ORF CG21450

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_2100095
Annotathon code: ORF_CG21450
Sample :
  • GPS :32°10'00n; 64°30'00w
  • Sargasso Sea: Sargasso Sea, Hydrostation S - Bermuda (UK)
  • Open Ocean (-5m, 22.9°C, 0.8-3.0 microns)
Authors
Team : BioCell 2007
Username : emilu
Annotated on : 2008-03-19 18:52:37
  • FERNANDEZ ORTEGA EMILIE
  • SOLER LUCIE

Synopsis

  • Taxonomy: Acaryochloris marina MBIC11017 (NCBI info)
    Rank: no rank - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 329726
    Kingdom: Bacteria - Phylum: Cyanobacteria - Class: - Order:
    Bacteria; Cyanobacteria; Acaryochloris;

Genomic Sequence

>JCVI_READ_2100095 ORF_CG21450 genomic DNA
GAGCTTAAATCCTCCCACGCCATACACGCGCTCGCGGGCAAGTCCGGAGCTTCTGACTCCCCGGCGACAGCGCGCGTCGCGCAGCACTGGCACCGTGATG
CCAGCCTCCTTTTTCCTCCGGACGCGCGATTCCACCTGACTGACGTGCACACGCGAGCATCAGGGGCCTTCCTTCCACCACACGCGATTAATGTCTTCAT
TCCACTGCAGCACCTGACTGAGGACAATGGGGCGACGGAATTCACTTTGGGTTCTCACATGTGGGGAGACGTGTGGGTCGACGACGAGGAAGCGGAGGCT
CCGTTACGCGATCACTCCTTTCTCTTACCGAGAGGCAGCTTTATTCTCGTTGACTATCGAACGGTCCACAGGGGGACCGTGAACCTGTCCAATAGAACAA
GATCCATGTTGATGCTAATCTATGGGCGATCCTGGTGGCACGACCGAACCAACTACGGTACTGAGGACTATGGTGGCGTCGGGCTGTCGGAGGCTCGCCG
CGACGACGGGGCCGGTGGTGGACCAGAGGCTGCGATTCAGCGTCGCGTTCTCAGGGCGCTCACAGTGTCGGAGGTGGGGCCTTCGGGCGAAGTCTGTGAT
CTGGGCACAGATGAACATGACCTCTGGCTTCGAGAGCGAATGTGGTGGGGTCTCACGACGATGT

Translation

[1 - 663/664]   direct strand
>ORF_CG21450 Translation [1-663   direct strand]
ELKSSHAIHALAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEA
PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARRDDGAGGGPEAAIQRRVLRALTVSEVGPSGEVCD
LGTDEHDLWLRERMWWGLTTM

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

Arbre non raciné
Méthode par parcimonie
Phylogénie.fr
kinetoplastid, cyanobactérie, algues vertes.



                       +--Synechosp2 (cyanobactérie)    
                    +--8  
                 +--7  +--Synechsp(cyanobactérie)   
                 |  |  
     +-----------6  +-----Stest  
     |           |  
     |           +--------Ostraotaur (algue verte) 
     |  
  +--5                 +--Leishdono (kinétoplastid)   
  |  |              +--4  
  |  |           +--3  +--Leishinfan (kinétoplastid) 
  |  |           |  |  
  1  +-----------2  +-----L.major (kinétoplastid) 
  |              |  
  |              +--------L.braz (kinétoplastid)
  |  
  +-----------------------T.brucei (kinétoplastid)

Annotator commentaries

  • ORF (Open Reading Frame)

Pour trouver notre ORF nous avons utilisé le logiciel SMS, par ORFfinder,avec le code génétique standard, sur les trois cadres de lectures, et un minimum de 60, dans le sens direct et indirect. Après la recherche d'ORFs, nous avons trouvé 4 cadres de lecture possibles. On a décidé de travailler sur l'ORF le plus long compris entre les bases 1 et 663 dans le sens direct. Il code pour une protéïne de 221 AA. Etant donné que le critère arbitraire du minimum de 60aa pour notre ORF est respecté, on peut supposer à ce stade que notre ORF est codant. Nous avons quand même observé que tous les ORF trouvés sur le brin indirect se terminent par un codon stop, TAA ou TAG.

  • Masse moléculaire

Le calcul de la masse moléculaire est impossible car l'ORF est incomplet en 3'et en 5'. En faisant une requête any codon dans ORFinder, nous n'obtenons pas un brin qui commence par une méthionine ni qui se termine par un codon stop. Observation qui sera renforcée plus tard par l'alignement multiple

  • Domaines protéiques

Nous avons utilisé le site InterproScan qui permet d'interroger la base InterPro, qui fédère un grand nombre de banques de données sur les domaines protéiques telles que Pfam. Nous avons trouvé un seul domaine protéique conservé (E-value, 1.1e-09) dont le numéro d'accession est IPR008775 correspondant à une Phytanoyl-CoA dioxygenase, son numéro d'accession Pfam est PF05721.Il semble être d'après la configuration visuelle donnée, s'agir d'un fragment de domaine Pfam-A c'est à dire un domaine qui a été et vérifié manuellement, la fiabilité des informations est donc pertinente. En cliquant sur la fiche d'InterproScan on peut voir : -qu'il n'y a aucuns termes GO associé, -qu'il y a deux relations "enfant" correspondant à une chlorinating enzyme (IPR010092) et une hydroxylase ectoine (IPR012774), -que ce domaine protéique n'est retrouvé dans aucun autre domaine protéique comme le précise le champ "found in no entries". Ca voudrait dire que ce domaine protéique est une unité structurale et fonctionnelle indépendante. La fiche Pfam de ce domaine protéique nous apprend que cette famille est composée de protéine PhyH eucaryote aussi bien qu'un nombre de dioxygenase bactérienne.(This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins as well as a number of bacterial deoxygenases). PhyH est une enzyme peroxymale catalysant la première étape de l'alpha oxidation de l'acide phytanique. Or, il existe plusieurs enzymes péroxymales. En recherchant dans PubMed Central, Entrez et Quick Go, nous apprenons que l'acide phytanique est un métabolite épimérique de l'isoprenoid de la chaine latérale de la chlorophylle. On suppose donc que dans notre cas notre enzyme aurait un lien avec la photosynthèse. De plus PhyH intervient dans la réaction : PhyH + oxoglutarate + O2 --> 2hydroxyphytanoyl-CoA + succinate + CO2. Dans nos recherches sur Pubmed ENTREZ nous avons trouvé dans les articles que PhyH peut être également nommé PAHX.

  • Blast

On a fait un blastp contre nr (car celui-ci regroupe beaucoup plus de séquences que swissprot) à partir de la séquence protéique et nous avons trouvé des résultats peu convaincants. Le blastp contre swissprot est évidemment moins bon. Par conséquent, nous avons décidé de faire un blastx vs nr et swissprot.Le Blastx contre NR traduit directement notre séquence génomique dans les six phases. Le Blastx permet aussi de vérifier si la séquence ne comporte pas un frameshift. Les résultats semblent montrer que ce n'est pas le cas. En effet, les E-values sont comprises entre 2e-10 et 2.8 et les scores sont globalement faibles (ils sont compris entre 35 et 69), hormis pour deux valeurs. Nous ne trouvons ici rien de plus significatif que nos précédentes requêtes effectuées avec le blastp.Nous obtenons aussi des résultats équivalents vs nr. Nous décidons donc de travailler sur notre première requête effectuée avec le blastp. On peut voir que seule une petite portion de notre séquence est homologue à un certain nombre de séquences déjà séquencées mais avec des faibles scores. Ce qui peut être non significatif car les régions similaires de notre ORF avec le reste des séquences protéiques présentes dans la banque sont comprises globalement entre l'acide aminé 50 et 130 soit seulement 80 acides aminés sur une totalité de 221aa. Ceci est visible grâce à l'alignement par couleur qui permet de donner rapidement une première idée visuelle des régions homologues de notre ORF. Grâce à l'alignement deux à deux réalisé dans blastp, on peut voir que notre séquence est incomplète: il semble que nous ayons la région centrale de la séquence sans les extrêmités N et C terminal. D'après le taxonomy report on remarque globalement des scores peu convaincants et de nombreuses espèces sont représentées(mouche, primate, carnivore, cyanobactérie, algues vertes, kinetoplastid, gram+, ascomycètes, alpha, beta, gamma-protéobactérie). Cette hétérogénéité nous laisse penser que notre ORF est sans doute un organisme pas encore vraiment connu. ce qui risque de poser problème pour construire notre arbre.

  • Alignement multiple

Alignement multiple réalisé avec phylogenie.fr. Globalement celui-ci n'est pas bon. C'est à dire qu'on a beau varier les organismes servant à construire notre groupe d'étude (Cyanobactéries, les Kinetoplastid, les algues vertes, un Gram+, des Ascomycètes, des Protéobactéries), les résultats sont similaires. On remarque qu'un ou deux acides aminés sont conservés au sein de toutes les séquences. Les gaps au début de la séquence sont importants. A ce stade nous n'arrivons pas à discerner clairement un groupe extérieur au vu de ces alignements et par conséquent nous nous demandons si tel ou tel orgarnisme doit être compris dans notre pseudo groupe d'étude. A chaque nouvel alignement nous construisons un arbre pour représenter les données de l'alignement multiple sous un autre angle. Or, l'arbre phylogénétique s'appuie sur l'alignement multiple qui est initialement mauvais. Le meilleur alignement obtenu est celui réalisé seulement en prenant des cyanobactéries, kinétoplastids, algues vertes (présenté dans la case prévue à cet effet). La similarité entre notre séquence et les autres séquences est un peu plus convaincante sans pour autant nous permettre de déterminer un groupe extérieur. L'alignement finalement présenté ici est celui réalisé dans phylogénie.fr puisque nous construisons l'arbre grâce à ce même logiciel.

  • Arbre

Comme nous le disons au-dessus, ne pouvant pas déterminer un groupe extérieur, nous décidons de construire un arbre non raciné avec les cyanobactéries, kinetoplastids, algues vertes, ce par la méthode de parcimonie dans phylogenie.fr. Au vu de notre arbre il semble se dégager deux groupes, l'un regroupant les kinétoplastid (eucaryote) et l'autre regroupant notre ORF, les algues vertes (eucaryotes) et les cyanobactéries (Eubactéries). D'un point de vue évolutif notre ORF et les cyanobactéries semblent avoir un ancêtre commun qui n'est pas partagé avec les algues verte. Ce qui nous laisse penser que notre ORF serait plus proche évolutivement des cyanobactéries que des algues vertes et laisserait peut être penser que notre ORF est une cyanobactérie appartenant au règne des Eubactéries.

  • Prédiction d'appartenance

Le Campbell nous apprend que les cyanobactéries sont les seuls procaryotes capables de photosynthèse productrice de dioxygène. Information qui est en accord avec les informations données par la fiche Pfam de la PhyH. Il s'agit d'organismes solitaires et coloniaux abondants partout où on trouve de l'eau. Ce qui est notre cas puisque notre ORF a été prélevé dans la mer des Sargasses.

  • Processus Biologique/Fonction moléculaire

Une dernière recherche dans NCBI nous permet d'avoir les références taxonomiques de notre ORF qui concordent avec nos informations et nos données brutes (blast, alignement multiple, arbre phylogénétique, etc...)Voilà pourquoi nous avons décidé de mettre comme processus biologique la respiration cellulaire et avancer le fait que notre ORF a une activité d'oxidoréductase. Nous pensons aussi qu'il s'agit par ailleurs d'un ADN codant, étant donné que l'enzyme PhyH est retrouvée à la fois chez les Eucaryotes et les Eubactéries ça expliquerait l'hétérogénéité des organismes représentés dans le taxonomy report.

Multiple Alignement

MUSCLE (3.6) multiple sequence alignment


T.brucei_gi_72387023_ref_XP_8439      ---MNNSLKKGSQSGRCCRCGAAFDHRNARRAVKCTKCQRIFHTKCFLAETGLS----AA
L.braz_gi_154340974_ref_XP_00156      -----MRIPLAIEHTTCSRCGKMLREATLKKSVHCVKCNRWYHRMCFMADTGVV-EEKAP
L.major_gi_73536664_ref_XP_84775      -------MRLSLVEHTCSRCGKKLREAAIKKSVHCIKCNRWYHRACFMADTGVVIEKKAP
Leishinfan_gi_146093005_ref_XP_0      -------MGLSLVEHTCSRCGKKLREAAIRKSVHCIKCNRWYHRTCFMADTGVVIEEKAP
Leishdono_gi_6708171_gb_AAF25825      -----------------------------------------------MADTGVVIEEKAP
Ostraotaur_gi_116057465_emb_CAL5      MMVTDHSNTLQSSTNPAENPSIGFLESSASRRRPVSPLARVVVRPARARDREPIAPRRTL
Stest_ORF_CG21450_Traduction_{1-      ----------------------------------------------------------EL
Synechsp_gi_86608026_ref_YP_4767      -----------------------------------------------------------M
Synechosp2_gi_86606777_ref_YP_47      -----------------------------------------------------------M
                                                                                                  

T.brucei_gi_72387023_ref_XP_8439      VDSH--C-----------------------------------------------------
L.braz_gi_154340974_ref_XP_00156      TTYS--C-----------------------------------------------------
L.major_gi_73536664_ref_XP_84775      TTDR--C-----------------------------------------------------
Leishinfan_gi_146093005_ref_XP_0      TSDR--C-----------------------------------------------------
Leishdono_gi_6708171_gb_AAF25825      TSDR--C-----------------------------------------------------
Ostraotaur_gi_116057465_emb_CAL5      ELFSQQQHRLVAHRERFERGDVAMDDDDEAEDEATWDDARTMRTAVVTMTCDVARWRRED
Stest_ORF_CG21450_Traduction_{1-      KSSH--A-----------------------------------------------------
Synechsp_gi_86608026_ref_YP_4767      RFSP--A-----------------------------------------------------
Synechosp2_gi_86606777_ref_YP_47      HFSH--A-----------------------------------------------------
                                                                                                  

T.brucei_gi_72387023_ref_XP_8439      ------------------------------------------------------------
L.braz_gi_154340974_ref_XP_00156      ------------------------------------------------------------
L.major_gi_73536664_ref_XP_84775      ------------------------------------------------------------
Leishinfan_gi_146093005_ref_XP_0      ------------------------------------------------------------
Leishdono_gi_6708171_gb_AAF25825      ------------------------------------------------------------
Ostraotaur_gi_116057465_emb_CAL5      GEACERLRAWTEACAWTPRRAMSVAACVGTGGDAEKTVVLDVVVRWRCRGCVTEEGRLER
Stest_ORF_CG21450_Traduction_{1-      ------------------------------------------------------------
Synechsp_gi_86608026_ref_YP_4767      ------------------------------------------------------------
Synechosp2_gi_86606777_ref_YP_47      ------------------------------------------------------------
                                                                                                  

T.brucei_gi_72387023_ref_XP_8439      -----VVCLCGISQT------------------------------------PYPLTIQQN
L.braz_gi_154340974_ref_XP_00156      -----VCCLSGTIEEKL-------------------------------E--KHPHHMNK-
L.major_gi_73536664_ref_XP_84775      -----VCCLAGTIDMKS-------------------------------K--KYSHHMNK-
Leishinfan_gi_146093005_ref_XP_0      -----VCCLAGTIDMKS-------------------------------K--RYSHHMNK-
Leishdono_gi_6708171_gb_AAF25825      -----VCCLAGTIDMKS-------------------------------K--RYSHHMNK-
Ostraotaur_gi_116057465_emb_CAL5      RLTRRVEAFGGGGDEREMRGDIVRVREFTVSVTAPGYVPIGSFEETVVECGPDGPGVAE-
Stest_ORF_CG21450_Traduction_{1-      -----IHALAGKSGA------------------------------------SDSPATAR-
Synechsp_gi_86608026_ref_YP_4767      -----VR-VSGTESLQE-------------------------------LQQPDPETVEQ-
Synechosp2_gi_86606777_ref_YP_47      ------------ERERR-------------------------------Q--PDPETVEQ-
                                                                                                  

T.brucei_gi_72387023_ref_XP_8439      TLARKFLRDGFVVVPLTRKPKSKQTTLEKLATFRANAERYFGAFIRAYENELEISSKAPS
L.braz_gi_154340974_ref_XP_00156      -YAKAFLEDGFCVVPLAEKRIELDNIIQDLTAWNADLLRYFNGLLKTYQCQAEMGDAVPT
L.major_gi_73536664_ref_XP_84775      -YARSFIKDGFCVVPLAETKTELEQITQDLSAWNADLLRYFKALLKTYECQAEMRGAVPS
Leishinfan_gi_146093005_ref_XP_0      -YAKGFIKNGFCVVPLAETKTELEQITQDLSTWNADLLRYFKALLTTYECQAEMGGAVPS
Leishdono_gi_6708171_gb_AAF25825      -YAKGFIKNGFCVVPLAETKTELEQITQDLSTWNADLLRYFKALLTTYECQAEMGGAVPS
Ostraotaur_gi_116057465_emb_CAL5      -ASARFHEDGLATCLRIVDDDCALAIRHLVLEY---IEKI----------ERRFAEGHPD
Stest_ORF_CG21450_Traduction_{1-      -VAQHWHRDASLLFPPDAR--------------------F--------------------
Synechsp_gi_86608026_ref_YP_4767      -AFELFSTEGYLVLPEIFPPELIDKLH---SSFLATYSRY---------CTHEHHADALL
Synechosp2_gi_86606777_ref_YP_47      -AFHLFSTEGYLVLPEIFPTALIDKLH---SSFLTTYSRY---------CTHENHPDALL
                                           :  :.                                                  

T.brucei_gi_72387023_ref_XP_8439      LQSG-----YSNFRERGKGRYEVIFPSIREEVLSIIENCDEVTMTLDLLLAPTGKRGDMQ
L.braz_gi_154340974_ref_XP_00156      LESG-----YSNFRQRCPGRFEIIADFISSKVVPLVAKSQIVQQTLDTLLCNAHLR--IE
L.major_gi_73536664_ref_XP_84775      LESG-----YSNFRQRCPGRFEIIADFITSKVVPLVANAQTVQQTLDALLCNAHLQ--TG
Leishinfan_gi_146093005_ref_XP_0      LESG-----YSNFRQRCPGRFEIIADFITSKVVPLVANAQTVQQTLDALLCNSQLQ--TG
Leishdono_gi_6708171_gb_AAF25825      LESG-----YSNFRQRCPGRFEIIADFITSKVVPLVANAQTVQQTLDALLCNSQLQ--TG
Ostraotaur_gi_116057465_emb_CAL5      IAYGKDRFAFKEISSRGGERFDALIDIERPEWKSLRDLARIDAPWLAFINEVL-----ST
Stest_ORF_CG21450_Traduction_{1-      ---H-----LTDVHTRASGAF---------------------------------------
Synechsp_gi_86608026_ref_YP_4767      VGNR-----RVMVTVRLEGPFNDPLIYAHPLILPILKRILGPELILSGL-----------
Synechosp2_gi_86606777_ref_YP_47      VGNR-----RVMVTVRLEGPFNDPLLYAHPLILPILQRILGSSLILSGL-----------
                                                  .  *    :                                       

T.brucei_gi_72387023_ref_XP_8439      RKLMSCGCFYSLPGSLRQDVHTDGPALS---TVED-------LFP-YAINVFVPLVPLNK
L.braz_gi_154340974_ref_XP_00156      KKVMSSGCFLSLMGSETQNPHTDGPGLS---NVVN-------LFP-YAVNVFVPLISVDS
L.major_gi_73536664_ref_XP_84775      KKVMSSGCFLSLMGSETQNVHTDGPALS---NVVN-------LFP-YAINVFVPLISVDS
Leishinfan_gi_146093005_ref_XP_0      KKVMSSGCFLSLMGSETQNAHTDGPALS---NVVN-------LFP-YAINVFVPLISVDS
Leishdono_gi_6708171_gb_AAF25825      KKVMSSGCFLSLMGSETQNAHTDGPALS---NVVN-------LFP-YAINVFVPLISVDS
Ostraotaur_gi_116057465_emb_CAL5      KWNVNVSVVYSRPGAKNQEWHADGRHLD---TECDPRTGEGHAQP-YGVCVFMPLIHLDR
Stest_ORF_CG21450_Traduction_{1-      ------------------------------------------LPP-HAINVFIPLQHLTE
Synechsp_gi_86608026_ref_YP_4767      ------GAVVSLPGSADQQVHRDLSHLFGDETLDA-------IIPCYALNLLIPLVEVNE
Synechosp2_gi_86606777_ref_YP_47      ------GVVVSLPGSADQQVHRDLSHLFGDAILDA-------IVPCYALNLLIPLVEVNE
                                                                                  * :.: :::**  :  

T.brucei_gi_72387023_ref_XP_8439      TNG-TEFFPGSHRVN--YSSKPVSQQRPVTPT--VPLGKVLLFDYRVLHRGLGNRLGFHR
L.braz_gi_154340974_ref_XP_00156      RNG-TEFFPGSHIVG------NARRRKPVSPA--VALGNALLFDYRVVHRGLRNAKIDPR
L.major_gi_73536664_ref_XP_84775      RNG-TEFFPGSHVVG------DRRQRKSVSPP--VALGSVLLFDYRVVHRGLRNAKSEPR
Leishinfan_gi_146093005_ref_XP_0      RNG-TEFFPGSHVVG------DRRQSKSVSPP--VALGSVLLFDYRVVHRGLRNAKSEPR
Leishdono_gi_6708171_gb_AAF25825      RNG-TEFFPGSHVVG------DRRQSKSVSPP--VALGSVLLFDYRVVHRGLRNAKSEPR
Ostraotaur_gi_116057465_emb_CAL5      DTGYTQFFKRSHKTSELIGFGEAASMLRLSFDGLLNTGQSVVYDYRLLHRGMYNRSNYVR
Stest_ORF_CG21450_Traduction_{1-      DNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR
Synechsp_gi_86608026_ref_YP_4767      ENGMTRLWPGSHAVFDAHYTELAQQMPFIDPP--LAKGSCLLFDYRLIHLGRANRSPAPR
Synechosp2_gi_86606777_ref_YP_47      ENGMTRLWPGSHAVFEAHYTELARQMPFVDPP--LAKGSCLLFDYRLIHLGRANRSAAPR
                                       .* * :   **                      :  *. :: *** :* *  *     *

T.brucei_gi_72387023_ref_XP_8439      PCYYATYARSWYEDKFNFSSTRY-----------RTALHVPSYLLERRCDR--------E
L.braz_gi_154340974_ref_XP_00156      PCYYVTFSQSWYQDIYNFSRKRY-----------KRQLDVDPSLLESREER--------M
L.major_gi_73536664_ref_XP_84775      PCYYVTFSRSWYQDTYNFSERRY-----------KKRLDVDPTLLESREER--------M
Leishinfan_gi_146093005_ref_XP_0      PCYYVTFSRSWYQDTYNFSERRY-----------KKRLDVDPTLLESREER--------M
Leishdono_gi_6708171_gb_AAF25825      PCYYVTFSRSWYQDTYNFSERRY-----------KKRLDVDPTLLESREER--------M
Ostraotaur_gi_116057465_emb_CAL5      PVLQFLYTAPAYRETKNY------------------------------------------
Stest_ORF_CG21450_Traduction_{1-      SMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARRDDGAGGGPEAAIQRRVLRALTVSEVGP
Synechsp_gi_86608026_ref_YP_4767      PLLYNTYSRAWFRDPINYTQQ-------------------PPLVI--------------P
Synechosp2_gi_86606777_ref_YP_47      PLLYNTYSRPWFRDPVNYTRQ-------------------PPLVI--------------P
                                      .     :  . : :  *:                                          

