50   DPEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALEL  229
            D + + +QL+ I PL +A+      +   F    + RW  + N     S +    + L  
Sbjct  487  DAKYVYDQLAVIAPLFLAITACTPYLG-GFLTETDARWRVISN-----SVDCRTEDELSY  540

Query  230  ERSIRL--FSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPR--KFASYTNSEL---  388
                R    S +    LP+++NY    ++ +   K  ++  +K    ++ S   S L   
Sbjct  541  ISKPRYSGISLYISDELPLKKNYYFYNDIDIILNKNVYDKLIKENVDEYLSRHISSLFVR  600

Query  389  DGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDD  565
            D +++     + KD+  ++N+ HE           N  +W EE M  +       F++D
Sbjct  601  DPIVVFEGSFSEKDITTIQNIMHE-----KNENINNSKMWSEEEMNKIYLSDDFEFLED  654


>gi|68059036|ref|XP_671496.1|  hypothetical protein PB301533.00.0 [Plasmodium berghei strain 
ANKA]
 gi|56487727|emb|CAI04104.1|  hypothetical protein PB301533.00.0 [Plasmodium berghei]
Length=325

 Score = 35.0 bits (79),  Expect = 4.4
 Identities = 37/179 (20%), Positives = 72/179 (40%), Gaps = 18/179 (10%)
 Frame = +2

Query  50   DPEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALEL  229
            D + + +QL+ I PL +A+      +   F    + RW  + N     S +    + L  
Sbjct  33   DAKYVYDQLAVIAPLFLAITACTPYLG-GFLTETDARWRVISN-----SVDCRTEDELSY  86

Query  230  ERSIRL--FSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPR--KFASYTNSEL---  388
                R    S +    LP+++NY    ++ +   K  ++  +K    ++ S   S L   
Sbjct  87   ISKPRYSGISLYISDELPLKKNYYFYNDIDIILNKNVYDKLIKENVDEYLSRHISSLFVR  146

Query  389  DGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDD  565
            D +++     + KD+  ++N+ HE           N  +W EE M  +       F++D
Sbjct  147  DPIVVFEGSFSEKDITTIQNIMHE-----KNENINNSKMWSEEEMNKIYLSDDFEFLED  200


>gi|92915559|ref|ZP_01284182.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108800252|ref|YP_640449.1|  hypothetical protein Mmcs_3286 [Mycobacterium sp. MCS]
 gi|92440295|gb|EAS98139.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108770671|gb|ABG09393.1|  conserved hypothetical protein [Mycobacterium sp. MCS]
Length=275

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +2

Query  389  DGVLIVAAPSTSKDVDLLENLKHELAHYHMRH-TSINYPLWYEEGMATLLSEATLTFVDD  565
            D ++     +   D DL   L+HEL H+ +R  T+ + P W  EG+A  L+    T   D
Sbjct  135  DRIVFAPGAAAMTDEDLRIVLRHELFHHAVREQTAADAPRWLTEGVADHLARPRTTPAPD  194

Query  566  A  568
            A
Sbjct  195  A  195


>gi|37665590|dbj|BAC99041.1|  replication protein [Lactobacillus sakei]
Length=219

 Score = 33.9 bits (76),  Expect = 9.9
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  377  NSELDGVLIVAAPSTSKDVDLLENLKHELAHYHMRHTSIN  496
            N EL GV I  +P   KD+  +E  K++ AHYH+ + S N
Sbjct  25   NLELIGVPIAISPLHDKDLSDVEGQKYKKAHYHVIYVSKN  64



ORF finding

ORF Finder SMS Any codon Direct:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 35 to base 853.
CATAATCATCACCCAGATCCGGAACAAATGATTAATCAATTGAGTCAAATTCATCCACTG
ATTGTCGCACTCTTTTTGAGTGTGTCGGTAGTGAATCTTACATTTGCCGCGCCAGAAGAA
GATCGCTGGATTCGTGTGGACAACGGAGATGTCGCCTTTTCTACCAACCTAGGTGAATCT
GAAGCACTAGAGCTAGAACGCTCAATTCGCCTATTCTCCGCGTTTAGCAAAACTTTTTTG
CCAGTTAGGGAAAATTATTCGATACCACTAGAGTTAATTGTTTTCGCGAAGAAAGCTGAT
TTTGAGGACACGGTAAAACCTAGAAAATTTGCTTCCTACACCAATTCTGAACTGGATGGT
GTTCTCATCGTCGCTGCTCCCTCTACCAGCAAAGATGTCGATCTTCTAGAAAATCTGAAG
CACGAGCTCGCGCACTATCACATGCGTCATACTTCGATTAATTATCCACTTTGGTACGAA
GAGGGAATGGCAACCCTGTTATCCGAGGCAACACTTACATTTGTAGACGACGCCATCAAA
GCCGAATTCAAAACTCCCAAGCCCACGGCAGGTTTTCCATTAAAACGATCTACAAAAATG
GTAAGAAAAGCCTGGTTGGTTGAACATCTTAAACGAAGAAGTCTGCGTAATCTGAACTTA
AGGATCATTCACAACTTCTATAATGATAGTCATCGACTGGCCAACTTCTTCCATTTTAAC
GAAAGTGATGATTCCAGATTCTCGATGAAAGCACTGAATCAATATCTATTAAACCAATCA
AGTACTCTTTTCTCCTCTCTTAATGTGACGCCAGACGAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
HNHHPDPEQMINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGES
EALELERSIRLFSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPRKFASYTNSELDG
VLIVAAPSTSKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIK
AEFKTPKPTAGFPLKRSTKMVRKAWLVEHLKRRSLRNLNLRIIHNFYNDSHRLANFFHFN
ESDDSRFSMKALNQYLLNQSSTLFSSLNVTPDE