T.brucei_gi_72387023_ref_XP_8439      VSKRCKVE-------------------
L.braz_gi_154340974_ref_XP_00156      AKKRRSGDGGSSVLQLT----------
L.major_gi_73536664_ref_XP_84775      AKKSRSDDGGSSASQFR----------
Leishinfan_gi_146093005_ref_XP_0      AKKSRSDDGGSSASQLR----------
Leishdono_gi_6708171_gb_AAF25825      AKKSRSDDGGSSASQLR----------
Ostraotaur_gi_116057465_emb_CAL5      ---------GVDSMW------------
Stest_ORF_CG21450_Traduction_{1-      SGEVCDLGTDEHDLWLRERMWWGLTTM
Synechsp_gi_86608026_ref_YP_4767      AQEKERIPAEHQNLFVTAQIV------
Synechosp2_gi_86606777_ref_YP_47      AAEKERIPAQHHSLFVAAQIV------
                            

BLAST

Blastp contre Swissprot
 
Sequences producing significant alignments:                       (Bits)  Value

sp|P67773|Y3657_MYCBO  Uncharacterized protein Mb3657 >sp|P677...  30.4    6.1  
sp|O86281|Y2431_LACLM  Uncharacterized protein llmg_2431 (ORFB)    30.0    8.1   Gene info
___________________________________________________________________________________________________
Blastp contre nr

Sequences producing significant alignments:                       (Bits)  Value

ref|YP_476788.1|  phytanoyl-CoA dioxygenase PhyH family protei...  69.7    1e-10 Gene info
ref|XP_001466614.1|  hypothetical protein [Leishmania infantum...  65.1    3e-09 Gene info
gb|AAF25825.1|AF185069_1  5FI8BORFP [Leishmania donovani]          65.1    3e-09
ref|XP_847751.1|  hypothetical protein, conserved [Leishmania ...  65.1    3e-09 Gene info
ref|YP_475540.1|  phytanoyl-CoA dioxygenase PhyH family protei...  64.7    4e-09 Gene info
ref|XP_843936.1|  hypothetical protein, conserved [Trypanosoma...  63.9    7e-09 Gene info
emb|CAL51892.1|  unnamed protein product [Ostreococcus tauri]      61.2    4e-08
emb|CAL53283.1|  5FI8BORFP (ISS) [Ostreococcus tauri]              59.7    1e->ref|YP_476788.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] gb|ABD01525.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] Length=272 GENE ID: 3901624 CYB_0534 | phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] (10 or fewer PubMed links)  Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 47/142 (33%), Positives = 64/142 (45%), Gaps = 15/142 (10%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 L+G P +A Q HRD S LF + A +P +A+N+ IPL Sbjct 116 LSGLGAVVSLPGSAD--QQVHRDLSHLFGDETL-----------DAIIPCYALNLLIPLV 162 Query 71 HLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 + E+NG T GSH D + + P D L +GS +L DYR +H G N S Sbjct 163 EVNEENGMTRLWPGSHAVFDAHYTELAQQMPFIDPP--LAKGSCLLFDYRLIHLGRANRS 220 Query 131 NRTRSMLMLIYGRSWWHDRTNY 152 R +L Y R+W+ D NY Sbjct 221 PAPRPLLYNTYSRAWFRDPINY 242 >ref|XP_001466614.1| Gene info hypothetical protein [Leishmania infantum] emb|CAM69654.1| Gene info hypothetical protein, conserved [Leishmania infantum] Length=349 GENE ID: 5070647 LinJ29.1090 | hypothetical protein [Leishmania infantum JPCM5] Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 224 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDR-RQSKSVSPPV-------ALGSVLLF 274 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 275 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 314 >gb|AAF25825.1|AF185069_1 5FI8BORFP [Leishmania donovani] Length=309 Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 184 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDR-RQSKSVSPPV-------ALGSVLLF 234 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 235 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 274 >ref|XP_847751.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin] gb|AAZ09543.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin] Length=349 GENE ID: 3608432 LmjF29.0885 | hypothetical protein, conserved [Leishmania major strain Friedlin] (10 or fewer PubMed links)  Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + S + GS +L Sbjct 224 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGD--------RRQRKSVSPPVALGSVLLF 274 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 275 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 314 >ref|YP_475540.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] gb|ABD00277.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] Length=264 GENE ID: 3899087 CYA_2137 | phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] (10 or fewer PubMed links)  Score = 64.7 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 44/125 (35%), Positives = 58/125 (46%), Gaps = 13/125 (10%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q HRD S LF DA A +P +A+N+ IPL + E+NG T GSH Sbjct 123 QQVHRDLSHLFG-DAILD----------AIVPCYALNLLIPLVEVNEENGMTRLWPGSHA 171 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 + + + P D L +GS +L DYR +H G N S R +L Y R W+ Sbjct 172 VFEAHYTELARQMPFVDPP--LAKGSCLLFDYRLIHLGRANRSAAPRPLLYNTYSRPWFR 229 Query 148 DRTNY 152 D NY Sbjct 230 DPVNY 234 >ref|XP_843936.1| Gene info hypothetical protein, conserved [Trypanosoma brucei] gb|AAX69674.1| hypothetical protein, conserved [Trypanosoma brucei] gb|AAZ10377.1| Gene info hypothetical protein, conserved [Trypanosoma brucei] Length=345 GENE ID: 3656284 Tb927.3.3440 | hypothetical protein, conserved [Trypanosoma brucei TREU927] (10 or fewer PubMed links)  Score = 63.9 bits (154), Expect = 7e-09, Method: Composition-based stats. Identities = 42/116 (36%), Positives = 54/116 (46%), Gaps = 13/116 (11%) Query 48 DVHTRASGAF----LPPHAINVFIPLQHLTEDNGATEFTLGSHM--WGDVWVDDEEAEAP 101 DVHT L P+AINVF+PL L + NG TEF GSH + V + P Sbjct 211 DVHTDGPALSTVEDLFPYAINVFVPLVPLNKTNG-TEFFPGSHRVNYSSKPVSQQRPVTP 269 Query 102 LRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 +P G +L DYR +HRG N R Y RSW+ D+ N+ + Y Sbjct 270 T------VPLGKVLLFDYRVLHRGLGNRLGFHRPCYYATYARSWYEDKFNFSSTRY 319 >emb|CAL51892.1| unnamed protein product [Ostreococcus tauri] Length=480 Score = 61.2 bits (147), Expect = 4e-08, Method: Composition-based stats. Identities = 40/128 (31%), Positives = 55/128 (42%), Gaps = 8/128 (6%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q WH D R T+ R P+ + VF+PL HL D G T+F SH Sbjct 358 QEWH--------ADGRHLDTECDPRTGEGHAQPYGVCVFMPLIHLDRDTGYTQFFKRSHK 409 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 ++ E A LL G ++ DYR +HRG N SN R +L +Y + Sbjct 410 TSELIGFGEAASMLRLSFDGLLNTGQSVVYDYRLLHRGMYNRSNYVRPVLQFLYTAPAYR 469 Query 148 DRTNYGTE 155 + NYG + Sbjct 470 ETKNYGVD 477 >emb|CAL53283.1| 5FI8BORFP (ISS) [Ostreococcus tauri] Length=563 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 42/122 (34%), Positives = 58/122 (47%), Gaps = 14/122 (11%) Query 40 PDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDD 95 P+ FH R G F NVF+P+ ++ G TEF GSH W V D Sbjct 446 PEQHFH---ADGRVFGIF------NVFVPMSAVSTIEGPTEFIHGSHQWDHNAAHVTTPD 496 Query 96 EEAEAPL-RDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGT 154 ++A+A R L GS ++ DYR +HRG N S R R + ++YG S D N+ Sbjct 497 QKAQAAAPRFQPELRVPGSLLVYDYRVMHRGGANASTRRRPLAYVMYGSSGTRDSWNFPL 556 Query 155 ED 156 +D Sbjct 557 DD 558 >ref|XP_808587.1| Gene info ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain CL Brener] gb|EAN86736.1| Gene info ADP-ribosylation factor-like protein 3A, putative [Trypanosoma cruzi] Length=345 GENE ID: 3539035 Tc00.1047053504433.14 | ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)  Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 39/113 (34%), Positives = 55/113 (48%), Gaps = 9/113 (7%) Query 47 TDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM--WGDVWVDDEEAEAPLRD 104 TD +S L P+AINVFIPL + ++NG TE GSH W D + + Sbjct 214 TDGPPLSSVVNLFPYAINVFIPLVPVDKNNG-TEVFPGSHRIEW------DSRSSLKKKP 266 Query 105 HSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 + ++P G +L DYR +HRG N R + RSW+ D+ N+ Y Sbjct 267 VTPIIPFGKALLFDYRLLHRGLGNRLGSPRPCYYATFVRSWYEDKFNFSFSRY 319 >ref|XP_001566440.1| hypothetical protein, conserved [Leishmania braziliensis] emb|CAM39951.1| hypothetical protein, conserved [Leishmania braziliensis] Length=350 Score = 57.4 bits (137), Expect = 6e-07, Method: Composition-based stats. Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+A+NVF+PL + NG TEF GSH+ G+ P+ S + G+ +L Sbjct 225 LFPYAVNVFVPLISVDSRNG-TEFFPGSHIVGNA-----RRRKPV---SPAVALGNALLF 275 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N R + + +SW+ D N+ + Y Sbjct 276 DYRVVHRGLRNAKIDPRPCYYVTFSQSWYQDIYNFSRKRY 315 >ref|XP_818133.1| Gene info hypothetical protein [Trypanosoma cruzi strain CL Brener] gb|EAN96282.1| Gene info hypothetical protein, conserved [Trypanosoma cruzi] Length=345 GENE ID: 3550292 Tc00.1047053507951.179 | hypothetical protein [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)  Score = 57.0 bits (136), Expect = 8e-07, Method: Composition-based stats. Identities = 39/113 (34%), Positives = 55/113 (48%), Gaps = 9/113 (7%) Query 47 TDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM--WGDVWVDDEEAEAPLRD 104 TD +S L P+AINVFIPL + ++NG TE GSH W D + + Sbjct 214 TDGPPLSSVVNLFPYAINVFIPLVPVDKNNG-TEVFPGSHRIEW------DSRSSLKKKP 266 Query 105 HSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 + +P G +L DYR +HRG N + R + RSW+ D+ N+ Y Sbjct 267 VTPSIPFGKALLFDYRLLHRGLGNRLSSPRPCYYATFVRSWYKDKFNFSFSRY 319 >ref|YP_496299.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] gb|ABD25465.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] Length=296 GENE ID: 3915802 Saro_1020 | Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 38/125 (30%), Positives = 51/125 (40%), Gaps = 17/125 (13%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 QH H D + LF + LP A+ + IPL + E NG TEF LG+H Sbjct 122 QHLHSDDTFLFA-----------GSENDGKLPAFALTIAIPLVEVNEVNGGTEFLLGTHR 170 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 P S L G ++ D+ HRG N+SN R M + R +W Sbjct 171 C------KSGKSYPGVPVSSPLAPGDCMIWDFMVRHRGRPNVSNAARPMFYITACRPFWI 224 Query 148 DRTNY 152 D N+ Sbjct 225 DSANF 229 >ref|XP_001417606.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO95899.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=314 GENE ID: 5001547 OSTLU_31394 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 52.0 bits (123), Expect = 2e-05, Method: Composition-based stats. Identities = 38/128 (29%), Positives = 56/128 (43%), Gaps = 10/128 (7%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q WH D R + R PP+ + VF+PL L+ + G T+F + SH Sbjct 189 QEWH--------ADGRHLDVECDVRTGCGHAPPYGVCVFMPLIDLSRETGFTQFFMRSHK 240 Query 88 WGDVWVDDEEAEAPLR-DHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 + + +A LR +L G + DYR +HRG N S R +L +Y + Sbjct 241 TSKL-IGFGDASLILRLSFDGILDAGQSVAYDYRLLHRGMANDSLANRPVLQFLYTAPAY 299 Query 147 HDRTNYGT 154 + NYGT Sbjct 300 RETKNYGT 307 >ref|XP_747181.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL85143.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=291 GENE ID: 3504528 AFUA_8G00230 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 39/104 (37%), Positives = 50/104 (48%), Gaps = 20/104 (19%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ +HRD DA L +H + A PP +++V PL TE+NGATE LGSH Sbjct 125 AQPFHRD-------DATHPL--MHYQPLEA--PPVSLSVIFPLTEFTEENGATEVILGSH 173 Query 87 MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRGTVN 128 W E P RD + L + G ++V R VH G N Sbjct 174 RW-------TEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGN 210 >ref|XP_001261651.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW19754.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=291 GENE ID: 4588684 NFIA_093740 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 39/104 (37%), Positives = 50/104 (48%), Gaps = 20/104 (19%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ +HRD DA L +H + A PP +++V PL TE+NGATE LGSH Sbjct 125 AQPFHRD-------DATHPL--MHHQPLEA--PPISLSVIFPLTEFTEENGATEVILGSH 173 Query 87 MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRGTVN 128 W E P RD + L + G ++V R VH G N Sbjct 174 RW-------MEVGTPERDQAVLATMDPGDVLVVRQRVVHAGGGN 210 >gb|AAD32731.1| MmcH [Streptomyces lavendulae] Length=254 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 5/138 (3%) Query 34 ASLLFPPDARFHLTDVHTRASGAFLP-PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW 92 A++ P +R HL T A + P P N L TEDNGAT GSH+ G Sbjct 101 ANIAGPGGSRMHLHADQTFARPPWPPYPLVANSMWMLDDFTEDNGATRLVPGSHLLGR-Q 159 Query 93 VDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 D + E + P GS ++ D R H+ N ++R R ++ Y R + + N+ Sbjct 160 PDYDRGEGNTETVAVCAPAGSVMVFDGRLWHQTGANTTDRPRHGILNYYCRGYVRQQQNF 219 Query 153 GT---EDYGGVGLSEARR 167 + ED E RR Sbjct 220 FSGLREDVATRATPELRR 237 >ref|ZP_01627897.1| hypothetical protein MGP2080_15899 [marine gamma proteobacterium HTCC2080] gb|EAW39438.1| hypothetical protein MGP2080_15899 [marine gamma proteobacterium HTCC2080] Length=269 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 42/147 (28%), Positives = 60/147 (40%), Gaps = 39/147 (26%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 QHWH D+ P AR HL P HAINV + L + G TE LGSH Sbjct 129 QHWHTDS----PHVARDHL------------PAHAINVMVALHDIPLAMGPTECALGSHF 172 Query 88 WG----------------------DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 ++ V D E E P + + GS ++ D R +HRG Sbjct 173 LSNHLSNPSLVLNELIYQHEGTTPEILVGDTETEIP-EACAQAMAAGSCLIFDDRLLHRG 231 Query 126 TVNLSNRTRSMLMLIYGRSWWHDRTNY 152 N SN+ R + Y ++ + + T++ Sbjct 232 LGNQSNKPRHVAYFAYRKNGYTENTHF 258 >ref|XP_384382.1| Gene info hypothetical protein FG04206.1 [Gibberella zeae PH-1] Length=299 GENE ID: 2785543 FG04206.1 | hypothetical protein [Gibberella zeae PH-1] Score = 47.8 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 22/109 (20%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH-------------------MWGDVWVDDEEAEA 100 P A+ + IPL T +NG+TE LG+H + ++ +E Sbjct 139 PFALVINIPLVTTTPENGSTEIWLGTHNGYGLDTQEGAHGERASGRIREELLRQRKEVSP 198 Query 101 PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 P+R ++ +GS I+ D R H G NL+ +TR ML +I+ W+ +R Sbjct 199 PIRP---IIKKGSIIVRDLRLWHAGMPNLTQQTRVMLAMIHFAPWYRNR 244 >ref|ZP_01627852.1| hypothetical protein MGP2080_02500 [marine gamma proteobacterium HTCC2080] gb|EAW39460.1| hypothetical protein MGP2080_02500 [marine gamma proteobacterium HTCC2080] Length=288 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 I+V L TE+NGAT GSH+ G D E+ P +PRGS ++ T+ Sbjct 161 ISVLWALDDFTEENGATRVIPGSHLSGPHPDDAEQTSYPAE-----MPRGSMVVYLGSTL 215 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N S++ R L+ Y W N Sbjct 216 HGGGANRSDKPRRALVNTYALGWLRQEEN 244 >ref|XP_001257330.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW15433.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=304 GENE ID: 4583844 NFIA_047690 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 16/105 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD 104 P A V +PL +T +NG+TE LG+H M GD + +D+ E +R Sbjct 149 PFAYVVNVPLIEMTPENGSTEIWLGTHINSGLHVQEGMHGDRASGRIKLDELEKRRAVRP 208 Query 105 H-SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 ++P+G+ +L D R H G N +++ R ML +I+ W+ + Sbjct 209 PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMIHFAPWYRN 253 >ref|ZP_00112501.1| hypothetical protein Npun02000257 [Nostoc punctiforme PCC 73102] Length=277 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 6/129 (4%) Query 19 DSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGA 78 D P Q HRD LF R + D P +A+ V PL +T +NG Sbjct 110 DVPFQGSDYQEIHRDFRPLFSDGLRPAVGD------RIVTPLYALAVNFPLVEVTAENGP 163 Query 79 TEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLM 138 + G+H+ + A + SF + G ++ +HRG+ N +N+ R M++ Sbjct 164 FQMARGTHVLPREEGLKKVASGEIPMESFYMQPGDVMVRSPLALHRGSPNRTNQPRPMVV 223 Query 139 LIYGRSWWH 147 + Y W H Sbjct 224 MGYAMHWLH 232 >dbj|BAD20765.1| hypothetical protein [Streptomyces kanamyceticus] emb|CAE46944.1| hypothetical protein [Streptomyces kanamyceticus] emb|CAF31594.2| putative kanamycin biosynthetic protein [Streptomyces kanamyceticus] Length=285 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 16/101 (15%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEA-------------EAPLRDH 105 PP+ + V +PL T +NG+TE+ GSH+ DE P+R Sbjct 145 PPYCLCVDVPLIDFTLENGSTEYWPGSHVLNPDECYDERGCVLPAELERRRAVAPPVR-- 202 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 F +P GS ++ D R HRG NLS R +L + + W+ Sbjct 203 -FPIPVGSVVIRDGRLWHRGVPNLSAAPRPLLAMTHYTEWF 242 >ref|XP_001549420.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10] gb|EDN33467.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10] Length=311 GENE ID: 5429904 BC1G_12148 | hypothetical protein [Botryotinia fuckeliana B05.10] Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 25/87 (28%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVD 118 P + T DNGAT GSH+W D + E P+ ++P GS + Sbjct 160 PLIGTGTMVSFDDFTADNGATTVIPGSHLWSDERIPTREEMIPV-----IMPAGSMVYFL 214 Query 119 YRTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N SN+ R + + Y + W Sbjct 215 NTLWHSGGANTSNKARRSITVQYCQPW 241 >ref|XP_001418352.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96645.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=566 GENE ID: 5002231 OSTLU_92828 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 39/123 (31%), Positives = 53/123 (43%), Gaps = 16/123 (13%) Query 40 PDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGD--VWVDDEE 97 P+ FH R G F NVFI + +G T F GSH W +V E Sbjct 439 PEQHFH---ADGRVFGIF------NVFINTAKVETIDGPTAFIHGSHEWDHDACYVSTPE 489 Query 98 ----AEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYG 153 A AP L P GS ++ DYR +H+G N S R RS+ +++ D N+ Sbjct 490 RKAQALAPRTQPELLFP-GSVLIYDYRVMHKGGANDSARRRSLAYVMFCSRRARDSWNFP 548 Query 154 TED 156 +D Sbjct 549 LDD 551 >ref|XP_001208474.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] gb|EAU37866.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] Length=294 GENE ID: 4315665 ATEG_01109 | conserved hypothetical protein [Aspergillus terreus NIH2624] Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 13/100 (13%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFL----------- 108 P A V I L + +NGATE LGSH+ D V D + L Sbjct 148 PFAFCVNINLVDTSPENGATEVWLGSHIDTDQSVLDHSVKHKQVKADLLEARRKISPGIQ 207 Query 109 --LPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LP+GS ++ D+R H G N ++ R ML+ I +W+ Sbjct 208 PGLPKGSLVIRDFRLWHAGMPNQTDDPRVMLVTIQFANWY 247 >ref|YP_001414577.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS64920.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=274 GENE ID: 5453899 Plav_3316 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 30/86 (34%), Positives = 39/86 (45%), Gaps = 11/86 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWG----DVWVDDEEAEAPLRDHSFLLPRGSFI 115 P AIN L T +NGAT GSH D VD + + P P GSFI Sbjct 143 PLAINALFCLDDFTTENGATYVLPGSHKQSAYPSDATVDALKVQIPA-------PAGSFI 195 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++D H G VN ++R R + +Y Sbjct 196 ILDCMLYHSGGVNRTDRERRAVNHVY 221 >ref|XP_001396026.1| Gene info hypothetical protein An12g09750 [Aspergillus niger] emb|CAL00879.1| Gene info unnamed protein product [Aspergillus niger] Length=338 GENE ID: 4986328 An12g09750 | hypothetical protein [Aspergillus niger CBS 513.88] (10 or fewer PubMed links)  Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 17/107 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHM----------------WGDVWVDDEEAEAPLR 103 P A + +PL +T +NG+TE LG+H G + V + E +R Sbjct 182 PFAYVINVPLVTMTPENGSTEIWLGTHADSGLHLQEGAHGADRASGRIKVQELEKRRAVR 241 Query 104 -DHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 ++P+GS ++ D R H G N + R ML +I+ W+ +R Sbjct 242 MPCQSVVPKGSLVIRDLRLWHAGMGNWTGNVRVMLAMIHFAPWYRNR 288 >ref|XP_731501.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293] gb|EAL84211.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293] Length=152 GENE ID: 3503644 AFUA_6G00540 | conserved hypothetical protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 16/107 (14%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD 104 P A + IPL +T +NG+TE LG+H M GD + +D+ E +R Sbjct 26 PFAYVINIPLIEMTPENGSTEIWLGTHIDSGLHIQEGMHGDRASGRIKLDELEKRRAVRP 85 Query 105 H-SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRT 150 ++P+G+ +L D R H G N +++ R ML +I G H +T Sbjct 86 PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMINGLEGEHFQT 132 >ref|XP_001227983.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51] gb|EAQ83652.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51] Length=251 GENE ID: 4396037 CHGG_10056 | hypothetical protein [Chaetomium globosum CBS 148.51] Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 5/90 (5%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT 121 I + + T NGAT GSH+WGD + E A L RG +L T Sbjct 113 GIGMLVAAVDTTYANGATLVVPGSHLWGDARIAQEHEVAAAE-----LSRGEALLFLTST 167 Query 122 VHRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 +H G N + R+M + Y RSW N Sbjct 168 LHAGGANTTPDPRTMYAIFYCRSWVRPEAN 197 >ref|XP_001558610.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10] gb|EDN33003.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10] Length=384 GENE ID: 5439200 BC1G_02681 | hypothetical protein [Botryotinia fuckeliana B05.10] Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 12/101 (11%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P I +F+ L ++ NG+TE GSH ++ + ++ +F Sbjct 149 PTCIELFMYLHEVSPTNGSTEIWPGSHHEWNLGNHESHGRGWVKASAFNRRAEHSPPFQP 208 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 +P+GS + D R H G NLS++ R ML IY W+ + Sbjct 209 TIPKGSIAIRDLRLWHAGMPNLSDQNRIMLGFIYFPRWYRN 249 >dbj|BAE66236.1| unnamed protein product [Aspergillus oryzae] Length=325 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 37/153 (24%) Query 15 SGASDSPATAR---VAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQH 71 SG S P TA ++Q H DA P P A V +PL Sbjct 140 SGNSAMPPTAENPPMSQPVHSDADFAHPTH------------------PFAYVVNVPLIT 181 Query 72 LTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF------------LLPRGSFI 115 +T +NG+TE LG+H + V + E A ++ + ++P+G+ + Sbjct 182 MTPENGSTEVWLGTHTDSGLHVQEGMHGERASGRIQLSALEKQRMIRPPCQPVVPKGALV 241 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 L D R H G N ++ R ML +I+ W+ + Sbjct 242 LRDLRLWHAGIGNQTDDVRVMLAMIHFAPWYRN 274 >gb|EAT83717.1| hypothetical protein SNOG_08549 [Phaeosphaeria nodorum SN15] Length=313 Score = 43.1 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 20/108 (18%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAE----APLRDHSFLL------ 109 P A+ V +PL + +NG+TE LG+H + D+E E A R S +L Sbjct 151 PFALVVNVPLVKMEVENGSTEIWLGTH--NGTTIADQEGEHGDRASGRIKSHILEARREV 208 Query 110 --------PRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 +GS I+ D R H G NLS+ R ML I+ W+ ++ Sbjct 209 RPPTQPTVKKGSIIIRDLRLWHGGKPNLSSVPRVMLAFIHFAPWYRNQ 256 >ref|YP_629546.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] gb|ABF88170.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] Length=395 GENE ID: 4102795 MXAN_1289 | phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] (10 or fewer PubMed links)  Score = 43.1 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 47/171 (27%), Positives = 76/171 (44%), Gaps = 20/171 (11%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHM-----------WGDVWVDDEEAEAPLR---DHSF 107 +I + IPL +T DNG E G+H G +D+ ++ +R Sbjct 165 SIAINIPLVDVTPDNGPMEVWPGTHQPPSEGRLAPFTTGAHRIDEPTLKSLVRRIPSRKL 224 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARR 167 ++ RG+ ++ D+R VHRGT NL++ R ML L + ++ Y G L+ + R Sbjct 225 VMRRGAVLIRDHRMVHRGTPNLADAPRYMLSLYCIAA---EQVPYRLLSDAGATLALSLR 281 Query 168 DDGAGGGPEAAIQRRVLRALTVSEVGPSGEVCDLGTDEHDLWLRERMWWGL 218 G G G AA++ R L L + +G E C L ++ +W L Sbjct 282 RMGRGSG--AAVRHRRLFDLG-AVLGRVVEECSLSDRDYRRTFSAELWASL 329 >ref|YP_459107.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594] gb|ABC64310.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594] Length=293 GENE ID: 3869292 ELI_11090 | hypothetical protein [Erythrobacter litoralis HTCC2594] Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 38/139 (27%), Positives = 51/139 (36%), Gaps = 40/139 (28%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ WH D S P R PP +++ F L T +NGATE GSH Sbjct 125 AQPWHFDDSHCDLPRPR---------------PPLSLSTFWSLTETTAENGATEIIPGSH 169 Query 87 MWGDVWVDDEEAEAPLRDHSFL--------------------LPRGSFILVDYRTVHRGT 126 +WG DE E FL +P GS ++ HRG Sbjct 170 LWG-----DERPEGASGPDDFLTGKTDKAGGAGTHPDAIKATMPPGSLMIAKGTLWHRGG 224 Query 127 VNLSNRTRSMLMLIYGRSW 145 N S+ R ++ + + W Sbjct 225 ANTSHDRRLIVTPQFCKGW 243 >ref|XP_001593774.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980] gb|EDO02725.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980] Length=322 GENE ID: 5489739 SS1G_05202 | hypothetical protein [Sclerotinia sclerotiorum 1980] Score = 43.1 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 30/122 (24%), Positives = 46/122 (37%), Gaps = 20/122 (16%) Query 24 ARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTL 83 + AQ H D L+ P R P + + T +NGAT Sbjct 151 GQTAQSIHCDDGLIALPRPR---------------PLIGVGTMVSFDDFTAENGATSVIP 195 Query 84 GSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGR 143 GSH+W D + E P+ ++P GS + H G N S++ R + + Y + Sbjct 196 GSHLWSDDRIPTREEMIPV-----IMPAGSMVYFLNTLWHSGGANTSDKPRRSITVQYCQ 250 Query 144 SW 145 W Sbjct 251 PW 252 >ref|XP_001265897.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW24000.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=318 GENE ID: 4593154 NFIA_035680 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 42.0 bits (97), Expect = 0.023, Method: Composition-based stats. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P V + L T NGATE G+H DV V + + +R Sbjct 173 PFGFCVNVNLVETTTTNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP 232 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LLP+GS I+ D+R H G N ++ R ML+ + W+ Sbjct 233 LLPKGSIIIRDFRLWHAGMPNQTDEPRVMLVTVLFARWY 271 >ref|ZP_01618410.1| hypothetical protein GP2143_06913 [marine gamma proteobacterium HTCC2143] gb|EAW29758.1| hypothetical protein GP2143_06913 [marine gamma proteobacterium HTCC2143] Length=279 Score = 42.0 bits (97), Expect = 0.025, Method: Composition-based stats. Identities = 31/107 (28%), Positives = 46/107 (42%), Gaps = 14/107 (13%) Query 44 FHLTDVHTRASGAFLPPH-----AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEA 98 FH+ D GA + P ++ L T NGATE GSH+W D D E Sbjct 130 FHVDD----NEGAMVLPKPRVALGVSAIWALDDFTTTNGATEVVPGSHLWAD---DREPQ 182 Query 99 EAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + + ++P GS ++ +HRG N+S +R + Y W Sbjct 183 QHEI--EQVIMPAGSALVFAGSLIHRGGANVSASSRLAVTPQYCMPW 227 >ref|XP_749468.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL87430.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=318 GENE ID: 3506925 AFUA_2G03330 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 41.6 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P V + L T NGATE G+H DV V + + +R Sbjct 173 PFGFCVNVNLVGTTATNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP 232 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LLP+GS I+ D+R H G N ++ R ML+ + W+ Sbjct 233 LLPKGSIIIRDFRLWHAGMPNRTDEPRVMLVTVLFARWY 271 >ref|XP_001216755.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] gb|EAU31307.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] Length=363 GENE ID: 4353480 ATEG_08134 | conserved hypothetical protein [Aspergillus terreus NIH2624] Score = 41.2 bits (95), Expect = 0.042, Method: Composition-based stats. Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 16/105 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A + +PL +T +NG+TE LG+H + V + E A ++ Sbjct 208 PFAYVINVPLITMTPENGSTEVWLGTHTDTGLHVQEGLHGERASGRIKLEELEKRRAVRA 267 Query 108 ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 +P+GS ++ D R H G N + R ML +I+ SW+ + Sbjct 268 PCQPTVPKGSIVIRDLRLWHAGIGNQTEIPRVMLAMIHFASWYRN 312 >ref|XP_367927.2| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15] gb|EDJ97281.1| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15] Length=330 GENE ID: 2683758 MGG_07831 | hypothetical protein [Magnaporthe grisea 70-15] (10 or fewer PubMed links)  Score = 40.8 bits (94), Expect = 0.054, Method: Composition-based stats. Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 17/106 (16%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A+ V +PL +T NG+TE LG+H D+ + E A +R Sbjct 156 PFALVVNVPLVTMTPHNGSTELWLGTHHLSDLSAQEGAHGERASGRIRQRLLDARRSTRG 215 Query 108 ----LLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHD 148 ++ +GS ++ D R H G NLS + R ML I+ W+ + Sbjct 216 PCQPVVKKGSVVVRDLRLWHAGMPNLSRDEVRVMLAFIHFAPWYRN 261 >ref|XP_001161510.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 1 [Pan troglodytes] Length=277 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 40.4 bits (93), Expect = 0.071, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >ref|XP_001161929.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 6 [Pan troglodytes] ref|XP_001161970.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 7 [Pan troglodytes] ref|XP_001162007.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 8 [Pan troglodytes] Length=291 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 40.4 bits (93), Expect = 0.072, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >ref|NP_001094346.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform a [Homo sapiens] pdb|2OPW|A Related structures Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 (Apo) gb|AAH53853.1| UniGene infoGene info PHYHD1 protein [Homo sapiens] emb|CAI10842.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] gb|EAW87844.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_a [Homo sapiens] Length=291 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 40.4 bits (93), Expect = 0.072, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >emb|CAI10841.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] Length=255 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 40.4 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|XP_682496.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4] gb|EAA61518.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4] Length=416 GENE ID: 2868057 AN9227.2 | hypothetical protein [Aspergillus nidulans FGSC A4] (10 or fewer PubMed links)  Score = 40.0 bits (92), Expect = 0.092, Method: Composition-based stats. Identities = 39/136 (28%), Positives = 55/136 (40%), Gaps = 28/136 (20%) Query 16 GASDSPATARVAQHWHRDASLLFP------PDARFHLTDVHTRASGAFLPPHAINVFIPL 69 GA A + AQ HRD P PDA P +IN + L Sbjct 227 GAVMELAPSNPAQPLHRDMRFSHPIVEYLKPDA----------------PATSINFLVAL 270 Query 70 QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNL 129 T +NGAT LGSH W + + + +A +R L+ G +L+ T+H G Sbjct 271 SPFTAENGATHVILGSHKWQN--LSNVSMDATVRA---LMNPGDALLITDSTIHCGGAET 325 Query 130 S-NRTRSMLMLIYGRS 144 + TR +L + G S Sbjct 326 TGTETRRLLTITMGIS 341 >ref|XP_001161891.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 5 [Pan troglodytes] Length=270 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 40.0 bits (92), Expect = 0.097, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|NP_001094347.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform c [Homo sapiens] gb|AAH51300.1| UniGene infoGene info PHYHD1 protein [Homo sapiens] gb|EAW87847.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_d [Homo sapiens] Length=270 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 40.0 bits (92), Expect = 0.097, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|ZP_01616112.1| hypothetical protein GP2143_18106 [marine gamma proteobacterium HTCC2143] gb|EAW33195.1| hypothetical protein GP2143_18106 [marine gamma proteobacterium HTCC2143] Length=346 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 35/113 (30%), Positives = 46/113 (40%), Gaps = 25/113 (22%) Query 47 TDVHTRASGAFLPPHAINVF--IPLQHLTEDNGATEFTLGSH------MWGDVWVDDEEA 98 T+ +A+G PP+ V + L +TE GATE GSH WG + Sbjct 141 TEQAAKAAGQSWPPNTTTVSCSLALSEITEALGATEIYPGSHRETAVTTWG-------KG 193 Query 99 EAPL----------RDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 E P+ + S +P G D R HRG N SN R M+ L Y Sbjct 194 EQPVHHPEIVKNWGQPASMTIPAGGVCFRDPRMWHRGVKNSSNTPRPMIALTY 246 >ref|ZP_00419196.1| Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP] gb|EAM04358.1| Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP] Length=261 Score = 39.7 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 23/129 (17%) Query 15 SGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTE 74 S + PA A WHRD + + F D T I + +PLQ ++ Sbjct 126 SNITRKPAGIGPAIGWHRDCT-----NTYFASDDERT-----------IRMLLPLQEMSS 169 Query 75 DNGATEFTLGSHMWGDVWVDDEEAE-APLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRT 133 NG T GSH+ + D A P ++ GS +++D + +H GT N S Sbjct 170 RNGGTAVLSGSHLHMESTPQDLSAAICP------VVSPGSALVIDSKVLHGGTPNRSELD 223 Query 134 RSMLMLIYG 142 R +++L +G Sbjct 224 RDVIILQFG 232 >ref|ZP_01721295.1| hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1] gb|EAZ79312.1| hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1] Length=245 Score = 39.3 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Query 69 LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH----SFLLPRGSFILVDYRTVHR 124 L TE+NGAT SH W + + DE PL H + P GS + + H Sbjct 138 LDDFTENNGATRIVPSSHKWSE--LPDEALINPLDKHPKEIKIIAPAGSVFIFNSHVWHG 195 Query 125 GTVNLSNRTR 134 GT+N +++ R Sbjct 196 GTMNETSKIR 205 >ref|XP_001392916.1| Gene info hypothetical protein An08g08010 [Aspergillus niger] emb|CAK45692.1| Gene info unnamed protein product [Aspergillus niger] Length=292 GENE ID: 4983120 An08g08010 | hypothetical protein [Aspergillus niger CBS 513.88] (10 or fewer PubMed links)  Score = 38.9 bits (89), Expect = 0.21, Method: Composition-based stats. Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 9/96 (9%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD------EEAEAPLRDHSFL---LP 110 P + + I L + +NGATE GSH D D E EA R + LP Sbjct 150 PFGLCININLVATSPENGATELWPGSHRDADPRDSDDTGVIPEIVEARRRVSPPVQPSLP 209 Query 111 RGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 +G+ I+ D+R H G N ++ R ML+ I+ +W+ Sbjct 210 KGAIIIRDFRLWHAGMPNRTDDPRVMLVTIHFPAWY 245 >ref|XP_572755.1| Gene info hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] gb|AAW45448.1| Gene info expressed protein [Cryptococcus neoformans var. neoformans JEC21] Length=327 GENE ID: 3259545 CNI00020 | hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] (10 or fewer PubMed links)  Score = 38.9 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 36/149 (24%), Positives = 56/149 (37%), Gaps = 34/149 (22%) Query 17 ASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDN 76 +++S A V Q H DA P P A V + L + N Sbjct 150 SANSAVKAEVGQPVHSDADFSHPS------------------IPFAAVVNVGLVDMNPKN 191 Query 77 GATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF------------LLPRGSFILVDYR 120 G+T+ LG+H D+ + E A ++ +P+GS I+ D R Sbjct 192 GSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISPPLQPTIPKGSLIIRDLR 251 Query 121 TVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 H G N ++ R ML +I+ W+ R Sbjct 252 LWHAGMPNTTDEIRIMLAMIHFAPWYRQR 280 >ref|XP_774078.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans B-3501A] gb|EAL19431.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans B-3501A] Length=327 GENE ID: 4937528 CNBH0030 | hypothetical protein [Cryptococcus neoformans var. neoformans B-3501A] Score = 38.9 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 36/149 (24%), Positives = 56/149 (37%), Gaps = 34/149 (22%) Query 17 ASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDN 76 +++S A V Q H DA P P A V + L + N Sbjct 150 SANSAVKAEVGQPVHSDADFSHPS------------------IPFAAVVNVGLVDMNPKN 191 Query 77 GATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF------------LLPRGSFILVDYR 120 G+T+ LG+H D+ + E A ++ +P+GS I+ D R Sbjct 192 GSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISPPLQPTIPKGSLIIRDLR 251 Query 121 TVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 H G N ++ R ML +I+ W+ R Sbjct 252 LWHAGMPNTTDEIRIMLAMIHFAPWYRQR 280 >dbj|BAE65945.1| unnamed protein product [Aspergillus oryzae] Length=276 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 7/122 (5%) Query 47 TDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS 106 +D+ + +L +NV L + +NGAT + GSH W E EA Sbjct 122 SDLSLQCPDPWLSTWGLNVIWCLHDVYYENGATLYIPGSHHWKTKAEVPPEEEARKLLVP 181 Query 107 FLLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA 165 F GS I++D R H N++ ++ R++L Y + + N+ GVGLSE Sbjct 182 FEAKAGSIIVMDGRLWHTSGCNVTQDKERALLFGAYNAPFLRGQVNW------GVGLSEE 235 Query 166 RR 167 + Sbjct 236 TK 237 >ref|XP_360888.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15] gb|EDJ94682.