No ORFs were found in reading frame 3.




ORF Finder SMS Any codon Reverse:

>ORF number 1 in reading frame 1 on the reverse strand extends from base 154 to base 360.
ATGATCCTTAAGTTCAGATTACGCAGACTTCTTCGTTTAAGATGTTCAACCAACCAGGCT
TTTCTTACCATTTTTGTAGATCGTTTTAATGGAAAACCTGCCGTGGGCTTGGGAGTTTTG
AATTCGGCTTTGATGGCGTCGTCTACAAATGTAAGTGTTGCCTCGGATAACAGGGTTGCC
ATTCCCTCTTCGTACCAAAGTGGATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MILKFRLRRLLRLRCSTNQAFLTIFVDRFNGKPAVGLGVLNSALMASSTNVSVASDNRVA
IPSSYQSG*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 568 to base 771.
TTTTCCCTAACTGGCAAAAAAGTTTTGCTAAACGCGGAGAATAGGCGAATTGAGCGTTCT
AGCTCTAGTGCTTCAGATTCACCTAGGTTGGTAGAAAAGGCGACATCTCCGTTGTCCACA
CGAATCCAGCGATCTTCTTCTGGCGCGGCAAATGTAAGATTCACTACCGACACACTCAAA
AAGAGTGCGACAATCAGTGGATGA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
FSLTGKKVLLNAENRRIERSSSSASDSPRLVEKATSPLSTRIQRSSSGAANVRFTTDTLK
KSATISG*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 654 to base 854.
GTTGGTAGAAAAGGCGACATCTCCGTTGTCCACACGAATCCAGCGATCTTCTTCTGGCGC
GGCAAATGTAAGATTCACTACCGACACACTCAAAAAGAGTGCGACAATCAGTGGATGAAT
TTGACTCAATTGATTAATCATTTGTTCCGGATCTGGGTGATGATTATGCTATTTGTCCTA
GGAACGTCCAGTTTGGCGCAG

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
VGRKGDISVVHTNPAIFFWRGKCKIHYRHTQKECDNQWMNLTQLINHLFRIWVMIMLFVL
GTSSLAQ




ORF Finder SMS ATG Direct:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 62 to base 853.
ATGATTAATCAATTGAGTCAAATTCATCCACTGATTGTCGCACTCTTTTTGAGTGTGTCG
GTAGTGAATCTTACATTTGCCGCGCCAGAAGAAGATCGCTGGATTCGTGTGGACAACGGA
GATGTCGCCTTTTCTACCAACCTAGGTGAATCTGAAGCACTAGAGCTAGAACGCTCAATT
CGCCTATTCTCCGCGTTTAGCAAAACTTTTTTGCCAGTTAGGGAAAATTATTCGATACCA
CTAGAGTTAATTGTTTTCGCGAAGAAAGCTGATTTTGAGGACACGGTAAAACCTAGAAAA
TTTGCTTCCTACACCAATTCTGAACTGGATGGTGTTCTCATCGTCGCTGCTCCCTCTACC
AGCAAAGATGTCGATCTTCTAGAAAATCTGAAGCACGAGCTCGCGCACTATCACATGCGT
CATACTTCGATTAATTATCCACTTTGGTACGAAGAGGGAATGGCAACCCTGTTATCCGAG
GCAACACTTACATTTGTAGACGACGCCATCAAAGCCGAATTCAAAACTCCCAAGCCCACG
GCAGGTTTTCCATTAAAACGATCTACAAAAATGGTAAGAAAAGCCTGGTTGGTTGAACAT
CTTAAACGAAGAAGTCTGCGTAATCTGAACTTAAGGATCATTCACAACTTCTATAATGAT
AGTCATCGACTGGCCAACTTCTTCCATTTTAACGAAAGTGATGATTCCAGATTCTCGATG
AAAGCACTGAATCAATATCTATTAAACCAATCAAGTACTCTTTTCTCCTCTCTTAATGTG
ACGCCAGACGAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALELERSI
RLFSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAPST
SKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPT
AGFPLKRSTKMVRKAWLVEHLKRRSLRNLNLRIIHNFYNDSHRLANFFHFNESDDSRFSM
KALNQYLLNQSSTLFSSLNVTPDE

No ORFs were found in reading frame 3.