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15] Length=432 GENE ID: 2676529 MGG_03431 | hypothetical protein [Magnaporthe grisea 70-15] (10 or fewer PubMed links)  Score = 38.5 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 3/92 (3%) Query 61 HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYR 120 + +N+ L +T++ GAT GSH+ V EE A + P GS +L+D R Sbjct 290 YVLNMMWYLTDVTDEKGATRIYPGSHV---EHVIPEEMNAVGKSIPAAAPAGSCVLLDSR 346 Query 121 TVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 T H VN + TR +++ + R + NY Sbjct 347 TWHSTGVNTTEETRPVILQSFCRFFVRQIENY 378 >ref|ZP_01501800.1| Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815] gb|EAU98489.1| Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815] Length=277 Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 38/155 (24%), Positives = 60/155 (38%), Gaps = 24/155 (15%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 L ++G + P WHRD S H T T A N + + Sbjct 113 LMQQNGIINRPDRQNYQVKWHRDLSYQ-------HWTSSKTIA---------FNALLCVD 156 Query 71 HLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH--SFLLPRGSFILVDYRTVHRGTVN 128 T NGA+ +H ++ + +R H P GSFI++D HRG +N Sbjct 157 EFTLKNGASFVLPATHH-----IEAFPTDRFVRQHERQIAAPAGSFIVLDAMLYHRGGIN 211 Query 129 LSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLS 163 +SN R + + G + + N+ T + G+S Sbjct 212 VSNDVRRAVNHLIGLPFLAQQVNFET-GFASTGMS 245 >ref|NP_001069711.1| UniGene infoGene info hypothetical protein LOC540828 [Bos taurus] gb|AAI22728.1| UniGene infoGene info Similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos taurus] Length=291 GENE ID: 540828 MGC152146 | similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos taurus] Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 21/120 (17%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWG-----------DVWVDDE 96 H AS + P + ++I L+ +NG F GSH G V Sbjct 156 HQDASFLYTEPLGRVLGLWIALEDAMLENGCLWFIPGSHTGGVSRRMVRTPAGSVPGTSF 215 Query 97 EAEAPLRDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSWWHD 148 P+RD+S +P RG+ +L+ VH+ NLS+R+R LM G W D Sbjct 216 LGSEPIRDNSLFVPTPVLRGALVLIHGEVVHKSEQNLSDRSRQAYTFHLMEAAGTIWSPD 275 >ref|ZP_01867932.1| Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1] gb|EDL53417.1| Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1] Length=252 Score = 37.4 bits (85), Expect = 0.60, Method: Composition-based stats. Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Query 61 HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-EEAEAPLRDHSFL-LPRGSFILVD 118 H +N L L DNGA G+H+ ++ D E+ EA D +L P GS ++ + Sbjct 137 HLVNSIWALDDLCRDNGAPRIIPGTHLRPELPEDVLEDTEATHPDEVYLECPAGSIMIFN 196 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 T H GTVN R +L +Y Sbjct 197 AHTWHGGTVNTLGTRRRVLHGLY 219 >ref|XP_953820.1| Gene info hypothetical protein TA06590 [Theileria annulata strain Ankara] emb|CAI73142.1| Gene info hypothetical protein [Theileria annulata] Length=502 GENE ID: 3863425 TA06590 | hypothetical protein [Theileria annulata strain Ankara] (10 or fewer PubMed links)  Score = 37.4 bits (85), Expect = 0.61, Method: Composition-based stats. Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 23/89 (25%) Query 62 AINVFIPLQHLTEDNGATEFTLGSH---------MWGDVWVDDEEAEAPLRDHSFLLPRG 112 IN+ +PLQ + NG +F G+H G V VD L G Sbjct 380 GINIVVPLQDTNKVNGRMQFLPGTHNEPSRLNPYTCGPVGVD--------------LNEG 425 Query 113 SFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ + +HR T+N SN +SM++ Y Sbjct 426 DVLIYNSSVLHRNTINESNVCQSMVVFTY 454 >ref|XP_664422.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4] gb|EAA58217.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4] Length=271 GENE ID: 2870496 AN6818.2 | hypothetical protein [Aspergillus nidulans FGSC A4] (10 or fewer PubMed links)  Score = 37.4 bits (85), Expect = 0.68, Method: Composition-based stats. Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 11/98 (11%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP----RGSFI 115 P A+N+ L + +NGAT + GSH W + E P L P GS I Sbjct 137 PWAVNIIWCLSDVYFENGATLYIPGSHRW------KRKNEVPSNAVEMLKPFVAKAGSII 190 Query 116 LVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY 152 +D R H N++ ++ R++L Y + + N+ Sbjct 191 AMDARVWHTSGANITKDQDRALLFAFYSAPFLRQQVNW 228 >ref|XP_001536248.1| Gene info predicted protein [Ajellomyces capsulatus NAm1] gb|EDN05262.1| Gene info predicted protein [Ajellomyces capsulatus NAm1] Length=221 GENE ID: 5442548 HCAG_08912 | predicted protein [Ajellomyces capsulatus NAm1] Score = 37.0 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 10/87 (11%) Query 60 PHAI-----NVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSF 114 PHA+ + T DNGAT GSH+WG + E P+ + P+GS Sbjct 96 PHAVGECDNSGLKAFDEFTADNGATRVVTGSHLWGADRRPECEESTPM-----VCPQGSV 150 Query 115 ILVDYRTVHRGTVNLSNRTRSMLMLIY 141 + T H G N S R L + Y Sbjct 151 VYFLATTWHCGGPNNSPNPRKSLTVQY 177 >ref|XP_001610743.1| Gene info conserved hypothetical protein [Babesia bovis] gb|EDO07175.1| Gene info conserved hypothetical protein [Babesia bovis] Length=1596 GENE ID: 5478977 BBOV_IV008210 | conserved hypothetical protein [Babesia bovis] Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 23/89 (25%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHM---------WGDVWVDDEEAEAPLRDHSFLLPRG 112 + V + L + E+NG +F G+H +G V VD L +G Sbjct 1483 GVTVVLALDCVEENNGRIQFLPGTHKTQPEINPYKFGKVGVD--------------LNKG 1528 Query 113 SFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ D R +HR T+N SN+ S L+ Y Sbjct 1529 DVLIFDSRVLHRNTINESNKCCSCLVFSY 1557 >ref|XP_001267631.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW25734.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=297 GENE ID: 4594309 NFIA_045530 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 37.0 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDV 91 PP AI+ + L T+DNG T LGSH W ++ Sbjct 149 PPLAISFILALTDFTKDNGGTRVILGSHKWPEI 181 >emb|CAD18985.1| putative oxigenase [Streptomyces cattleya] Length=259 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 7/92 (7%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDV-WVDDEEAEAPLRDHS------FLLPR 111 PP AI V++ L T +NG + LGSH G V V EE + + + P Sbjct 145 PPEAITVWMALDDATVENGCVHYVLGSHRHGRVEHVRPEEGAVMIEARTEQEPVAYPAPA 204 Query 112 GSFILVDYRTVHRGTVNLSNRTRSMLMLIYGR 143 G ++ T+H NLS+ R +++Y R Sbjct 205 GDALVHSVNTLHGSGPNLSDGPRRAYVVVYVR 236 >gb|AAR37958.1| conserved hypothetical protein [uncultured marine bacterium 561] Length=295 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 44/174 (25%), Positives = 69/174 (39%), Gaps = 37/174 (21%) Query 5 SHAIHALAGK----SGASDSPATARVAQHWHRDASLL--------FPPDAR--FHLTDVH 50 SH ++A+ K + P +A+H+ ++ LL P ++ +H D H Sbjct 76 SHRVYAMLAKNPIFAELVTHPLALTLAEHFLGESCLLSACLAIELMPGESAQPWHTDDGH 135 Query 51 TRASGAFLPPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEA 98 + PPH I+ F L T +NGATE SH+W + V D+ + Sbjct 136 V----SLKPPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDG 191 Query 99 EAPLRDH-------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 DH + L GS ++ HRG NLS +R ++ Y W Sbjct 192 VDEAADHECHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW 245 >ref|NP_962094.1| Gene info hypothetical protein MAP3160 [Mycobacterium avium subsp. paratuberculosis K-10] gb|AAS05708.1| Gene info hypothetical protein MAP_3160 [Mycobacterium avium subsp. paratuberculosis K-10] Length=277 GENE ID: 2721210 MAP3160 | hypothetical protein [Mycobacterium avium subsp. paratuberculosis K-10] (10 or fewer PubMed links)  Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P A + T DNGAT GSH WG ++ P+ ++P GS +L Sbjct 143 PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPAGSCVLFVG 197 Query 120 RTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N ++R R + Y + W Sbjct 198 TLWHGGGANTTDRDRLAVTAQYCQPW 223 >ref|XP_313252.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST] gb|EAA08759.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST] Length=287 GENE ID: 1274172 AgaP_AGAP003514 | AGAP003514-PA [Anopheles gambiae str. PEST] (10 or fewer PubMed links)  Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 16/92 (17%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEEA----------EAPLRDHS 106 P I +IPL+ T NG F GSH G W+ + + APL S Sbjct 160 PSTTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRWIRNPDKGADELLVYDRPAPLYPQS 219 Query 107 FLLP----RGSFILVDYRTVHRGTVNLSNRTR 134 + GS +L+ + VHR N S+R+R Sbjct 220 NFVAVPVKAGSCVLIHSQAVHRSDANKSDRSR 251 >ref|ZP_01626096.1| hypothetical protein MGP2080_09703 [marine gamma proteobacterium HTCC2080] gb|EAW41112.1| hypothetical protein MGP2080_09703 [marine gamma proteobacterium HTCC2080] Length=279 Score = 35.8 bits (81), Expect = 1.7, Method: Composition-based stats. Identities = 34/121 (28%), Positives = 48/121 (39%), Gaps = 23/121 (19%) Query 44 FHLTDVHTRASGAFLPPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------V 91 +H D H + PPH I+ F L T +NGATE SH+W + V Sbjct 113 WHTDDGHV----SLKPPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAV 168 Query 92 WVDDEEAEAPLRDH-------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 D+ + DH + L GS ++ HRG NLS +R ++ Y Sbjct 169 DFDNTDGVDEAADHECHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAG 228 Query 145 W 145 W Sbjct 229 W 229 >ref|XP_001224329.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51] gb|EAQ88496.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51] Length=613 GENE ID: 4392423 CHGG_05115 | hypothetical protein [Chaetomium globosum CBS 148.51] Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 5/93 (5%) Query 54 SGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGS 113 SG P ++N + L T++NGAT GSH W D+ ++ P + G Sbjct 472 SGPDAPEASVNFVVALTEFTDENGATRVIPGSHRWQDL----QQNGTPEDTIPAEMEVGD 527 Query 114 FILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSW 145 + + VH G N + + TR + L++ S+ Sbjct 528 ACFITGKVVHGGGANRTKDFTRRAITLVFQCSY 560 >ref|ZP_01749022.1| hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2] gb|EBA13005.1| hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2] Length=215 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Query 65 VFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAP-LRDHSFLLPRGSFILVDYRTVH 123 V + L +E++GA E LGSH G V D +A A H RG +++D T+H Sbjct 125 VRVHLDDTSEEDGAMEIALGSHRDGKVMADQSQAVADRYPKHVCPAQRGDILILDMLTLH 184 Query 124 RGTVNLSNRTRSMLMLIYG 142 R TR L + Y Sbjct 185 RSLPATVPSTRRTLRIDYA 203 >ref|YP_001339697.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] gb|ABR69762.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] Length=267 GENE ID: 5365525 Mmwyl1_0830 | Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 30/132 (22%), Positives = 57/132 (43%), Gaps = 27/132 (20%) Query 30 WHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH--- 86 WHRD P F V +R P A+N + T DNG+T+ GSH Sbjct 125 WHRDL-----PYQHF----VTSR-------PIALNALYCVCDFTFDNGSTQVLPGSHKIE 168 Query 87 -MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 G+ ++++ + + F + G ++L+D H G++N ++ R + +Y Sbjct 169 KFPGNKFLEENKMQ-------FYVSSGDYLLIDSMLYHSGSINKTSDRRIGINNVYSTPI 221 Query 146 WHDRTNYGTEDY 157 + ++ + D+ Sbjct 222 IRRQIDFNSSDF 233 >ref|YP_883146.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] gb|ABK69454.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] Length=287 GENE ID: 4527072 MAV_3990 | phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P A + T DNGAT GSH WG ++ P+ ++P GS +L Sbjct 153 PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPVGSCVLFVG 207 Query 120 RTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N ++R R + Y + W Sbjct 208 TLWHGGGANTTDRDRLAVTAQYCQPW 233 >ref|YP_366487.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] gb|ABB05843.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] Length=291 GENE ID: 3733825 Bcep18194_C6796 | Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 31/108 (28%), Positives = 43/108 (39%), Gaps = 13/108 (12%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD FPP A G P N+ I L TE+NGAT GS Sbjct 131 AQMLHRDVGN-FPPLC----------ALGINGPTVFTNLMIALTRFTEENGATRIIPGSQ 179 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR 134 W + + D + P + + G +L + +H G N++ R Sbjct 180 NWDEDYFDSK--GTPDMTIAAEMDAGDALLFSGKVIHGGGANVTQNER 225 >ref|XP_001657669.1| Gene info conserved hypothetical protein [Aedes aegypti] gb|EAT48860.1| Gene info conserved hypothetical protein [Aedes aegypti] Length=286 GENE ID: 5567769 AaeL_AAEL000102 | conserved hypothetical protein [Aedes aegypti] (10 or fewer PubMed links)  Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 20/94 (21%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--------------DVWVDDEEAEAPLRD 104 P I +IPL+ T NG F GSH G ++ + D APL Sbjct 159 PSSTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRYIRNPDKSSPELLIYDR--PAPLYP 216 Query 105 HSFL----LPRGSFILVDYRTVHRGTVNLSNRTR 134 S + GS +L+ + VHR N S+R+R Sbjct 217 QSNFCAAPVKAGSLVLIHSQVVHRSDANRSDRSR 250 >ref|XP_001417798.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96091.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=280 GENE ID: 5002111 OSTLU_87319 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH--MWGDVWVDDEEAEAPLRDHSF---LLPRGSF 114 P F+ LQ + D G T F G++ + + E E P+ + ++ RG Sbjct 164 PSVFTCFVALQDVERDMGPTLFIPGTNNAQAHVEFREGNEREGPVFRRPYELGVISRGDA 223 Query 115 ILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 L D RT+H GT N S+R R + + R+ Sbjct 224 TLFDSRTLHCGTENDSSRRRVLFYFSFQRA 253 >gb|ABC25279.1| phytanoyl-CoA dioxygenase (PhyH) family [uncultured marine bacterium Ant4E12] Length=287 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDE 96 ++ ++ L H+T D+GA EF GSH+W D+W E Sbjct 145 MSFWVALDHVTLDSGALEFIRGSHLW-DIWYQPE 177 >emb|CAL54074.1| unnamed protein product [Ostreococcus tauri] Length=330 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 21/98 (21%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRD-------------HS 106 P F+ LQ + D G T F G+ ++ +A A R+ Sbjct 213 PSVYTCFVALQDVDADMGPTLFIPGT--------NNAQAHAEFREGLERGGPVLQRPNEL 264 Query 107 FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 L+ RG L D RT+H GT N S+R R + + R+ Sbjct 265 GLISRGDATLFDSRTLHCGTENASSRRRVLFYFSFQRT 302 >ref|XP_001261676.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW19779.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=267 GENE ID: 4588607 NFIA_093990 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 3/95 (3%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT 121 A+NV L +TE+NGAT + GS+ W W +D AP F G +++D R Sbjct 127 AVNVIWCLTRMTEENGATLYIPGSNKW-TTW-EDVPDNAPDLLVPFEADAGDIVVIDGRL 184 Query 122 VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE 155 H N++ + R++L Y TN+ + Sbjct 185 WHTSGSNVTKDEDRAILFAYYSAPHMRPLTNWSAK 219 >ref|XP_646498.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum AX4] gb|EAL72707.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum AX4] Length=147 GENE ID: 3397778 DDBDRAFT_0201933 | hypothetical protein [Dictyostelium discoideum AX4] (10 or fewer PubMed links)  Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 57 FLPPHAINVFIPLQHLTEDNGATEFTLGSHMW 88 FLP I +++PL ++ +NG E+ GSH W Sbjct 39 FLPAETIAIWVPLNDVSIENGTLEYATGSHNW 70 >ref|XP_001657670.1| Gene info conserved hypothetical protein [Aedes aegypti] gb|EAT48861.1| Gene info conserved hypothetical protein [Aedes aegypti] Length=286 GENE ID: 5567769 AaeL_AAEL000102 | conserved hypothetical protein [Aedes aegypti] (10 or fewer PubMed links)  Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 20/94 (21%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--------------DVWVDDEEAEAPLRD 104 P I +IPL+ T NG F GSH G ++ + D APL Sbjct 159 PSSTIGFWIPLEDATLQNGCLYFIKGSHKSGVHRRYIRNPDKSSPELLIYDR--PAPLYP 216 Query 105 HSFL----LPRGSFILVDYRTVHRGTVNLSNRTR 134 S + GS +L+ + VHR N S+R+R Sbjct 217 QSNFCANPVKAGSLVLIHSQVVHRSDANRSDRSR 250 >ref|ZP_01854292.1| hypothetical protein PM8797T_31148 [Planctomyces maris DSM 8797] gb|EDL59736.1| hypothetical protein PM8797T_31148 [Planctomyces maris DSM 8797] Length=281 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 18/137 (13%) Query 29 HWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMW 88 +WH D +P +A H +A + H ++++ L T++NGAT GSH + Sbjct 116 YWHAD----WPYNAT---NTTHVKAPYPDVMMHLASIWM-LTPFTKENGATYILPGSHKF 167 Query 89 ------GDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYG 142 G + D++A P + P GS L D R H N S+ +R+ L++ Y Sbjct 168 DNNPAAGGMSDIDQDANHP-DELQATGPAGSVFLYDSRLWHAVAPNYSDESRAALIIRYA 226 Query 143 RSWWHDRTNY--GTEDY 157 WW + T GT D+ Sbjct 227 -PWWLNLTPTIRGTPDH 242 >ref|NP_822046.1| Gene info dioxygenase [Streptomyces avermitilis MA-4680] dbj|BAC68581.1| Gene info putative Fe(II)/alpha-ketoglutarate dependent hydroxylase [Streptomyces avermitilis MA-4680] Length=311 GENE ID: 1212549 SAV871 | dioxygenase [Streptomyces avermitilis MA-4680] (10 or fewer PubMed links)  Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 12/102 (11%) Query 54 SGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWG---DVWVDDEEAEAPLR-----DH 105 +G PP ++++I L +T DN F GSH +G ++ D E +H Sbjct 122 AGPVDPPQYLHLWIALDDVTNDNSGMVFYRGSHRFGLAPHIFHPDGLPEVQPELLERIEH 181 Query 106 SFL---LPRGSFILVDYRTVHRGTVNLSNRTR-SMLMLIYGR 143 + +P GS L D T+H N+++R R S+++ + GR Sbjct 182 MRVEPDIPAGSAALFDGGTIHGSKANITDRRRLSLVVAVRGR 223 >gb|AAK01519.1| hypothetical protein [Pseudomonas aeruginosa] gb|EAZ58108.1| hypothetical protein PA2G_01326 [Pseudomonas aeruginosa 2192] Length=309 Score = 34.7 bits (78), Expect = 3.8, Method: Composition-based stats. Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD + P F + H P N+ + L TE+NGAT GS Sbjct 151 AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ 199 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P LL G +L + VH G N++ Sbjct 200 DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT 239 >ref|XP_851122.1| UniGene infoGene info PREDICTED: similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) [Canis familiaris] Length=312 GENE ID: 608889 LOC608889 | similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) [Canis lupus familiaris] Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 31/105 (29%), Positives = 43/105 (40%), Gaps = 25/105 (23%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEA--------------PLRDHSFL 108 + ++I L+ T +NG F GSH G V A P+ D S Sbjct 192 LGIWIALEDATLENGCLWFIPGSHTGG---VSRRMVRAFAGLKLNTRFLGSEPVWDDSLF 248 Query 109 LP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 +P RG+ IL+ VH+ NLS+R+R LM G W Sbjct 249 VPTPVQRGALILIHGEVVHKSEQNLSDRSRHAYTFHLMESLGTMW 293 >ref|ZP_00975555.1| COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Pseudomonas aeruginosa 2192] ref|ZP_01365588.1| hypothetical protein PaerPA_01002714 [Pseudomonas aeruginosa PACS2] Length=288 Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD + P F + H P N+ + L TE+NGAT GS Sbjct 130 AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ 178 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P LL G +L + VH G N++ Sbjct 179 DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT 218 >ref|NP_744958.1| Gene info hypothetical protein PP_2814 [Pseudomonas putida KT2440] gb|AAN68422.1|AE016475_1 Gene info conserved hypothetical protein [Pseudomonas putida KT2440] Length=289 GENE ID: 1042682 PP_2814 | hypothetical protein [Pseudomonas putida KT2440] (10 or fewer PubMed links)  Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Query 60 PHAI-NVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVD 118 P AI N+ + L TE+NGAT GS W D ++ P LL G +L Sbjct 152 PRAITNLMLALTDFTEENGATRLIPGSQDWDDF----DDVGTPEMTIPALLKAGDAVLFG 207 Query 119 YRTVHRGTVNLS 130 + VH G N++ Sbjct 208 GKVVHGGGANVT 219 >ref|ZP_01103950.1| conserved hypothetical protein [gamma proteobacterium KT 71] gb|EAQ96749.1| conserved hypothetical protein [Congregibacter litoralis KT71] Length=315 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 6/95 (6%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGD-VWVDDEEAEAPLRDHSFLLPRGSFILV 117 P ++ + TEDNGAT GSH+WG+ + D + ++P GS IL Sbjct 173 PVLSVATVFAIDDFTEDNGATVAIPGSHLWGEGRFPTDSDPRV-----KAVMPAGSCILF 227 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 H G N S +R Y + + NY Sbjct 228 LGNLWHGGGENYSGESRMAFTGQYCEPYLRTQENY 262 >ref|YP_766411.1| Gene info putative deoxygenase [Rhizobium leguminosarum bv. viciae 3841] emb|CAE00194.1| Gene info hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] emb|CAK06296.1| Gene info putative deoxygenase [Rhizobium leguminosarum bv. viciae 3841] Length=273 GENE ID: 4401722 RL0802 | putative deoxygenase [Rhizobium leguminosarum bv. viciae 3841] (10 or fewer PubMed links)  Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P AIN L T +NG+T G+H + + DE L H + RG+FI++D Sbjct 144 PLAINALFALDDFTIENGSTRVIPGTHH-REAFPPDEVVRR-LETH-VTVKRGTFIVLDC 200 Query 120 RTVHRGTVNLSNRTRSMLMLIY 141 H G N +++ R + ++ Sbjct 201 MVYHAGGTNKTDKNRRAINHVF 222 >ref|ZP_01034759.1| hypothetical protein ROS217_22977 [Roseovarius sp. 217] gb|EAQ27440.1| hypothetical protein ROS217_22977 [Roseovarius sp. 217] Length=265 Score = 34.7 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 9/85 (10%) Query 69 LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT 126 L T +NGAT GS + +D+ +A ++PRGS + TVH G Sbjct 144 LDDFTAENGATRVVPGSQDLRPIKSITEDQITQA-------VMPRGSVLFYLGATVHAGG 196 Query 127 VNLSNRTRSMLMLIYGRSWWHDRTN 151 N SN R L+ Y W N Sbjct 197 ANRSNAPRKGLITTYSLGWLRQEEN 221 >ref|XP_001109799.1| UniGene infoGene info PREDICTED: similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) isoform 2 [Macaca mulatta] ref|XP_001109842.1| UniGene infoGene info PREDICTED: similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) isoform 3 [Macaca mulatta] ref|XP_001109887.1| UniGene infoGene info PREDICTED: similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) isoform 4 [Macaca mulatta] ref|XP_001109974.1| UniGene infoGene info PREDICTED: similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) isoform 6 [Macaca mulatta] Length=288 GENE ID: 717104 LOC717104 | similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) [Macaca mulatta] Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 26/118 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSVPG 212 Query 103 ---------RDHSFL--LPRGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S L LP G+ +L+ VH+ NLS+ +R LM G +W Sbjct 213 TSFLGSEPARDNSLLVSLP-GALVLIHGEVVHKSKQNLSDHSRQAYTFHLMEASGTTW 269 >ref|ZP_00976791.1| COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Burkholderia cenocepacia PC184] Length=275 Score = 34.3 bits (77), Expect = 4.9, Method: Composition-based stats. Identities = 40/136 (29%), Positives = 54/136 (39%), Gaps = 30/136 (22%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 72 FAGDSFFLKQPRTGTVTP-WHQDDAF---TDARIEHREV--------------NFWIPLQ 113 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P R + L G + Sbjct 114 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPARAVACPLMPGDCTVHA 173 Query 119 YRTVHRGTVNLSNRTR 134 RT+H NLS++ R Sbjct 174 GRTLHAAGANLSDQPR 189 >ref|XP_462625.1| Gene info hypothetical protein DEHA0G26389g [Debaryomyces hansenii CBS767] emb|CAG91144.1| Gene info unnamed protein product [Debaryomyces hansenii CBS767] Length=348 GENE ID: 2904357 DEHA0G26389g | hypothetical protein [Debaryomyces hansenii CBS767] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.0, Method: Composition-based stats. Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Query 67 IPLQHLTEDNGATEFTLGSHMWG-DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 I L T+ NGAT GSH+WG + D+ E A + L +G + T H Sbjct 198 IALTDTTKANGATRVIPGSHLWGPNRCPDNNEGNACYLE----LEKGDCAFILGSTYHAA 253 Query 126 TVNLSNRTRSMLMLIYGRSWWHDRTNY 152 + N+++ R +S+ NY Sbjct 254 SSNMTSEDRITSFYFMTKSYLKQEENY 280 >ref|ZP_01662317.1| phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J] ref|ZP_02009228.1| Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D] gb|EAX44268.1| phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J] gb|EDN39860.1| Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D] Length=292 Score = 34.3 bits (77), Expect = 5.3, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 5/79 (6%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 + + I + +E+NG T GSH W D + +E P + G ++ T Sbjct 151 VQIMIAITDFSEENGGTLVIPGSHKWDDERMPKQEEAIPTS-----MEAGDALIFIGSTY 205 Query 123 HRGTVNLSNRTRSMLMLIY 141 H G N SN R+ L + Y Sbjct 206 HGGGQNRSNAPRTGLTMSY 224 >ref|YP_293556.1| Gene info Phytanoyl-CoA dioxygenase [Ralstonia eutropha JMP134] gb|AAZ65699.1| Gene info Phytanoyl-CoA dioxygenase [Ralstonia eutropha JMP134] Length=288 GENE ID: 3607667 Reut_C6398 | Phytanoyl-CoA dioxygenase [Ralstonia eutropha JMP134] Score = 34.3 bits (77), Expect = 5.5, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 0/41 (0%) Query 50 HTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGD 90 H G P IN + L TE+NGAT GSH W D Sbjct 142 HFLKMGRASPEIVINFLVALTDFTEENGATRVIPGSHKWPD 182 >ref|YP_545348.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] gb|ABE49507.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] Length=295 GENE ID: 4000736 Mfla_1239 | Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.6, Method: Composition-based stats. Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 9/83 (10%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP---RGSFILVDY 119 + + IPLQ ++++NG T GSH+ D + L + P G + + Sbjct 151 LRLLIPLQDMSQENGGTAVVPGSHL------DHSMNKHTLDKDAIAHPDVEAGDVLAIHP 204 Query 120 RTVHRGTVNLSNRTRSMLMLIYG 142 R +H G N S+R R ++++ +G Sbjct 205 RLLHGGNPNRSDRERDVIIVQFG 227 >ref|YP_117481.1| Gene info hypothetical protein nfa12720 [Nocardia farcinica IFM 10152] dbj|BAD56117.1| Gene info hypothetical protein [Nocardia farcinica IFM 10152] Length=287 GENE ID: 3106789 nfa12720 | hypothetical protein [Nocardia farcinica IFM 10152] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 28/104 (26%), Positives = 39/104 (37%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD FP G P +N I L TE+NGAT GS+ Sbjct 128 AQMLHRDLENWFP-----------FVGMGPAGPEVTVNFLIALTDFTEENGATRVIPGSN 176 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P + + G + +T H G N++ Sbjct 177 HWPDF----QDRGTPDQTVPATMKAGDALFFSGKTAHGGGANIT 216 >ref|XP_307158.4| Gene info AGAP012746-PA [Anopheles gambiae str. PEST] gb|EAA02969.4| Gene info AGAP012746-PA [Anopheles gambiae str. PEST] Length=290 GENE ID: 1268597 AgaP_AGAP012746 | AGAP012746-PA [Anopheles gambiae str. PEST] Score = 34.3 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 16/92 (17%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEEA----------EAPLRDHS 106 P I +IPL+ NG F GSH G W+ + + APL S Sbjct 163 PSTTIGFWIPLEDAMLQNGCLHFIKGSHKSGVHRRWIRNPDKGADELLVYDRPAPLYPQS 222 Query 107 FLLP----RGSFILVDYRTVHRGTVNLSNRTR 134 + GS +L+ + VHR N S+R+R Sbjct 223 NFVAVPVKAGSCVLIHSQAVHRSDANKSDRSR 254 >ref|XP_001499867.1| Gene info PREDICTED: similar to PHYHD1 protein [Equus caballus] Length=296 GENE ID: 100070141 LOC100070141 | similar to PHYHD1 protein [Equus caballus] Score = 34.3 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 30/102 (29%), Positives = 43/102 (42%), Gaps = 19/102 (18%) Query 63 INVFIPLQHLTEDNGATEFTLGSHM-----------WGDVWVDDEEAEAPLRDHSFLLP- 110 + ++I L+ T +NG F GSH G + P D+S +P Sbjct 176 LGLWIALEDTTVENGCLWFIPGSHTSGVSRRMVRTPAGSMTGISIRGSDPAWDNSLYVPT 235 Query 111 ---RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RGS IL+ VH+ NLS+R+R + LM G W Sbjct 236 EVGRGSLILIHGEVVHKSEQNLSDRSRHVYTFHLMEASGTVW 277 >ref|XP_628987.1| Gene info hypothetical protein DDBDRAFT_0191987 [Dictyostelium discoideum AX4] gb|EAL60583.1| Gene info hypothetical protein DDBDRAFT_0191987 [Dictyostelium discoideum AX4] Length=306 GENE ID: 3385650 DDBDRAFT_0191987 | hypothetical protein [Dictyostelium discoideum AX4] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 0/38 (0%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEA 100 I V+I L ++++NG EF GSH W D+ D ++ + Sbjct 147 ITVWIALTDVSKENGTVEFVEGSHKWKDLPADINDSNS 184 >ref|XP_001109936.1| UniGene infoGene info PREDICTED: similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) isoform 5 [Macaca mulatta] Length=267 GENE ID: 717104 LOC717104 | similar to phytanoyl-CoA dioxygenase domain containing 1 (predicted) [Macaca mulatta] Score = 33.9 bits (76), Expect = 6.4, Method: Composition-based stats. Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 26/118 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSVPG 191 Query 103 ---------RDHSFL--LPRGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S L LP G+ +L+ VH+ NLS+ +R LM G +W Sbjct 192 TSFLGSEPARDNSLLVSLP-GALVLIHGEVVHKSKQNLSDHSRQAYTFHLMEASGTTW 248 
ref|XP_808587.1|  ADP-ribosylation factor-like protein 3A [Try...  58.5    3e-07 Gene info
ref|XP_001566440.1|  hypothetical protein, conserved [Leishman...  57.4    6e-07 Gene info
ref|XP_818133.1|  hypothetical protein [Trypanosoma cruzi stra...  57.0    8e-07 Gene info
ref|YP_496299.1|  Phytanoyl-CoA dioxygenase [Novosphingobium a...  52.4    2e-05 Gene info
ref|XP_001417606.1|  predicted protein [Ostreococcus lucimarin...  52.0    2e-05 Gene info
ref|XP_747181.1|  phytanoyl-CoA dioxygenase family protein [As...  51.2    5e-05 Gene info
ref|XP_001261651.1|  phytanoyl-CoA dioxygenase, putative [Neos...  50.4    8e-05 Gene info
gb|AAD32731.1|  MmcH [Streptomyces lavendulae]                     49.7    1e-04
ref|ZP_01627897.1|  hypothetical protein MGP2080_15899 [marine...  48.9    2e-04
ref|XP_384382.1|  hypothetical protein FG04206.1 [Gibberella zeae  47.8    5e-04 Gene info
ref|ZP_01627852.1|  hypothetical protein MGP2080_02500 [marine...  47.4    7e-04
ref|XP_001257330.1|  phytanoyl-CoA dioxygenase, putative [Neos...  47.0    8e-04 Gene info
ref|ZP_00112501.1|  hypothetical protein Npun02000257 [Nostoc ...  47.0    0.001
dbj|BAD20765.1|  hypothetical protein [Streptomyces kanamyceti...  46.2    0.002
ref|XP_001549420.1|  hypothetical protein BC1G_12148 [Botryoti...  45.1    0.003 Gene info
ref|XP_001418352.1|  predicted protein [Ostreococcus lucimarin...  44.7    0.004 Gene info
ref|XP_001208474.1|  conserved hypothetical protein [Aspergill...  44.7    0.004 Gene info
ref|YP_001414577.1|  Phytanoyl-CoA dioxygenase [Parvibaculum l...  44.3    0.005 Gene info
ref|XP_001396026.1|  hypothetical protein An12g09750 [Aspergil...  44.3    0.006 Gene info
ref|XP_731501.1|  conserved hypothetical protein [Aspergillus ...  44.3    0.006 Gene info
ref|XP_001227983.1|  hypothetical protein CHGG_10056 [Chaetomi...  43.9    0.007 Gene info
ref|XP_001558610.1|  hypothetical protein BC1G_02681 [Botryoti...  43.9    0.007 Gene info
dbj|BAE66236.1|  unnamed protein product [Aspergillus oryzae]      43.5    0.009
gb|EAT83717.1|  hypothetical protein SNOG_08549 [Phaeosphaeria no  43.1    0.011
ref|YP_629546.1|  phytanoyl-CoA dioxygenase family protein [My...  43.1    0.011 Gene info
ref|YP_459107.1|  hypothetical protein ELI_11090 [Erythrobacte...  43.1    0.012 Gene info
ref|XP_001593774.1|  hypothetical protein SS1G_05202 [Scleroti...  43.1    0.013 Gene info
ref|XP_001265897.1|  phytanoyl-CoA dioxygenase, putative [Neos...  42.0    0.023 Gene info
ref|ZP_01618410.1|  hypothetical protein GP2143_06913 [marine ...  42.0    0.025
ref|XP_749468.1|  phytanoyl-CoA dioxygenase family protein [As...  41.6    0.036 Gene info
ref|XP_001216755.1|  conserved hypothetical protein [Aspergill...  41.2    0.042 Gene info
ref|XP_367927.2|  hypothetical protein MGG_07831 [Magnaporthe ...  40.8    0.054 Gene info
ref|XP_001161510.1|  PREDICTED: phytanoyl-CoA dioxygenase doma...  40.4    0.071 Gene info
ref|XP_001161929.1|  PREDICTED: phytanoyl-CoA dioxygenase doma...  40.4    0.072 Gene info
ref|NP_001094346.1|  phytanoyl-CoA dioxygenase domain containi...  40.4    0.072 UniGene infoGene info
emb|CAI10841.1|  phytanoyl-CoA dioxygenase domain containing 1 [H  40.4    0.086 Gene info
ref|XP_682496.1|  hypothetical protein AN9227.2 [Aspergillus n...  40.0    0.092 Gene info
ref|XP_001161891.1|  PREDICTED: phytanoyl-CoA dioxygenase doma...  40.0    0.097 Gene info
ref|NP_001094347.1|  phytanoyl-CoA dioxygenase domain containi...  40.0    0.097 UniGene infoGene info
ref|ZP_01616112.1|  hypothetical protein GP2143_18106 [marine ...  40.0    0.11 
ref|ZP_00419196.1|  Phytanoyl-CoA dioxygenase [Azotobacter vin...  39.7    0.15 
ref|ZP_01721295.1|  hypothetical protein ALPR1_16728 [Algoriph...  39.3    0.18 
ref|XP_001392916.1|  hypothetical protein An08g08010 [Aspergil...  38.9    0.21  Gene info
ref|XP_572755.1|  hypothetical protein [Cryptococcus neoforman...  38.9    0.22  Gene info
ref|XP_774078.1|  hypothetical protein CNBH0030 [Cryptococcus ...  38.9    0.22  Gene info
dbj|BAE65945.1|  unnamed protein product [Aspergillus oryzae]      38.9    0.23 
ref|XP_360888.1|  hypothetical protein MGG_03431 [Magnaporthe ...  38.5    0.32  Gene info
ref|ZP_01501800.1|  Phytanoyl-CoA dioxygenase [Burkholderia ph...  38.1    0.41 
ref|NP_001069711.1|  hypothetical protein LOC540828 [Bos tauru...  38.1    0.41  UniGene infoGene info
ref|ZP_01867932.1|  Phytanoyl-CoA dioxygenase [Vibrio shilonii...  37.4    0.60 
ref|XP_953820.1|  hypothetical protein TA06590 [Theileria annu...  37.4    0.61  Gene info
ref|XP_664422.1|  hypothetical protein AN6818.2 [Aspergillus n...  37.4    0.68  Gene info
ref|XP_001536248.1|  predicted protein [Ajellomyces capsulatus...  37.0    0.85  Gene info
ref|XP_001610743.1|  conserved hypothetical protein [Babesia b...  37.0    0.93  Gene info
ref|XP_001267631.1|  phytanoyl-CoA dioxygenase, putative [Neos...  37.0    0.94  Gene info
emb|CAD18985.1|  putative oxigenase [Streptomyces cattleya]        36.6    1.1  
gb|AAR37958.1|  conserved hypothetical protein [uncultured mar...  36.6    1.2  
ref|NP_962094.1|  hypothetical protein MAP3160 [Mycobacterium ...  36.2    1.5   Gene info
ref|XP_313252.4|  AGAP003514-PA [Anopheles gambiae str. PEST] ...  36.2    1.5   Gene info
ref|ZP_01626096.1|  hypothetical protein MGP2080_09703 [marine...  35.8    1.7  
ref|XP_001224329.1|  hypothetical protein CHGG_05115 [Chaetomi...  35.8    1.8   Gene info
ref|ZP_01749022.1|  hypothetical protein RCCS2_03949 [Roseobac...  35.8    1.9  
ref|YP_001339697.1|  Phytanoyl-CoA dioxygenase [Marinomonas sp...  35.8    2.0   Gene info
ref|YP_883146.1|  phytanoyl-CoA dioxygenase (PhyH) family prot...  35.8    2.0   Gene info
ref|YP_366487.1|  Phytanoyl-CoA dioxygenase [Burkholderia sp. ...  35.8    2.1   Gene info
ref|XP_001657669.1|  conserved hypothetical protein [Aedes aeg...  35.8    2.1   Gene info
ref|XP_001417798.1|  predicted protein [Ostreococcus lucimarin...  35.4    2.4   Gene info
gb|ABC25279.1|  phytanoyl-CoA dioxygenase (PhyH) family [uncul...  35.4    2.7  
emb|CAL54074.1|  unnamed protein product [Ostreococcus tauri]      35.4    2.7  
ref|XP_001261676.1|  phytanoyl-CoA dioxygenase, putative [Neos...  35.4    2.8   Gene info
ref|XP_646498.1|  hypothetical protein DDBDRAFT_0201933 [Dicty...  35.4    2.8   Gene info
ref|XP_001657670.1|  conserved hypothetical protein [Aedes aeg...  35.0    3.1   Gene info
ref|ZP_01854292.1|  hypothetical protein PM8797T_31148 [Planct...  35.0    3.3  
ref|NP_822046.1|  dioxygenase [Streptomyces avermitilis MA-468...  35.0    3.4   Gene info
gb|AAK01519.1|  hypothetical protein [Pseudomonas aeruginosa] ...  34.7    3.8  
ref|XP_851122.1|  PREDICTED: similar to phytanoyl-CoA dioxygen...  34.7    4.0   UniGene infoGene info
ref|ZP_00975555.1|  COG5285: Protein involved in biosynthesis ...  34.7    4.0  
ref|NP_744958.1|  hypothetical protein PP_2814 [Pseudomonas pu...  34.7    4.1   Gene info
ref|ZP_01103950.1|  conserved hypothetical protein [gamma prot...  34.7    4.1  
ref|YP_766411.1|  putative deoxygenase [Rhizobium leguminosaru...  34.7    4.2   Gene info
ref|ZP_01034759.1|  hypothetical protein ROS217_22977 [Roseova...  34.7    4.3  
ref|XP_001109799.1|  PREDICTED: similar to phytanoyl-CoA dioxy...  34.7    4.4   UniGene infoGene info
ref|ZP_00976791.1|  COG5285: Protein involved in biosynthesis ...  34.3    4.9  
ref|XP_462625.1|  hypothetical protein DEHA0G26389g [Debaryomy...  34.3    5.0   Gene info
ref|ZP_01662317.1|  phytanoyl-CoA dioxygenase [Ralstonia picke...  34.3    5.3  
ref|YP_293556.1|  Phytanoyl-CoA dioxygenase [Ralstonia eutroph...  34.3    5.5   Gene info
ref|YP_545348.1|  Phytanoyl-CoA dioxygenase [Methylobacillus f...  34.3    5.6   Gene info
ref|YP_117481.1|  hypothetical protein nfa12720 [Nocardia farc...  34.3    5.8   Gene info
ref|XP_307158.4|  AGAP012746-PA [Anopheles gambiae str. PEST] ...  34.3    6.1   Gene info
ref|XP_001499867.1|  PREDICTED: similar to PHYHD1 protein [Equus   34.3    6.1   Gene info
ref|XP_628987.1|  hypothetical protein DDBDRAFT_0191987 [Dicty...  34.3    6.3   Gene info
ref|XP_001109936.1|  PREDICTED: similar to phytanoyl-CoA dioxy...  33.9    6.4   UniGene infoGene info

>ref|YP_476788.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus 
sp. JA-2-3B'a(2-13)]
 gb|ABD01525.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus 
sp. JA-2-3B'a(2-13)]
Length=272

 GENE ID: 3901624 CYB_0534 | phytanoyl-CoA dioxygenase PhyH family protein
[Synechococcus sp. JA-2-3B'a(2-13)] (10 or fewer PubMed links)

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 67/157 (42%), Gaps = 15/157 (9%)

Query  11   LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ  70
            L+G       P +A   Q  HRD S LF                 A +P +A+N+ IPL 
Sbjct  116  LSGLGAVVSLPGSAD--QQVHRDLSHLF-----------GDETLDAIIPCYALNLLIPLV  162

Query  71   HLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS  130
             + E+NG T    GSH   D    +   + P  D    L +GS +L DYR +H G  N S
Sbjct  163  EVNEENGMTRLWPGSHAVFDAHYTELAQQMPFIDPP--LAKGSCLLFDYRLIHLGRANRS  220

Query  131  NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARR  167
               R +L   Y R+W+ D  NY  +    +   E  R
Sbjct  221  PAPRPLLYNTYSRAWFRDPINYTQQPPLVIPAQEKER  257


>ref|YP_475540.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus 
sp. JA-3-3Ab]
 gb|ABD00277.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus 
sp. JA-3-3Ab]
Length=264

 GENE ID: 3899087 CYA_2137 | phytanoyl-CoA dioxygenase PhyH family protein
[Synechococcus sp. JA-3-3Ab] (10 or fewer PubMed links)

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 63/140 (45%), Gaps = 13/140 (9%)

Query  28   QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM  87
            Q  HRD S LF  DA             A +P +A+N+ IPL  + E+NG T    GSH 
Sbjct  123  QQVHRDLSHLFG-DAIL----------DAIVPCYALNLLIPLVEVNEENGMTRLWPGSHA  171

Query  88   WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH  147
              +    +   + P  D    L +GS +L DYR +H G  N S   R +L   Y R W+ 
Sbjct  172  VFEAHYTELARQMPFVDPP--LAKGSCLLFDYRLIHLGRANRSAAPRPLLYNTYSRPWFR  229

Query  148  DRTNYGTEDYGGVGLSEARR  167
            D  NY  +    +  +E  R
Sbjct  230  DPVNYTRQPPLVIPAAEKER  249

>ref|XP_001466614.1| Gene info hypothetical protein [Leishmania infantum]
 emb|CAM69654.1| Gene info hypothetical protein, conserved [Leishmania infantum]
Length=349

 GENE ID: 5070647 LinJ29.1090 | hypothetical protein [Leishmania infantum JPCM5]

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV  117
            L P+AINVF+PL  +   NG TEF  GSH+ GD     +    P+         GS +L 
Sbjct  224  LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QSKSVSPPV-------ALGSVLLF  274

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY  157
            DYR VHRG  N  +  R    + + RSW+ D  N+    Y
Sbjct  275  DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY  314


>gb|AAF25825.1|AF185069_1  5FI8BORFP [Leishmania donovani]
Length=309

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV  117
            L P+AINVF+PL  +   NG TEF  GSH+ GD     +    P+         GS +L 
Sbjct  184  LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QSKSVSPPV-------ALGSVLLF  234

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY  157
            DYR VHRG  N  +  R    + + RSW+ D  N+    Y
Sbjct  235  DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY  274


>ref|XP_847751.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin]
 gb|AAZ09543.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin]
Length=349

 GENE ID: 3608432 LmjF29.0885 | hypothetical protein, conserved
[Leishmania major strain Friedlin] (10 or fewer PubMed links)

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV  117
            L P+AINVF+PL  +   NG TEF  GSH+ GD     +    P+         GS +L 
Sbjct  224  LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QRKSVSPPV-------ALGSVLLF  274

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY  157
            DYR VHRG  N  +  R    + + RSW+ D  N+    Y
Sbjct  275  DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY  314

>ref|XP_843936.1| Gene info hypothetical protein, conserved [Trypanosoma brucei]
 gb|AAX69674.1|  hypothetical protein, conserved [Trypanosoma brucei]
 gb|AAZ10377.1| Gene info hypothetical protein, conserved [Trypanosoma brucei]
Length=345

 GENE ID: 3656284 Tb927.3.3440 | hypothetical protein, conserved
[Trypanosoma brucei TREU927] (10 or fewer PubMed links)

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHM--WGDVWVDDEEAEAPLRDHSFLLPRGSFI  115
            L P+AINVF+PL  L + NG TEF  GSH   +    V  +    P       +P G  +
Sbjct  225  LFPYAINVFVPLVPLNKTNG-TEFFPGSHRVNYSSKPVSQQRPVTPT------VPLGKVL  277

Query  116  LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY  157
            L DYR +HRG  N     R      Y RSW+ D+ N+ +  Y
Sbjct  278  LFDYRVLHRGLGNRLGFHRPCYYATYARSWYEDKFNFSSTRY  319


>emb|CAL51892.1|  unnamed protein product [Ostreococcus tauri]
Length=480

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 55/128 (42%), Gaps = 8/128 (6%)

Query  28   QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM  87
            Q WH         D R   T+   R       P+ + VF+PL HL  D G T+F   SH 
Sbjct  358  QEWH--------ADGRHLDTECDPRTGEGHAQPYGVCVFMPLIHLDRDTGYTQFFKRSHK  409

Query  88   WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH  147
              ++    E A         LL  G  ++ DYR +HRG  N SN  R +L  +Y    + 
Sbjct  410  TSELIGFGEAASMLRLSFDGLLNTGQSVVYDYRLLHRGMYNRSNYVRPVLQFLYTAPAYR  469

Query  148  DRTNYGTE  155
            +  NYG +
Sbjct  470  ETKNYGVD  477

>emb|CAL53283.1|  5FI8BORFP (ISS) [Ostreococcus tauri]
Length=563

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 7/100 (7%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDDEEAEA--PLRDHSFLLPRGSFIL  116
             NVF+P+  ++   G TEF  GSH W      V   D++A+A  P       +P GS ++
Sbjct  460  FNVFVPMSAVSTIEGPTEFIHGSHQWDHNAAHVTTPDQKAQAAAPRFQPELRVP-GSLLV  518

Query  117  VDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED  156
             DYR +HRG  N S R R +  ++YG S   D  N+  +D
Sbjct  519  YDYRVMHRGGANASTRRRPLAYVMYGSSGTRDSWNFPLDD  558


>ref|XP_001566440.1| Gene info hypothetical protein LbrM29_V2.0950 [Leishmania braziliensis]
 emb|CAM39951.1| Gene info hypothetical protein, conserved [Leishmania braziliensis]
Length=350

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV  117
            L P+A+NVF+PL  +   NG TEF  GSH+ G+       + A        +  G+ +L 
Sbjct  225  LFPYAVNVFVPLISVDSRNG-TEFFPGSHIVGNARRRKPVSPA--------VALGNALLF  275

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY  157
            DYR VHRG  N     R    + + +SW+ D  N+  + Y
Sbjct  276  DYRVVHRGLRNAKIDPRPCYYVTFSQSWYQDIYNFSRKRY  315


>ref|XP_808587.1| Gene info ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain 
CL Brener]
 gb|EAN86736.1| Gene info ADP-ribosylation factor-like protein 3A, putative [Trypanosoma 
cruzi]
Length=345

 GENE ID: 3539035 Tc00.1047053504433.14 | ADP-ribosylation factor-like protein
3A [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV  117
            L P+AINVFIPL  + ++NG TE   GSH     W  D  +    +  + ++P G  +L 
Sbjct  225  LFPYAINVFIPLVPVDKNNG-TEVFPGSHRIE--W--DSRSSLKKKPVTPIIPFGKALLF  279

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGV  160
            DYR +HRG  N     R      + RSW+ D+ N+    Y  V
Sbjct  280  DYRLLHRGLGNRLGSPRPCYYATFVRSWYEDKFNFSFSRYRTV  322


>ref|XP_001417606.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95899.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
Length=314

 GENE ID: 5001547 OSTLU_31394 | predicted protein
[Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 58/129 (44%), Gaps = 12/129 (9%)

Query  28   QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM  87
            Q WH         D R    +   R      PP+ + VF+PL  L+ + G T+F + SH 
Sbjct  189  QEWH--------ADGRHLDVECDVRTGCGHAPPYGVCVFMPLIDLSRETGFTQFFMRSHK  240

Query  88   WGDVWVDDEEAEAPLRDHSF--LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW  145
               + +   +A   LR  SF  +L  G  +  DYR +HRG  N S   R +L  +Y    
Sbjct  241  TSKL-IGFGDASLILR-LSFDGILDAGQSVAYDYRLLHRGMANDSLANRPVLQFLYTAPA  298

Query  146  WHDRTNYGT  154
            + +  NYGT
Sbjct  299  YRETKNYGT  307


>ref|XP_818133.1| Gene info hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN96282.1| Gene info hypothetical protein, conserved [Trypanosoma cruzi]
Length=345

 GENE ID: 3550292 Tc00.1047053507951.179 | hypothetical protein
[Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%)

Query  58   LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV  117
            L P+AINVFIPL  + ++NG TE   GSH     W  D  +    +  +  +P G  +L 
Sbjct  225  LFPYAINVFIPLVPVDKNNG-TEVFPGSHRIE--W--DSRSSLKKKPVTPSIPFGKALLF  279

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGV  160
            DYR +HRG  N  +  R      + RSW+ D+ N+    Y  V
Sbjct  280  DYRLLHRGLGNRLSSPRPCYYATFVRSWYKDKFNFSFSRYRTV  322


>ref|YP_496299.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 
12444]
 gb|ABD25465.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 
12444]
Length=296

 GENE ID: 3915802 Saro_1020 | Phytanoyl-CoA dioxygenase
[Novosphingobium aromaticivorans DSM 12444]

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 52/125 (41%), Gaps = 17/125 (13%)