ORF Finder SMS ATG Reverse:

>ORF number 1 in reading frame 1 on the reverse strand extends from base 154 to base 360.
ATGATCCTTAAGTTCAGATTACGCAGACTTCTTCGTTTAAGATGTTCAACCAACCAGGCT
TTTCTTACCATTTTTGTAGATCGTTTTAATGGAAAACCTGCCGTGGGCTTGGGAGTTTTG
AATTCGGCTTTGATGGCGTCGTCTACAAATGTAAGTGTTGCCTCGGATAACAGGGTTGCC
ATTCCCTCTTCGTACCAAAGTGGATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MILKFRLRRLLRLRCSTNQAFLTIFVDRFNGKPAVGLGVLNSALMASSTNVSVASDNRVA
IPSSYQSG*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.




ORF Finder SMS ATG,CTG,GTG,TTG Direct:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 62 to base 853.
ATGATTAATCAATTGAGTCAAATTCATCCACTGATTGTCGCACTCTTTTTGAGTGTGTCG
GTAGTGAATCTTACATTTGCCGCGCCAGAAGAAGATCGCTGGATTCGTGTGGACAACGGA
GATGTCGCCTTTTCTACCAACCTAGGTGAATCTGAAGCACTAGAGCTAGAACGCTCAATT
CGCCTATTCTCCGCGTTTAGCAAAACTTTTTTGCCAGTTAGGGAAAATTATTCGATACCA
CTAGAGTTAATTGTTTTCGCGAAGAAAGCTGATTTTGAGGACACGGTAAAACCTAGAAAA
TTTGCTTCCTACACCAATTCTGAACTGGATGGTGTTCTCATCGTCGCTGCTCCCTCTACC
AGCAAAGATGTCGATCTTCTAGAAAATCTGAAGCACGAGCTCGCGCACTATCACATGCGT
CATACTTCGATTAATTATCCACTTTGGTACGAAGAGGGAATGGCAACCCTGTTATCCGAG
GCAACACTTACATTTGTAGACGACGCCATCAAAGCCGAATTCAAAACTCCCAAGCCCACG
GCAGGTTTTCCATTAAAACGATCTACAAAAATGGTAAGAAAAGCCTGGTTGGTTGAACAT
CTTAAACGAAGAAGTCTGCGTAATCTGAACTTAAGGATCATTCACAACTTCTATAATGAT
AGTCATCGACTGGCCAACTTCTTCCATTTTAACGAAAGTGATGATTCCAGATTCTCGATG
AAAGCACTGAATCAATATCTATTAAACCAATCAAGTACTCTTTTCTCCTCTCTTAATGTG
ACGCCAGACGAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MINQLSQIHPLIVALFLSVSVVNLTFAAPEEDRWIRVDNGDVAFSTNLGESEALELERSI
RLFSAFSKTFLPVRENYSIPLELIVFAKKADFEDTVKPRKFASYTNSELDGVLIVAAPST
SKDVDLLENLKHELAHYHMRHTSINYPLWYEEGMATLLSEATLTFVDDAIKAEFKTPKPT
AGFPLKRSTKMVRKAWLVEHLKRRSLRNLNLRIIHNFYNDSHRLANFFHFNESDDSRFSM
KALNQYLLNQSSTLFSSLNVTPDE

No ORFs were found in reading frame 3.



ORF Finder SMS ATG,CTG,GTG,TTG Reverse:

>ORF number 1 in reading frame 1 on the reverse strand extends from base 154 to base 360.
ATGATCCTTAAGTTCAGATTACGCAGACTTCTTCGTTTAAGATGTTCAACCAACCAGGCT
TTTCTTACCATTTTTGTAGATCGTTTTAATGGAAAACCTGCCGTGGGCTTGGGAGTTTTG
AATTCGGCTTTGATGGCGTCGTCTACAAATGTAAGTGTTGCCTCGGATAACAGGGTTGCC
ATTCCCTCTTCGTACCAAAGTGGATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MILKFRLRRLLRLRCSTNQAFLTIFVDRFNGKPAVGLGVLNSALMASSTNVSVASDNRVA
IPSSYQSG*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 592 to base 771.
TTGCTAAACGCGGAGAATAGGCGAATTGAGCGTTCTAGCTCTAGTGCTTCAGATTCACCT
AGGTTGGTAGAAAAGGCGACATCTCCGTTGTCCACACGAATCCAGCGATCTTCTTCTGGC
GCGGCAAATGTAAGATTCACTACCGACACACTCAAAAAGAGTGCGACAATCAGTGGATGA


>Translation of ORF number 2 in reading frame 1 on the reverse strand.
LLNAENRRIERSSSSASDSPRLVEKATSPLSTRIQRSSSGAANVRFTTDTLKKSATISG*


No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.