Query  28   QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM  87
            QH H D + LF            +   G  LP  A+ + IPL  + E NG TEF LG+H 
Sbjct  122  QHLHSDDTFLF----------AGSENDGK-LPAFALTIAIPLVEVNEVNGGTEFLLGTHR  170

Query  88   WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH  147
                         P    S  L  G  ++ D+   HRG  N+SN  R M  +   R +W 
Sbjct  171  C------KSGKSYPGVPVSSPLAPGDCMIWDFMVRHRGRPNVSNAARPMFYITACRPFWI  224

Query  148  DRTNY  152
            D  N+
Sbjct  225  DSANF  229


>emb|CAN94331.1|  hypothetical protein [Sorangium cellulosum 'So ce 56']
Length=270

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 53/129 (41%), Gaps = 13/129 (10%)

Query  17   ASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDN  76
            A+D+P      Q  HRDA  LFP               G   P   + V  PL  +T +N
Sbjct  103  ATDTPLLGSDYQDVHRDAPPLFP-------------EIGRETPAFQLAVNFPLVDVTAEN  149

Query  77   GATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSM  136
            G  E   G+HM          A+  +      +  G  ++ D R +HRGT N S   R M
Sbjct  150  GPIEIARGTHMLSKAEGMRRLAQGEVALEPIAMELGDVMVRDVRGLHRGTPNRSREPRPM  209

Query  137  LMLIYGRSW  145
            +++ Y R W
Sbjct  210  VVIGYSRRW  218


>ref|ZP_01627897.1|  hypothetical protein MGP2080_15899 [marine gamma proteobacterium 
HTCC2080]
 gb|EAW39438.1|  hypothetical protein MGP2080_15899 [marine gamma proteobacterium 
HTCC2080]
Length=269

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 60/147 (40%), Gaps = 39/147 (26%)

Query  28   QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM  87
            QHWH D+    P  AR HL            P HAINV + L  +    G TE  LGSH 
Sbjct  129  QHWHTDS----PHVARDHL------------PAHAINVMVALHDIPLAMGPTECALGSHF  172

Query  88   WG----------------------DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG  125
                                    ++ V D E E P    +  +  GS ++ D R +HRG
Sbjct  173  LSNHLSNPSLVLNELIYQHEGTTPEILVGDTETEIP-EACAQAMAAGSCLIFDDRLLHRG  231

Query  126  TVNLSNRTRSMLMLIYGRSWWHDRTNY  152
              N SN+ R +    Y ++ + + T++
Sbjct  232  LGNQSNKPRHVAYFAYRKNGYTENTHF  258


>ref|XP_384382.1| Gene info hypothetical protein FG04206.1 [Gibberella zeae PH-1]
Length=299

 GENE ID: 2785543 FG04206.1 | hypothetical protein [Gibberella zeae PH-1]

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 24/133 (18%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSH-------------------MWGDVWVDDEEAEA  100
            P A+ + IPL   T +NG+TE  LG+H                   +  ++    +E   
Sbjct  139  PFALVINIPLVTTTPENGSTEIWLGTHNGYGLDTQEGAHGERASGRIREELLRQRKEVSP  198

Query  101  PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGT-EDYGG  159
            P+R    ++ +GS I+ D R  H G  NL+ +TR ML +I+   W+ +R      ED   
Sbjct  199  PIRP---IIKKGSIIVRDLRLWHAGMPNLTQQTRVMLAMIHFAPWYRNRMRLELGEDVKS  255

Query  160  VGLSEARRDDGAG  172
            + L E  R+   G
Sbjct  256  I-LEELEREGKLG  267

>ref|XP_747181.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus 
Af293]
 gb|EAL85143.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus 
Af293]
Length=291

 GENE ID: 3504528 AFUA_8G00230 | phytanoyl-CoA dioxygenase family protein
[Aspergillus fumigatus Af293] (10 or fewer PubMed links)

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 20/101 (19%)

Query  27   AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH  86
            AQ +HRD       DA   L  +H +   A  PP +++V  PL   TE+NGATE  LGSH
Sbjct  125  AQPFHRD-------DATHPL--MHYQPLEA--PPVSLSVIFPLTEFTEENGATEVILGSH  173

Query  87   MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRG  125
             W +V         P RD + L  +  G  ++V  R VH G
Sbjct  174  RWTEVG-------TPERDQAVLATMDPGDVLIVRQRVVHAG  207


>dbj|BAD20765.1|  hypothetical protein [Streptomyces kanamyceticus]
 emb|CAE46944.1|  hypothetical protein [Streptomyces kanamyceticus]
 emb|CAF31594.2|  putative kanamycin biosynthetic protein [Streptomyces kanamyceticus]
Length=285

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 16/101 (15%)

Query  59   PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEE-------------AEAPLRDH  105
            PP+ + V +PL   T +NG+TE+  GSH+       DE                 P+R  
Sbjct  145  PPYCLCVDVPLIDFTLENGSTEYWPGSHVLNPDECYDERGCVLPAELERRRAVAPPVR--  202

Query  106  SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW  146
             F +P GS ++ D R  HRG  NLS   R +L + +   W+
Sbjct  203  -FPIPVGSVVIRDGRLWHRGVPNLSAAPRPLLAMTHYTEWF  242


>ref|XP_001261651.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
 gb|EAW19754.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
Length=291

 GENE ID: 4588684 NFIA_093740 | phytanoyl-CoA dioxygenase, putative
[Neosartorya fischeri NRRL 181]

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 20/101 (19%)

Query  27   AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH  86
            AQ +HRD       DA   L  +H +   A  PP +++V  PL   TE+NGATE  LGSH
Sbjct  125  AQPFHRD-------DATHPL--MHHQPLEA--PPISLSVIFPLTEFTEENGATEVILGSH  173

Query  87   MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRG  125
             W +V         P RD + L  +  G  ++V  R VH G
Sbjct  174  RWMEVG-------TPERDQAVLATMDPGDVLVVRQRVVHAG  207


>ref|XP_001418352.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96645.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
Length=566

 GENE ID: 5002231 OSTLU_92828 | predicted protein
[Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEE----AEAPLRDHSFLLPRGSFIL  116
             NVFI    +   +G T F  GSH W     +V   E    A AP      L P GS ++
Sbjct  453  FNVFINTAKVETIDGPTAFIHGSHEWDHDACYVSTPERKAQALAPRTQPELLFP-GSVLI  511

Query  117  VDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED  156
             DYR +H+G  N S R RS+  +++      D  N+  +D
Sbjct  512  YDYRVMHKGGANDSARRRSLAYVMFCSRRARDSWNFPLDD  551


>ref|YP_629546.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus 
DK 1622]
 gb|ABF88170.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus 
DK 1622]
Length=395

 GENE ID: 4102795 MXAN_1289 | phytanoyl-CoA dioxygenase family protein
[Myxococcus xanthus DK 1622] (10 or fewer PubMed links)

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 73/173 (42%), Gaps = 24/173 (13%)

Query  62   AINVFIPLQHLTEDNGATE----------------FTLGSHMWGDVWVDDEEAEAPLRDH  105
            +I + IPL  +T DNG  E                FT G+H   +  +       P R  
Sbjct  165  SIAINIPLVDVTPDNGPMEVWPGTHQPPSEGRLAPFTTGAHRIDEPTLKSLVRRIPSR--  222

Query  106  SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA  165
              ++ RG+ ++ D+R VHRGT NL++  R ML L        ++  Y      G  L+ +
Sbjct  223  KLVMRRGAVLIRDHRMVHRGTPNLADAPRYMLSLY---CIAAEQVPYRLLSDAGATLALS  279

Query  166  RRDDGAGGGPEAAIQRRVLRALTVSEVGPSGEVCDLGTDEHDLWLRERMWWGL  218
             R  G G G  AA++ R L  L  + +G   E C L   ++       +W  L
Sbjct  280  LRRMGRGSG--AAVRHRRLFDLG-AVLGRVVEECSLSDRDYRRTFSAELWASL  329


>ref|ZP_01627852.1|  hypothetical protein MGP2080_02500 [marine gamma proteobacterium 
HTCC2080]
 gb|EAW39460.1|  hypothetical protein MGP2080_02500 [marine gamma proteobacterium 
HTCC2080]
Length=288

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV  122
            I+V   L   TE+NGAT    GSH+ G    D E+   P       +PRGS ++    T+
Sbjct  161  ISVLWALDDFTEENGATRVIPGSHLSGPHPDDAEQTSYPAE-----MPRGSMVVYLGSTL  215

Query  123  HRGTVNLSNRTRSMLMLIYGRSWWHDRTN  151
            H G  N S++ R  L+  Y   W     N
Sbjct  216  HGGGANRSDKPRRALVNTYALGWLRQEEN  244


>ref|XP_001257330.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
 gb|EAW15433.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
Length=304

 GENE ID: 4583844 NFIA_047690 | phytanoyl-CoA dioxygenase, putative
[Neosartorya fischeri NRRL 181]

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 16/105 (15%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD  104
            P A  V +PL  +T +NG+TE  LG+H          M GD     + +D+ E    +R 
Sbjct  149  PFAYVVNVPLIEMTPENGSTEIWLGTHINSGLHVQEGMHGDRASGRIKLDELEKRRAVRP  208

Query  105  HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD  148
                ++P+G+ +L D R  H G  N +++ R ML +I+   W+ +
Sbjct  209  PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMIHFAPWYRN  253


>gb|AAD32731.1|  MmcH [Streptomyces lavendulae]
Length=254

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query  34   ASLLFPPDARFHLTDVHTRASGAFLP-PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW  92
            A++  P  +R HL    T A   + P P   N    L   TEDNGAT    GSH+ G   
Sbjct  101  ANIAGPGGSRMHLHADQTFARPPWPPYPLVANSMWMLDDFTEDNGATRLVPGSHLLGR-Q  159

Query  93   VDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY  152
             D +  E      +   P GS ++ D R  H+   N ++R R  ++  Y R +   + N+
Sbjct  160  PDYDRGEGNTETVAVCAPAGSVMVFDGRLWHQTGANTTDRPRHGILNYYCRGYVRQQQNF  219

Query  153  GT---EDYGGVGLSEARR  167
             +   ED       E RR
Sbjct  220  FSGLREDVATRATPELRR  237

>ref|XP_731501.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293]
 gb|EAL84211.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293]
Length=152

 GENE ID: 3503644 AFUA_6G00540 | conserved hypothetical protein
[Aspergillus fumigatus Af293] (10 or fewer PubMed links)

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 16/107 (14%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD  104
            P A  + IPL  +T +NG+TE  LG+H          M GD     + +D+ E    +R 
Sbjct  26   PFAYVINIPLIEMTPENGSTEIWLGTHIDSGLHIQEGMHGDRASGRIKLDELEKRRAVRP  85

Query  105  HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRT  150
                ++P+G+ +L D R  H G  N +++ R ML +I G    H +T
Sbjct  86   PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMINGLEGEHFQT  132


>ref|XP_001227983.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51]
 gb|EAQ83652.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51]
Length=251

 GENE ID: 4396037 CHGG_10056 | hypothetical protein
[Chaetomium globosum CBS 148.51]

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV  122
            I + +     T  NGAT    GSH+WGD  +  E   A        L RG  +L    T+
Sbjct  114  IGMLVAAVDTTYANGATLVVPGSHLWGDARIAQEHEVAAAE-----LSRGEALLFLTSTL  168

Query  123  HRGTVNLSNRTRSMLMLIYGRSWWHDRTN  151
            H G  N +   R+M  + Y RSW     N
Sbjct  169  HAGGANTTPDPRTMYAIFYCRSWVRPEAN  197


>ref|YP_001414577.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1]
 gb|ABS64920.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1]
Length=274

 GENE ID: 5453899 Plav_3316 | Phytanoyl-CoA dioxygenase
[Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score = 44.7 bits (104),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWG----DVWVDDEEAEAPLRDHSFLLPRGSFI  115
            P AIN    L   T +NGAT    GSH       D  VD  + + P        P GSFI
Sbjct  143  PLAINALFCLDDFTTENGATYVLPGSHKQSAYPSDATVDALKVQIPA-------PAGSFI  195

Query  116  LVDYRTVHRGTVNLSNRTRSMLMLIY  141
            ++D    H G VN ++R R  +  +Y
Sbjct  196  ILDCMLYHSGGVNRTDRERRAVNHVY  221


>ref|XP_001208474.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU37866.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=294

 GENE ID: 4315665 ATEG_01109 | conserved hypothetical protein
[Aspergillus terreus NIH2624]

 Score = 44.3 bits (103),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 13/100 (13%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFL-----------  108
            P A  V I L   + +NGATE  LGSH+  D  V D   +        L           
Sbjct  148  PFAFCVNINLVDTSPENGATEVWLGSHIDTDQSVLDHSVKHKQVKADLLEARRKISPGIQ  207

Query  109  --LPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW  146
              LP+GS ++ D+R  H G  N ++  R ML+ I   +W+
Sbjct  208  PGLPKGSLVIRDFRLWHAGMPNQTDDPRVMLVTIQFANWY  247


>ref|XP_001549420.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10]
 gb|EDN33467.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10]
Length=311

 GENE ID: 5429904 BC1G_12148 | hypothetical protein
[Botryotinia fuckeliana B05.10]

 Score = 44.3 bits (103),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query  66   FIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG  125
             +     T DNGAT    GSH+W D  +   E   P+     ++P GS +       H G
Sbjct  167  MVSFDDFTADNGATTVIPGSHLWSDERIPTREEMIPV-----IMPAGSMVYFLNTLWHSG  221

Query  126  TVNLSNRTRSMLMLIYGRSW  145
              N SN+ R  + + Y + W
Sbjct  222  GANTSNKARRSITVQYCQPW  241


>ref|XP_001396026.1| Gene info hypothetical protein An12g09750 [Aspergillus niger]
 emb|CAL00879.1| Gene info unnamed protein product [Aspergillus niger]
Length=338

 GENE ID: 4986328 An12g09750 | hypothetical protein
[Aspergillus niger CBS 513.88] (10 or fewer PubMed links)

 Score = 44.3 bits (103),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 17/107 (15%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHM----------------WGDVWVDDEEAEAPLR  103
            P A  + +PL  +T +NG+TE  LG+H                  G + V + E    +R
Sbjct  182  PFAYVINVPLVTMTPENGSTEIWLGTHADSGLHLQEGAHGADRASGRIKVQELEKRRAVR  241

Query  104  -DHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR  149
                 ++P+GS ++ D R  H G  N +   R ML +I+   W+ +R
Sbjct  242  MPCQSVVPKGSLVIRDLRLWHAGMGNWTGNVRVMLAMIHFAPWYRNR  288


>ref|ZP_00112501.1|  hypothetical protein Npun02000257 [Nostoc punctiforme PCC 73102]
Length=277

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 6/129 (4%)

Query  19   DSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGA  78
            D P      Q  HRD   LF    R  + D          P +A+ V  PL  +T +NG 
Sbjct  110  DVPFQGSDYQEIHRDFRPLFSDGLRPAVGD------RIVTPLYALAVNFPLVEVTAENGP  163

Query  79   TEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLM  138
             +   G+H+        + A   +   SF +  G  ++     +HRG+ N +N+ R M++
Sbjct  164  FQMARGTHVLPREEGLKKVASGEIPMESFYMQPGDVMVRSPLALHRGSPNRTNQPRPMVV  223

Query  139  LIYGRSWWH  147
            + Y   W H
Sbjct  224  MGYAMHWLH  232


>ref|XP_001558610.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10]
 gb|EDN33003.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10]
Length=384

 GENE ID: 5439200 BC1G_02681 | hypothetical protein
[Botryotinia fuckeliana B05.10]

 Score = 43.1 bits (100),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 18/104 (17%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSH-MW--------GDVWVDDE------EAEAPLRD  104
            P  I +F+ L  ++  NG+TE   GSH  W        G  WV         E   P + 
Sbjct  149  PTCIELFMYLHEVSPTNGSTEIWPGSHHEWNLGNHESHGRGWVKASAFNRRAEHSPPFQP  208

Query  105  HSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD  148
                +P+GS  + D R  H G  NLS++ R ML  IY   W+ +
Sbjct  209  ---TIPKGSIAIRDLRLWHAGMPNLSDQNRIMLGFIYFPRWYRN  249


>ref|YP_459107.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594]
 gb|ABC64310.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594]
Length=293

 GENE ID: 3869292 ELI_11090 | hypothetical protein
[Erythrobacter litoralis HTCC2594]

 Score = 42.7 bits (99),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 51/140 (36%), Gaps = 40/140 (28%)

Query  26   VAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGS  85
             AQ WH D S    P  R               PP +++ F  L   T +NGATE   GS
Sbjct  124  TAQPWHFDDSHCDLPRPR---------------PPLSLSTFWSLTETTAENGATEIIPGS  168

Query  86   HMWGDVWVDDEEAEAPLRDHSFL--------------------LPRGSFILVDYRTVHRG  125
            H+WG     DE  E       FL                    +P GS ++      HRG
Sbjct  169  HLWG-----DERPEGASGPDDFLTGKTDKAGGAGTHPDAIKATMPPGSLMIAKGTLWHRG  223

Query  126  TVNLSNRTRSMLMLIYGRSW  145
              N S+  R ++   + + W
Sbjct  224  GANTSHDRRLIVTPQFCKGW  243

>ref|ZP_01618410.1|  hypothetical protein GP2143_06913 [marine gamma proteobacterium 
HTCC2143]
 gb|EAW29758.1|  hypothetical protein GP2143_06913 [marine gamma proteobacterium 
HTCC2143]
Length=279

 Score = 42.4 bits (98),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query  69   LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVN  128
            L   T  NGATE   GSH+W D   D E  +  +     ++P GS ++     +HRG  N
Sbjct  156  LDDFTTTNGATEVVPGSHLWAD---DREPQQHEI--EQVIMPAGSALVFAGSLIHRGGAN  210

Query  129  LSNRTRSMLMLIYGRSWWHDRTN  151
            +S  +R  +   Y   W     N
Sbjct  211  VSASSRLAVTPQYCMPWLRQIEN  233


>gb|EAT83717.1|  hypothetical protein SNOG_08549 [Phaeosphaeria nodorum SN15]
Length=313

 Score = 42.4 bits (98),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 20/115 (17%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAE----APLRDHSFLL------  109
            P A+ V +PL  +  +NG+TE  LG+H      + D+E E    A  R  S +L      
Sbjct  151  PFALVVNVPLVKMEVENGSTEIWLGTH--NGTTIADQEGEHGDRASGRIKSHILEARREV  208

Query  110  --------PRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED  156
                     +GS I+ D R  H G  NLS+  R ML  I+   W+ ++      D
Sbjct  209  RPPTQPTVKKGSIIIRDLRLWHGGKPNLSSVPRVMLAFIHFAPWYRNQMEVEIAD  263


>ref|XP_367927.2| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15]
 gb|EDJ97281.1| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15]
Length=330

 GENE ID: 2683758 MGG_07831 | hypothetical protein [Magnaporthe grisea 70-15]
(10 or fewer PubMed links)

 Score = 42.4 bits (98),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 17/106 (16%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF--------  107
            P A+ V +PL  +T  NG+TE  LG+H   D+   +    E A   +R            
Sbjct  156  PFALVVNVPLVTMTPHNGSTELWLGTHHLSDLSAQEGAHGERASGRIRQRLLDARRSTRG  215

Query  108  ----LLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHD  148
                ++ +GS ++ D R  H G  NLS +  R ML  I+   W+ +
Sbjct  216  PCQPVVKKGSVVVRDLRLWHAGMPNLSRDEVRVMLAFIHFAPWYRN  261


>ref|XP_001265897.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
 gb|EAW24000.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
Length=318

 GENE ID: 4593154 NFIA_035680 | phytanoyl-CoA dioxygenase, putative
[Neosartorya fischeri NRRL 181]

 Score = 42.0 bits (97),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------  107
            P    V + L   T  NGATE   G+H   DV V   + +  +R                
Sbjct  173  PFGFCVNVNLVETTTTNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP  232

Query  108  LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW  146
            LLP+GS I+ D+R  H G  N ++  R ML+ +    W+
Sbjct  233  LLPKGSIIIRDFRLWHAGMPNQTDEPRVMLVTVLFARWY  271


>ref|XP_001593774.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980]
 gb|EDO02725.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980]
Length=322

 GENE ID: 5489739 SS1G_05202 | hypothetical protein
[Sclerotinia sclerotiorum 1980]

 Score = 41.6 bits (96),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 47/127 (37%), Gaps = 20/127 (15%)

Query  25   RVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLG  84
            + AQ  H D  L+  P  R               P   +   +     T +NGAT    G
Sbjct  152  QTAQSIHCDDGLIALPRPR---------------PLIGVGTMVSFDDFTAENGATSVIPG  196

Query  85   SHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS  144
            SH+W D  +   E   P+     ++P GS +       H G  N S++ R  + + Y + 
Sbjct  197  SHLWSDDRIPTREEMIPV-----IMPAGSMVYFLNTLWHSGGANTSDKPRRSITVQYCQP  251

Query  145  WWHDRTN  151
            W     N
Sbjct  252  WIRTYEN  258


>ref|XP_001216755.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU31307.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=363

 GENE ID: 4353480 ATEG_08134 | conserved hypothetical protein
[Aspergillus terreus NIH2624]

 Score = 41.6 bits (96),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 22/108 (20%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-------------EEAE------A  100
            P A  + +PL  +T +NG+TE  LG+H    + V +             EE E      A
Sbjct  208  PFAYVINVPLITMTPENGSTEVWLGTHTDTGLHVQEGLHGERASGRIKLEELEKRRAVRA  267

Query  101  PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD  148
            P +     +P+GS ++ D R  H G  N +   R ML +I+  SW+ +
Sbjct  268  PCQP---TVPKGSIVIRDLRLWHAGIGNQTEIPRVMLAMIHFASWYRN  312


>dbj|BAE66236.1|  unnamed protein product [Aspergillus oryzae]
Length=325

 Score = 41.2 bits (95),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 16/105 (15%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHM---------------WGDVWVDDEEAEAPLRD  104
            P A  V +PL  +T +NG+TE  LG+H                 G + +   E +  +R 
Sbjct  170  PFAYVVNVPLITMTPENGSTEVWLGTHTDSGLHVQEGMHGERASGRIQLSALEKQRMIRP  229

Query  105  HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD  148
                ++P+G+ +L D R  H G  N ++  R ML +I+   W+ +
Sbjct  230  PCQPVVPKGALVLRDLRLWHAGIGNQTDDVRVMLAMIHFAPWYRN  274


>ref|XP_360888.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15]
 gb|EDJ94682.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15]
Length=432

 GENE ID: 2676529 MGG_03431 | hypothetical protein [Magnaporthe grisea 70-15]
(10 or fewer PubMed links)

 Score = 41.2 bits (95),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query  61   HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYR  120
            + +N+   L  +T++ GAT    GSH+     V  EE  A  +      P GS +L+D R
Sbjct  290  YVLNMMWYLTDVTDEKGATRIYPGSHVE---HVIPEEMNAVGKSIPAAAPAGSCVLLDSR  346

Query  121  TVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY  152
            T H   VN +  TR +++  + R +     NY
Sbjct  347  TWHSTGVNTTEETRPVILQSFCRFFVRQIENY  378


>ref|XP_749468.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus 
Af293]
 gb|EAL87430.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus 
Af293]
Length=318

 GENE ID: 3506925 AFUA_2G03330 | phytanoyl-CoA dioxygenase family protein
[Aspergillus fumigatus Af293] (10 or fewer PubMed links)

 Score = 40.8 bits (94),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------  107
            P    V + L   T  NGATE   G+H   DV V   + +  +R                
Sbjct  173  PFGFCVNVNLVGTTATNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP  232

Query  108  LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW  146
            LLP+GS I+ D+R  H G  N ++  R ML+ +    W+
Sbjct  233  LLPKGSIIIRDFRLWHAGMPNRTDEPRVMLVTVLFARWY  271


>ref|ZP_00419196.1|  Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP]
 gb|EAM04358.1|  Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP]
Length=261

 Score = 40.8 bits (94),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 21/128 (16%)

Query  15   SGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTE  74
            S  +  PA    A  WHRD +     +  F   D  T           I + +PLQ ++ 
Sbjct  126  SNITRKPAGIGPAIGWHRDCT-----NTYFASDDERT-----------IRMLLPLQEMSS  169

Query  75   DNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR  134
             NG T    GSH+  +    D  A         ++  GS +++D + +H GT N S   R
Sbjct  170  RNGGTAVLSGSHLHMESTPQDLSAAI-----CPVVSPGSALVIDSKVLHGGTPNRSELDR  224

Query  135  SMLMLIYG  142
             +++L +G
Sbjct  225  DVIILQFG  232


>ref|ZP_01616112.1|  hypothetical protein GP2143_18106 [marine gamma proteobacterium 
HTCC2143]
 gb|EAW33195.1|  hypothetical protein GP2143_18106 [marine gamma proteobacterium 
HTCC2143]
Length=346

 Score = 40.8 bits (94),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 47/113 (41%), Gaps = 25/113 (22%)

Query  47   TDVHTRASGAFLPPHA--INVFIPLQHLTEDNGATEFTLGSH------MWGDVWVDDEEA  98
            T+   +A+G   PP+   ++  + L  +TE  GATE   GSH       WG       + 
Sbjct  141  TEQAAKAAGQSWPPNTTTVSCSLALSEITEALGATEIYPGSHRETAVTTWG-------KG  193

Query  99   EAPL----------RDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY  141
            E P+          +  S  +P G     D R  HRG  N SN  R M+ L Y
Sbjct  194  EQPVHHPEIVKNWGQPASMTIPAGGVCFRDPRMWHRGVKNSSNTPRPMIALTY  246

>dbj|BAE65945.1|  unnamed protein product [Aspergillus oryzae]
Length=276

 Score = 40.4 bits (93),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query  47   TDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS  106
            +D+  +    +L    +NV   L  +  +NGAT +  GSH W        E EA      
Sbjct  122  SDLSLQCPDPWLSTWGLNVIWCLHDVYYENGATLYIPGSHHWKTKAEVPPEEEARKLLVP  181

Query  107  FLLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA  165
            F    GS I++D R  H    N++ ++ R++L   Y   +   + N+      GVGLSE 
Sbjct  182  FEAKAGSIIVMDGRLWHTSGCNVTQDKERALLFGAYNAPFLRGQVNW------GVGLSEE  235

Query  166  RR  167
             +
Sbjct  236  TK  237


>emb|CAD18985.1|  putative oxigenase [Streptomyces cattleya]
Length=259

 Score = 39.7 bits (91),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query  59   PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW-VDDEEAEAPLRDHS------FLLPR  111
            PP AI V++ L   T +NG   + LGSH  G V  V  EE    +   +      +  P 
Sbjct  145  PPEAITVWMALDDATVENGCVHYVLGSHRHGRVEHVRPEEGAVMIEARTEQEPVAYPAPA  204

Query  112  GSFILVDYRTVHRGTVNLSNRTRSMLMLIYGR  143
            G  ++    T+H    NLS+  R   +++Y R
Sbjct  205  GDALVHSVNTLHGSGPNLSDGPRRAYVVVYVR  236


>ref|XP_001392916.1| Gene info hypothetical protein An08g08010 [Aspergillus niger]
 emb|CAK45692.1| Gene info unnamed protein product [Aspergillus niger]
Length=292

 GENE ID: 4983120 An08g08010 | hypothetical protein
[Aspergillus niger CBS 513.88] (10 or fewer PubMed links)

 Score = 39.7 bits (91),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGD------VWVDDEEAEAPLRDHSFL---LP  110
            P  + + I L   + +NGATE   GSH   D        V  E  EA  R    +   LP
Sbjct  150  PFGLCININLVATSPENGATELWPGSHRDADPRDSDDTGVIPEIVEARRRVSPPVQPSLP  209

Query  111  RGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW  146
            +G+ I+ D+R  H G  N ++  R ML+ I+  +W+
Sbjct  210  KGAIIIRDFRLWHAGMPNRTDDPRVMLVTIHFPAWY  245


>ref|XP_001417798.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96091.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
Length=280

 GENE ID: 5002111 OSTLU_87319 | predicted protein
[Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)

 Score = 39.3 bits (90),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGD--VWVDDEEAEAPLRDHSF---LLPRGSF  114
            P     F+ LQ +  D G T F  G++       + +  E E P+    +   ++ RG  
Sbjct  164  PSVFTCFVALQDVERDMGPTLFIPGTNNAQAHVEFREGNEREGPVFRRPYELGVISRGDA  223

Query  115  ILVDYRTVHRGTVNLSNRTRSMLMLIYGRS  144
             L D RT+H GT N S+R R +    + R+
Sbjct  224  TLFDSRTLHCGTENDSSRRRVLFYFSFQRA  253


>ref|ZP_01501800.1|  Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815]
 gb|EAU98489.1|  Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815]
Length=277

 Score = 39.3 bits (90),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 60/156 (38%), Gaps = 24/156 (15%)

Query  10   ALAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPL  69
             L  ++G  + P        WHRD S         H T   T          A N  + +
Sbjct  112  VLMQQNGIINRPDRQNYQVKWHRDLSYQ-------HWTSSKT---------IAFNALLCV  155

Query  70   QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH--SFLLPRGSFILVDYRTVHRGTV  127
               T  NGA+     +H      ++    +  +R H      P GSFI++D    HRG +
Sbjct  156  DEFTLKNGASFVLPATH-----HIEAFPTDRFVRQHERQIAAPAGSFIVLDAMLYHRGGI  210

Query  128  NLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLS  163
            N+SN  R  +  + G  +   + N+ T  +   G+S
Sbjct  211  NVSNDVRRAVNHLIGLPFLAQQVNFET-GFASTGMS  245


>ref|XP_001536248.1| Gene info predicted protein [Ajellomyces capsulatus NAm1]
 gb|EDN05262.1| Gene info predicted protein [Ajellomyces capsulatus NAm1]
Length=221

 GENE ID: 5442548 HCAG_08912 | predicted protein [Ajellomyces capsulatus NAm1]

 Score = 38.9 bits (89),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query  72   LTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSN  131
             T DNGAT    GSH+WG     + E   P+     + P+GS +     T H G  N S 
Sbjct  113  FTADNGATRVVTGSHLWGADRRPECEESTPM-----VCPQGSVVYFLATTWHCGGPNNSP  167

Query  132  RTRSMLMLIYGRSWWHDRTN  151
              R  L + Y + +     N
Sbjct  168  NPRKSLTVQYCQPYIRQIEN  187


>ref|ZP_01749022.1|  hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2]
 gb|EBA13005.1|  hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2]
Length=215

 Score = 38.5 bits (88),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query  65   VFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAP-LRDHSFLLPRGSFILVDYRTVH  123
            V + L   +E++GA E  LGSH  G V  D  +A A     H     RG  +++D  T+H
Sbjct  125  VRVHLDDTSEEDGAMEIALGSHRDGKVMADQSQAVADRYPKHVCPAQRGDILILDMLTLH  184

Query  124  RGTVNLSNRTRSMLMLIYG  142
            R        TR  L + Y 
Sbjct  185  RSLPATVPSTRRTLRIDYA  203


>ref|XP_572755.1| Gene info hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW45448.1| Gene info expressed protein [Cryptococcus neoformans var. neoformans JEC21]
Length=327

 GENE ID: 3259545 CNI00020 | hypothetical protein
[Cryptococcus neoformans var. neoformans JEC21] (10 or fewer PubMed links)

 Score = 38.5 bits (88),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF--------  107
            P A  V + L  +   NG+T+  LG+H   D+   +    E A   ++            
Sbjct  175  PFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISP  234

Query  108  ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR  149
                 +P+GS I+ D R  H G  N ++  R ML +I+   W+  R
Sbjct  235  PLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPWYRQR  280


>ref|XP_774078.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19431.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=327

 GENE ID: 4937528 CNBH0030 | hypothetical protein
[Cryptococcus neoformans var. neoformans B-3501A]

 Score = 38.5 bits (88),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF--------  107
            P A  V + L  +   NG+T+  LG+H   D+   +    E A   ++            
Sbjct  175  PFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISP  234

Query  108  ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR  149
                 +P+GS I+ D R  H G  N ++  R ML +I+   W+  R
Sbjct  235  PLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPWYRQR  280


>ref|ZP_00976791.1|  COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide 
fumonisin [Burkholderia cenocepacia PC184]
Length=275

 Score = 38.5 bits (88),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 56/143 (39%), Gaps = 30/143 (20%)

Query  11   LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ  70
             AG S     P T  V   WH+D +     DAR    +V              N +IPLQ
Sbjct  72   FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ  113

Query  71   HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD  118
             ++ DNG  +F  GSH++         GDV     E      P R  +  L  G   +  
Sbjct  114  AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPARAVACPLMPGDCTVHA  173

Query  119  YRTVHRGTVNLSNRTRSMLMLIY  141
             RT+H    NLS++ R    L +
Sbjct  174  GRTLHAAGANLSDQPRYAYALNF  196


>ref|XP_682496.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61518.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4]
Length=416

 GENE ID: 2868057 AN9227.2 | hypothetical protein [Aspergillus nidulans FGSC A4]
(10 or fewer PubMed links)

 Score = 38.1 bits (87),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 55/136 (40%), Gaps = 28/136 (20%)

Query  16   GASDSPATARVAQHWHRDASLLFP------PDARFHLTDVHTRASGAFLPPHAINVFIPL  69
            GA    A +  AQ  HRD     P      PDA                P  +IN  + L
Sbjct  227  GAVMELAPSNPAQPLHRDMRFSHPIVEYLKPDA----------------PATSINFLVAL  270

Query  70   QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNL  129
               T +NGAT   LGSH W +  + +   +A +R    L+  G  +L+   T+H G    
Sbjct  271  SPFTAENGATHVILGSHKWQN--LSNVSMDATVR---ALMNPGDALLITDSTIHCGGAET  325

Query  130  S-NRTRSMLMLIYGRS  144
            +   TR +L +  G S
Sbjct  326  TGTETRRLLTITMGIS  341

>ref|XP_953820.1| Gene info hypothetical protein TA06590 [Theileria annulata strain Ankara]
 emb|CAI73142.1| Gene info hypothetical protein [Theileria annulata]
Length=502

 GENE ID: 3863425 TA06590 | hypothetical protein
[Theileria annulata strain Ankara] (10 or fewer PubMed links)

 Score = 38.1 bits (87),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 23/88 (26%)

Query  63   INVFIPLQHLTEDNGATEFTLGSH---------MWGDVWVDDEEAEAPLRDHSFLLPRGS  113
            IN+ +PLQ   + NG  +F  G+H           G V VD  E +  + + S L     
Sbjct  381  INIVVPLQDTNKVNGRMQFLPGTHNEPSRLNPYTCGPVGVDLNEGDVLIYNSSVL-----  435

Query  114  FILVDYRTVHRGTVNLSNRTRSMLMLIY  141
                     HR T+N SN  +SM++  Y
Sbjct  436  ---------HRNTINESNVCQSMVVFTY  454


>ref|ZP_01867932.1|  Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1]
 gb|EDL53417.1|  Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1]
Length=252

 Score = 38.1 bits (87),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query  57   FLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-EEAEAPLRDHSFL-LPRGSF  114
            F   H +N    L  L  DNGA     G+H+  ++  D  E+ EA   D  +L  P GS 
Sbjct  133  FPKVHLVNSIWALDDLCRDNGAPRIIPGTHLRPELPEDVLEDTEATHPDEVYLECPAGSI  192

Query  115  ILVDYRTVHRGTVNLSNRTRSMLMLIY  141
            ++ +  T H GTVN     R +L  +Y
Sbjct  193  MIFNAHTWHGGTVNTLGTRRRVLHGLY  219


>ref|XP_001161510.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 
1 [Pan troglodytes]
Length=277

 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain
containing 1 [Pan troglodytes]

 Score = 37.7 bits (86),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL-----  102
            H  AS  +  P    + V+I ++  T +NG   F  GSH  G   V      AP+     
Sbjct  156  HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG  212

Query  103  ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW  145
                     RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G +W
Sbjct  213  TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW  272


>emb|CAI10841.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens]
Length=255

 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1
[Homo sapiens] (10 or fewer PubMed links)

 Score = 37.7 bits (86),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL-----  102
            H  AS  +  P    + V+I ++  T +NG   F  GSH  G   V      AP+     
Sbjct  135  HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG  191

Query  103  ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW  145
                     RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G +W
Sbjct  192  TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW  251


>ref|NP_001094347.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform c [Homo 
sapiens]
 gb|AAH51300.1| UniGene infoGene info PHYHD1 protein [Homo sapiens]
 gb|EAW87847.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_d 
[Homo sapiens]
Length=270

 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1
[Homo sapiens] (10 or fewer PubMed links)

 Score = 37.4 bits (85),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL-----  102
            H  AS  +  P    + V+I ++  T +NG   F  GSH  G   V      AP+     
Sbjct  135  HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG  191

Query  103  ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW  145
                     RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G +W
Sbjct  192  TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW  251


>ref|XP_001161891.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 
5 [Pan troglodytes]
Length=270

 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain
containing 1 [Pan troglodytes]

 Score = 37.4 bits (85),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL-----  102
            H  AS  +  P    + V+I ++  T +NG   F  GSH  G   V      AP+     
Sbjct  135  HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG  191

Query  103  ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW  145
                     RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G +W
Sbjct  192  TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW  251


>ref|NP_001094346.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform a [Homo 
sapiens]
 pdb|2OPW|A Related structures Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase 
Phyhd1 (Apo)
 gb|AAH53853.1| UniGene infoGene info PHYHD1 protein [Homo sapiens]
 emb|CAI10842.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens]
 gb|EAW87844.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_a 
[Homo sapiens]
Length=291

 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1
[Homo sapiens] (10 or fewer PubMed links)

 Score = 37.4 bits (85),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL-----  102
            H  AS  +  P    + V+I ++  T +NG   F  GSH  G   V      AP+     
Sbjct  156  HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG  212

Query  103  ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW  145
                     RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G +W
Sbjct  213  TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW  272


>ref|XP_001161929.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 
6 [Pan troglodytes]
 ref|XP_001161970.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 
7 [Pan troglodytes]
 ref|XP_001162007.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 
8 [Pan troglodytes]
Length=291

 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain
containing 1 [Pan troglodytes]

 Score = 37.4 bits (85),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL-----  102
            H  AS  +  P    + V+I ++  T +NG   F  GSH  G   V      AP+     
Sbjct  156  HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG  212

Query  103  ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW  145
                     RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G +W
Sbjct  213  TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW  272


>ref|XP_001610743.1| Gene info conserved hypothetical protein [Babesia bovis]
 gb|EDO07175.1| Gene info conserved hypothetical protein [Babesia bovis]
Length=1596

 GENE ID: 5478977 BBOV_IV008210 | conserved hypothetical protein [Babesia bovis]

 Score = 37.0 bits (84),  Expect = 0.93, Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 23/89 (25%)

Query  62    AINVFIPLQHLTEDNGATEFTLGSHM---------WGDVWVDDEEAEAPLRDHSFLLPRG  112
              + V + L  + E+NG  +F  G+H          +G V VD              L +G
Sbjct  1483  GVTVVLALDCVEENNGRIQFLPGTHKTQPEINPYKFGKVGVD--------------LNKG  1528

Query  113   SFILVDYRTVHRGTVNLSNRTRSMLMLIY  141
               ++ D R +HR T+N SN+  S L+  Y
Sbjct  1529  DVLIFDSRVLHRNTINESNKCCSCLVFSY  1557


>ref|XP_664422.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4]
 gb|EAA58217.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4]
Length=271

 GENE ID: 2870496 AN6818.2 | hypothetical protein [Aspergillus nidulans FGSC A4]
(10 or fewer PubMed links)

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 11/98 (11%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP----RGSFI  115
            P A+N+   L  +  +NGAT +  GSH W        + E P      L P     GS I
Sbjct  137  PWAVNIIWCLSDVYFENGATLYIPGSHRW------KRKNEVPSNAVEMLKPFVAKAGSII  190

Query  116  LVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY  152
             +D R  H    N++ ++ R++L   Y   +   + N+
Sbjct  191  AMDARVWHTSGANITKDQDRALLFAFYSAPFLRQQVNW  228

>ref|XP_001418033.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96326.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
Length=326

 GENE ID: 5002112 OSTLU_15487 | predicted protein
[Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 52/113 (46%), Gaps = 14/113 (12%)

Query  56   AFLPPHA--INVFIPLQHLTEDNGATEFTLG-----SHMWGDVWVDDEEAEAPL---RDH  105
            AF  PHA   ++FI LQ +  + G T F LG     SH    V   +EE  A L   R  
Sbjct  188  AFDAPHAPLYSLFIALQDVIPEMGPTCFVLGTQDKASHDAFPVTKWNEEQFARLAKSRCC  247

Query  106  SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD---RTNYGTE  155
               L +G  +L D RT H+G  N   R R+++ L + +    D   R N G E
Sbjct  248  DAELRKGDAVLYDARTFHQGGANEYGR-RALMTLTFLKPPIPDAPTRRNAGAE  299


>ref|ZP_01103950.1|  conserved hypothetical protein [gamma proteobacterium KT 71]
 gb|EAQ96749.1|  conserved hypothetical protein [Congregibacter litoralis KT71]
Length=315

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 6/95 (6%)

Query  59   PPHAINVFIPLQHLTEDNGATEFTLGSHMWGD-VWVDDEEAEAPLRDHSFLLPRGSFILV  117
            P  ++     +   TEDNGAT    GSH+WG+  +  D +          ++P GS IL 
Sbjct  173  PVLSVATVFAIDDFTEDNGATVAIPGSHLWGEGRFPTDSDPRV-----KAVMPAGSCILF  227

Query  118  DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY  152
                 H G  N S  +R      Y   +   + NY
Sbjct  228  LGNLWHGGGENYSGESRMAFTGQYCEPYLRTQENY  262


>ref|NP_962094.1| Gene info hypothetical protein MAP3160 [Mycobacterium avium subsp. paratuberculosis 
K-10]
 gb|AAS05708.1| Gene info hypothetical protein MAP_3160 [Mycobacterium avium subsp. paratuberculosis 
K-10]
Length=277

 GENE ID: 2721210 MAP3160 | hypothetical protein
[Mycobacterium avium subsp. paratuberculosis K-10] (10 or fewer PubMed links)

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY  119
            P A      +   T DNGAT    GSH WG      ++   P+     ++P GS +L   
Sbjct  143  PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPAGSCVLFVG  197

Query  120  RTVHRGTVNLSNRTRSMLMLIYGRSW  145
               H G  N ++R R  +   Y + W
Sbjct  198  TLWHGGGANTTDRDRLAVTAQYCQPW  223


>ref|ZP_01034759.1|  hypothetical protein ROS217_22977 [Roseovarius sp. 217]
 gb|EAQ27440.1|  hypothetical protein ROS217_22977 [Roseovarius sp. 217]
Length=265

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 9/85 (10%)

Query  69   LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT  126
            L   T +NGAT    GS     +    +D+  +A       ++PRGS +     TVH G 
Sbjct  144  LDDFTAENGATRVVPGSQDLRPIKSITEDQITQA-------VMPRGSVLFYLGATVHAGG  196

Query  127  VNLSNRTRSMLMLIYGRSWWHDRTN  151
             N SN  R  L+  Y   W     N
Sbjct  197  ANRSNAPRKGLITTYSLGWLRQEEN  221


>ref|ZP_01721295.1|  hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1]
 gb|EAZ79312.1|  hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1]
Length=245

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query  69   LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH----SFLLPRGSFILVDYRTVHR  124
            L   TE+NGAT     SH W +  + DE    PL  H      + P GS  + +    H 
Sbjct  138  LDDFTENNGATRIVPSSHKWSE--LPDEALINPLDKHPKEIKIIAPAGSVFIFNSHVWHG  195

Query  125  GTVNLSNRTR  134
            GT+N +++ R
Sbjct  196  GTMNETSKIR  205


>ref|XP_001224329.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51]
 gb|EAQ88496.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51]
Length=613

 GENE ID: 4392423 CHGG_05115 | hypothetical protein
[Chaetomium globosum CBS 148.51]

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 5/100 (5%)

Query  54   SGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGS  113
            SG   P  ++N  + L   T++NGAT    GSH W D+    ++   P       +  G 
Sbjct  472  SGPDAPEASVNFVVALTEFTDENGATRVIPGSHRWQDL----QQNGTPEDTIPAEMEVGD  527

Query  114  FILVDYRTVHRGTVN-LSNRTRSMLMLIYGRSWWHDRTNY  152
               +  + VH G  N   + TR  + L++  S+      Y
Sbjct  528  ACFITGKVVHGGGANRTKDFTRRAITLVFQCSYLTPEEAY  567


>ref|YP_366487.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383]
 gb|ABB05843.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383]
Length=291

 GENE ID: 3733825 Bcep18194_C6796 | Phytanoyl-CoA dioxygenase
[Burkholderia sp. 383]

 Score = 36.6 bits (83),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 43/108 (39%), Gaps = 13/108 (12%)

Query  27   AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH  86
            AQ  HRD    FPP            A G   P    N+ I L   TE+NGAT    GS 
Sbjct  131  AQMLHRDVGN-FPPLC----------ALGINGPTVFTNLMIALTRFTEENGATRIIPGSQ  179

Query  87   MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR  134
             W + + D +    P    +  +  G  +L   + +H G  N++   R
Sbjct  180  NWDEDYFDSK--GTPDMTIAAEMDAGDALLFSGKVIHGGGANVTQNER  225


>ref|XP_001261676.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
 gb|EAW19779.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
Length=267

 GENE ID: 4588607 NFIA_093990 | phytanoyl-CoA dioxygenase, putative
[Neosartorya fischeri NRRL 181]

 Score = 36.2 bits (82),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 3/95 (3%)

Query  62   AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT  121
            A+NV   L  +TE+NGAT +  GS+ W   W +D    AP     F    G  +++D R 
Sbjct  127  AVNVIWCLTRMTEENGATLYIPGSNKWT-TW-EDVPDNAPDLLVPFEADAGDIVVIDGRL  184

Query  122  VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE  155
             H    N++ +  R++L   Y        TN+  +
Sbjct  185  WHTSGSNVTKDEDRAILFAYYSAPHMRPLTNWSAK  219


>ref|XP_001267631.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
 gb|EAW25734.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 
181]
Length=297

 GENE ID: 4594309 NFIA_045530 | phytanoyl-CoA dioxygenase, putative
[Neosartorya fischeri NRRL 181]

 Score = 36.2 bits (82),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 0/33 (0%)

Query  59   PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDV  91
            PP AI+  + L   T+DNG T   LGSH W ++
Sbjct  149  PPLAISFILALTDFTKDNGGTRVILGSHKWPEI  181


>ref|YP_883146.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium 
avium 104]
 gb|ABK69454.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium 
avium 104]
Length=287

 GENE ID: 4527072 MAV_3990 | phytanoyl-CoA dioxygenase (PhyH) family protein
[Mycobacterium avium 104]

 Score = 36.2 bits (82),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY  119
            P A      +   T DNGAT    GSH WG      ++   P+     ++P GS +L   
Sbjct  153  PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPVGSCVLFVG  207

Query  120  RTVHRGTVNLSNRTRSMLMLIYGRSW  145
               H G  N ++R R  +   Y + W
Sbjct  208  TLWHGGGANTTDRDRLAVTAQYCQPW  233


>emb|CAL54074.1|  unnamed protein product [Ostreococcus tauri]
Length=330

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 21/98 (21%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRD-------------HS  106
            P     F+ LQ +  D G T F  G++        + +A A  R+               
Sbjct  213  PSVYTCFVALQDVDADMGPTLFIPGTN--------NAQAHAEFREGLERGGPVLQRPNEL  264

Query  107  FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS  144
             L+ RG   L D RT+H GT N S+R R +    + R+
Sbjct  265  GLISRGDATLFDSRTLHCGTENASSRRRVLFYFSFQRT  302


>ref|NP_001069711.1| UniGene infoGene info hypothetical protein LOC540828 [Bos taurus]
 gb|AAI22728.1| UniGene infoGene info Similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos 
taurus]
Length=291

 GENE ID: 540828 MGC152146 | similar to phytanoyl-CoA dioxygenase domain
containing 1 [Bos taurus]

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 21/120 (17%)

Query  50   HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHM-----------WGDVWVDDE  96
            H  AS  +  P    + ++I L+    +NG   F  GSH             G V     
Sbjct  156  HQDASFLYTEPLGRVLGLWIALEDAMLENGCLWFIPGSHTGGVSRRMVRTPAGSVPGTSF  215

Query  97   EAEAPLRDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSWWHD  148
                P+RD+S  +P    RG+ +L+    VH+   NLS+R+R      LM   G  W  D
Sbjct  216  LGSEPIRDNSLFVPTPVLRGALVLIHGEVVHKSEQNLSDRSRQAYTFHLMEAAGTIWSPD  275


>ref|ZP_01562106.1|  Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia MC0-3]
 gb|EAV60109.1|  Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia MC0-3]
Length=303

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 55/143 (38%), Gaps = 30/143 (20%)

Query  11   LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ  70
             AG S     P T  V   WH+D +     DAR    +V              N +IPLQ
Sbjct  100  FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ  141

Query  71   HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD  118
             ++ DNG  +F  GSH++         GDV     E      P    +  L  G   +  
Sbjct  142  AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHA  201

Query  119  YRTVHRGTVNLSNRTRSMLMLIY  141
             RT+H    NLS++ R    L +
Sbjct  202  GRTLHAAGANLSDQPRYAYALNF  224


>ref|YP_621422.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054]
 ref|YP_839910.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia HI2424]
 gb|ABF76449.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054]
 gb|ABK13017.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia HI2424]
Length=303

 GENE ID: 4092656 Bcen_1544 | Phytanoyl-CoA dioxygenase
[Burkholderia cenocepacia AU 1054]

 Score = 35.4 bits (80),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 55/143 (38%), Gaps = 30/143 (20%)

Query  11   LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ  70
             AG S     P T  V   WH+D +     DAR    +V              N +IPLQ
Sbjct  100  FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ  141

Query  71   HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD  118
             ++ DNG  +F  GSH++         GDV     E      P    +  L  G   +  
Sbjct  142  AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHA  201

Query  119  YRTVHRGTVNLSNRTRSMLMLIY  141
             RT+H    NLS++ R    L +
Sbjct  202  GRTLHAAGANLSDQPRYAYALNF  224


>ref|YP_001539320.1| Gene info Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205]
 gb|ABW00330.1| Gene info Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205]
Length=264

 GENE ID: 5705419 Sare_4561 | Phytanoyl-CoA dioxygenase
[Salinispora arenicola CNS-205]

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 22/104 (21%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW------------VD-DEEAEAP-----  101
            P  +NV + L  +TE NG   F  GSH  G +             +D DE +  P     
Sbjct  125  PSQVNVALFLDDVTEFNGPVIFLRGSHQLGPLERPGSTEGHESGHIDPDEYSLTPAELAD  184

Query  102  -LRDHSFLLP---RGSFILVDYRTVHRGTVNLSNRTRSMLMLIY  141
             ++ H  + P   RG  +L   + VH    N+S   R +L+L Y
Sbjct  185  LVKQHEMVSPKGARGGVLLFSSQIVHGSGTNISPFARRLLILTY  228

>ref|XP_963174.1| Gene info hypothetical protein [Neurospora crassa OR74A]
 emb|CAD70289.1|  conserved hypothetical protein [Neurospora crassa]
 gb|EAA33938.1| Gene info conserved hypothetical protein [Neurospora crassa OR74A]
Length=336

 GENE ID: 3879322 NCU09596.1 | hypothetical protein [Neurospora crassa OR74A]
(10 or fewer PubMed links)

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 47/115 (40%), Gaps = 28/115 (24%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSH------------------------MWGDVWVDD  95
            P A+ + +PL  +T DNG+TE  LG+H                        +  ++    
Sbjct  174  PFALVINVPLITMTPDNGSTELWLGTHNLAGEDSSGHAAQEGAHGERASGRIRPELLARR  233

Query  96   EEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVN-LSNRTRSMLMLIYGRSWWHDR  149
                AP +     + +GS ++ D R  H G  N  S   R ML +I+   W+ +R
Sbjct  234  AAVRAPCQP---TVRKGSIVVRDLRLWHAGMPNRTSGEVRIMLAMIHFAPWYRNR  285


>ref|XP_313252.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST]
 gb|EAA08759.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST]
Length=287

 GENE ID: 1274172 AgaP_AGAP003514 | AGAP003514-PA [Anopheles gambiae str. PEST]
(10 or fewer PubMed links)

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 16/92 (17%)

Query  59   PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEEA----------EAPLRDHS  106
            P   I  +IPL+  T  NG   F  GSH  G    W+ + +            APL   S
Sbjct  160  PSTTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRWIRNPDKGADELLVYDRPAPLYPQS  219

Query  107  FL----LPRGSFILVDYRTVHRGTVNLSNRTR  134
                  +  GS +L+  + VHR   N S+R+R
Sbjct  220  NFVAVPVKAGSCVLIHSQAVHRSDANKSDRSR  251


>emb|CAL54075.1|  unnamed protein product [Ostreococcus tauri]
Length=346

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 42/95 (44%), Gaps = 17/95 (17%)

Query  60   PHA--INVFIPLQHLTEDNGATEFTLGSH-----------MWGDVWVDDEEAEAPLRDHS  106
            PHA   ++FI LQ +  + G T F LG+             WGD      EA A      
Sbjct  217  PHAPLYSLFIALQDVVPEMGPTCFVLGTQDRASHDAFPNAKWGDAQF---EALAGREWCD  273

Query  107  FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY  141
              L +G  +L D RT H+G  N   R R+++ L +
Sbjct  274  ATLRKGDAVLYDARTFHQGGANEHGR-RALMTLTF  307


>ref|ZP_01662317.1|  phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J]
 ref|ZP_02009228.1|  Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D]
 gb|EAX44268.1|  phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J]
 gb|EDN39860.1|  Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D]
Length=292

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 5/90 (5%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV  122
            + + I +   +E+NG T    GSH W D  +  +E   P       +  G  ++    T 
Sbjct  151  VQIMIAITDFSEENGGTLVIPGSHKWDDERMPKQEEAIPTS-----MEAGDALIFIGSTY  205

Query  123  HRGTVNLSNRTRSMLMLIYGRSWWHDRTNY  152
            H G  N SN  R+ L + Y  +      N+
Sbjct  206  HGGGQNRSNAPRTGLTMSYDLAILRQEENH  235


>ref|YP_001339697.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1]
 gb|ABR69762.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1]
Length=267

 GENE ID: 5365525 Mmwyl1_0830 | Phytanoyl-CoA dioxygenase
[Marinomonas sp. MWYL1]

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 48/102 (47%), Gaps = 11/102 (10%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDDEEAEAPLRDHSFLLPRGSFI  115
            P A+N    +   T DNG+T+   GSH      G+ ++++ + +       F +  G ++
Sbjct  139  PIALNALYCVCDFTFDNGSTQVLPGSHKIEKFPGNKFLEENKMQ-------FYVSSGDYL  191

Query  116  LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY  157
            L+D    H G++N ++  R  +  +Y       + ++ + D+
Sbjct  192  LIDSMLYHSGSINKTSDRRIGINNVYSTPIIRRQIDFNSSDF  233


>ref|YP_001414417.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1]
 gb|ABS64760.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1]
Length=302

 GENE ID: 5453830 Plav_3154 | Phytanoyl-CoA dioxygenase
[Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 5/89 (5%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV  122
             N    +   T++NGAT+   GS  W D +   E+     +     +P GS ++      
Sbjct  137  FNTIWAISDFTKENGATQVCPGSLGWPDDYQPTED-----QIGYAEMPAGSVLVYSGGVF  191

Query  123  HRGTVNLSNRTRSMLMLIYGRSWWHDRTN  151
            H G  N+SN  R  + + Y   W     N
Sbjct  192  HGGGANVSNGDRIGINITYTLGWLRQEEN  220


>ref|XP_747157.2| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus 
Af293]
 gb|EAL85119.2| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus 
Af293]
Length=309

 GENE ID: 3504545 AFUA_8G00480 | phytanoyl-CoA dioxygenase family protein
[Aspergillus fumigatus Af293] (10 or fewer PubMed links)

 Score = 34.7 bits (78),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 3/95 (3%)

Query  62   AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT  121
            A+NV   L  +T++NGAT +  GS+ W   W +D    AP     F    G  +++D R 
Sbjct  169  AVNVIWCLTRMTKENGATLYIPGSNKWT-TW-EDVPDNAPDLLVPFEADAGDIVVIDGRL  226

Query  122  VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE  155
             H    N++ +  R++L   Y        TN+  +
Sbjct  227  WHTSGSNVTEDEDRAILFAYYSAPHMRPLTNWSAK  261


>ref|ZP_01626096.1|  hypothetical protein MGP2080_09703 [marine gamma proteobacterium 
HTCC2080]
 gb|EAW41112.1|  hypothetical protein MGP2080_09703 [marine gamma proteobacterium 
HTCC2080]
Length=279

 Score = 34.7 bits (78),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%)

Query  59   PPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEAEAPLRDH-  105
            PPH    I+ F  L   T +NGATE    SH+W +         V  D+ +      DH 
Sbjct  124  PPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDGVDEAADHE  183

Query  106  ------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW  145
                  +  L  GS ++      HRG  NLS  +R ++   Y   W
Sbjct  184  CHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW  229


>ref|YP_508892.1| Gene info Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1]
 gb|ABD53867.1| Gene info Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1]
Length=230

 GENE ID: 3933394 Jann_0950 | Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1]

 Score = 34.7 bits (78),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 20/120 (16%)

Query  41   DARFHLTDVHTRAS------GAFLP----PHAINVFIPLQHLTEDNGAT---------EF  81
            + +F +   HT AS      GA++P    P+ ++V+I L   T +NG+          E 
Sbjct  91   NEQFVVKGPHTGASFAWHQDGAYVPFAHKPY-LSVWIALDDATLENGSLSCLPRDLDREG  149

Query  82   TLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY  141
             +  H W D+  +    + P    +   P G+ ++    T+HR   N +NR R   +  Y
Sbjct  150  HIDPHHWNDIGKEKVGYDGPDPGEALPCPAGTMVIFSSLTLHRSGANTTNRPRRAYLAQY  209


>ref|XP_001657669.1| Gene info conserved hypothetical protein [Aedes aegypti]
 gb|EAT48860.1| Gene info conserved hypothetical protein [Aedes aegypti]
Length=286

 GENE ID: 5567769 AaeL_AAEL000102 | conserved hypothetical protein
[Aedes aegypti] (10 or fewer PubMed links)

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 20/94 (21%)

Query  59   PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--------------DVWVDDEEAEAPLRD  104
            P   I  +IPL+  T  NG   F  GSH  G              ++ + D    APL  
Sbjct  159  PSSTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRYIRNPDKSSPELLIYDR--PAPLYP  216

Query  105  HSFL----LPRGSFILVDYRTVHRGTVNLSNRTR  134
             S      +  GS +L+  + VHR   N S+R+R
Sbjct  217  QSNFCAAPVKAGSLVLIHSQVVHRSDANRSDRSR  250


>gb|AAR37958.1|  conserved hypothetical protein [uncultured marine bacterium 561]
Length=295

 Score = 34.3 bits (77),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%)

Query  59   PPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEAEAPLRDH-  105
            PPH    I+ F  L   T +NGATE    SH+W +         V  D+ +      DH 
Sbjct  140  PPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDGVDEAADHE  199

Query  106  ------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW  145
                  +  L  GS ++      HRG  NLS  +R ++   Y   W
Sbjct  200  CHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW  245


>ref|YP_545348.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT]
 gb|ABE49507.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT]
Length=295

 GENE ID: 4000736 Mfla_1239 | Phytanoyl-CoA dioxygenase
[Methylobacillus flagellatus KT] (10 or fewer PubMed links)

 Score = 34.3 bits (77),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query  63   INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP---RGSFILVDY  119
            + + IPLQ ++++NG T    GSH+      D    +  L   +   P    G  + +  
Sbjct  151  LRLLIPLQDMSQENGGTAVVPGSHL------DHSMNKHTLDKDAIAHPDVEAGDVLAIHP  204

Query  120  RTVHRGTVNLSNRTRSMLMLIYG  142
            R +H G  N S+R R ++++ +G
Sbjct  205  RLLHGGNPNRSDRERDVIIVQFG  227


>gb|ABC25279.1|  phytanoyl-CoA dioxygenase (PhyH) family [uncultured marine bacterium 
Ant4E12]
Length=287

 Score = 34.3 bits (77),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  61   HAINVF-IPLQHLTEDNGATEFTLGSHMWGDVWVDDE  96
            H I  F + L H+T D+GA EF  GSH+W D+W   E
Sbjct  142  HQIMSFWVALDHVTLDSGALEFIRGSHLW-DIWYQPE  177


>ref|XP_646498.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum 
AX4]
 gb|EAL72707.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum 
AX4]
Length=147

 GENE ID: 3397778 DDBDRAFT_0201933 | hypothetical protein
[Dictyostelium discoideum AX4] (10 or fewer PubMed links)

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 0/32 (0%)

Query  57  FLPPHAINVFIPLQHLTEDNGATEFTLGSHMW  88
           FLP   I +++PL  ++ +NG  E+  GSH W
Sbjct  39  FLPAETIAIWVPLNDVSIENGTLEYATGSHNW  70


>ref|XP_462625.1| Gene info hypothetical protein DEHA0G26389g [Debaryomyces hansenii CBS767]
 emb|CAG91144.1| Gene info unnamed protein product [Debaryomyces hansenii CBS767]
Length=348

 GENE ID: 2904357 DEHA0G26389g | hypothetical protein
[Debaryomyces hansenii CBS767] (10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%)

Query  67   IPLQHLTEDNGATEFTLGSHMWG-DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG  125
            I L   T+ NGAT    GSH+WG +   D+ E  A   +    L +G    +   T H  
Sbjct  198  IALTDTTKANGATRVIPGSHLWGPNRCPDNNEGNACYLE----LEKGDCAFILGSTYHAA  253

Query  126  TVNLSNRTRSMLMLIYGRSWWHDRTNY  152
            + N+++  R        +S+     NY
Sbjct  254  SSNMTSEDRITSFYFMTKSYLKQEENY  280


>ref|YP_001412132.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1]
 gb|ABS62475.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1]
Length=265

 GENE ID: 5455998 Plav_0852 | Phytanoyl-CoA dioxygenase
[Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 43/96 (44%), Gaps = 8/96 (8%)

Query  60   PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS--FLLPRGSFILV  117
            P AINV   L   T +NGAT F  GSH+      D    +A  R  +   +   GS  ++
Sbjct  138  PLAINVAWALDDFTVENGATRFVPGSHL-----KDHGPGKASERAQTVPIICKAGSIFVM  192

Query  118  DYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY  152
            D R  H+   N S   TR+ L   Y R +   + N+
Sbjct  193  DGRVWHQTGPNTSGGDTRAGLFAYYVRPFIRPQWNW  228


>ref|ZP_01878938.1|  hypothetical protein RTM1035_05470 [Roseovarius sp. TM1035]
 gb|EDM33041.1|  hypothetical protein RTM1035_05470 [Roseovarius sp. TM1035]
Length=265

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 34/85 (40%), Gaps = 9/85 (10%)

Query  69   LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT  126
            L   T +NGAT    GS     +    DD+  +A       ++PRGS +     TVH G 
Sbjct  144  LDDFTAENGATRVVPGSQDLRPINSITDDQITQA-------VMPRGSVLFYLGATVHAGG  196

Query  127  VNLSNRTRSMLMLIYGRSWWHDRTN  151
             N +   R  L+  Y   W     N
Sbjct  197  ANRAAAPRKGLITTYSLGWLRQEEN  221


>gb|AAK01519.1|  hypothetical protein [Pseudomonas aeruginosa]
 gb|EAZ58108.1|  hypothetical protein PA2G_01326 [Pseudomonas aeruginosa 2192]
Length=309

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%)

Query  27   AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH  86
            AQ  HRD +   P    F   + H        P    N+ + L   TE+NGAT    GS 
Sbjct  151  AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ  199

Query  87   MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS  130
             W D     ++   P      LL  G  +L   + VH G  N++
Sbjct  200  DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT  239


>ref|NP_744958.1| Gene info hypothetical protein PP_2814 [Pseudomonas putida KT2440]
 gb|AAN68422.1|AE016475_1 Gene info conserved hypothetical protein [Pseudomonas putida KT2440]
Length=289

 GENE ID: 1042682 PP_2814 | hypothetical protein [Pseudomonas putida KT2440]
(10 or fewer PubMed links)

 Score = 33.9 bits (76),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query  60   PHAI-NVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVD  118
            P AI N+ + L   TE+NGAT    GS  W D     ++   P      LL  G  +L  
Sbjct  152  PRAITNLMLALTDFTEENGATRLIPGSQDWDDF----DDVGTPEMTIPALLKAGDAVLFG  207

Query  119  YRTVHRGTVNLS  130
             + VH G  N++
Sbjct  208  GKVVHGGGANVT  219


>ref|ZP_00975555.1|  COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide 
fumonisin [Pseudomonas aeruginosa 2192]
 ref|ZP_01365588.1|  hypothetical protein PaerPA_01002714 [Pseudomonas aeruginosa 
PACS2]
Length=288

 Score = 33.9 bits (76),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%)

Query  27   AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH  86
            AQ  HRD +   P    F   + H        P    N+ + L   TE+NGAT    GS 
Sbjct  130  AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ  178

Query  87   MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS  130
             W D     ++   P      LL  G  +L   + VH G  N++
Sbjct  179  DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT  218



>ref|YP_476788.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] gb|ABD01525.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] Length=272 GENE ID: 3901624 CYB_0534 | phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] (10 or fewer PubMed links)  Score = 70.1 bits (170), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 49/157 (31%), Positives = 67/157 (42%), Gaps = 15/157 (9%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 L+G P +A Q HRD S LF A +P +A+N+ IPL Sbjct 116 LSGLGAVVSLPGSAD--QQVHRDLSHLF-----------GDETLDAIIPCYALNLLIPLV 162 Query 71 HLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 + E+NG T GSH D + + P D L +GS +L DYR +H G N S Sbjct 163 EVNEENGMTRLWPGSHAVFDAHYTELAQQMPFIDPP--LAKGSCLLFDYRLIHLGRANRS 220 Query 131 NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARR 167 R +L Y R+W+ D NY + + E R Sbjct 221 PAPRPLLYNTYSRAWFRDPINYTQQPPLVIPAQEKER 257 >ref|YP_475540.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] gb|ABD00277.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] Length=264 GENE ID: 3899087 CYA_2137 | phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] (10 or fewer PubMed links)  Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 46/140 (32%), Positives = 63/140 (45%), Gaps = 13/140 (9%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q HRD S LF DA A +P +A+N+ IPL + E+NG T GSH Sbjct 123 QQVHRDLSHLFG-DAIL----------DAIVPCYALNLLIPLVEVNEENGMTRLWPGSHA 171 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 + + + P D L +GS +L DYR +H G N S R +L Y R W+ Sbjct 172 VFEAHYTELARQMPFVDPP--LAKGSCLLFDYRLIHLGRANRSAAPRPLLYNTYSRPWFR 229 Query 148 DRTNYGTEDYGGVGLSEARR 167 D NY + + +E R Sbjct 230 DPVNYTRQPPLVIPAAEKER 249 >ref|XP_001466614.1| Gene info hypothetical protein [Leishmania infantum] emb|CAM69654.1| Gene info hypothetical protein, conserved [Leishmania infantum] Length=349 GENE ID: 5070647 LinJ29.1090 | hypothetical protein [Leishmania infantum JPCM5] Score = 65.9 bits (159), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 224 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QSKSVSPPV-------ALGSVLLF 274 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 275 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 314 >gb|AAF25825.1|AF185069_1 5FI8BORFP [Leishmania donovani] Length=309 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 184 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QSKSVSPPV-------ALGSVLLF 234 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 235 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 274 >ref|XP_847751.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin] gb|AAZ09543.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin] Length=349 GENE ID: 3608432 LmjF29.0885 | hypothetical protein, conserved [Leishmania major strain Friedlin] (10 or fewer PubMed links)  Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 224 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QRKSVSPPV-------ALGSVLLF 274 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 275 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 314 >ref|XP_843936.1| Gene info hypothetical protein, conserved [Trypanosoma brucei] gb|AAX69674.1| hypothetical protein, conserved [Trypanosoma brucei] gb|AAZ10377.1| Gene info hypothetical protein, conserved [Trypanosoma brucei] Length=345 GENE ID: 3656284 Tb927.3.3440 | hypothetical protein, conserved [Trypanosoma brucei TREU927] (10 or fewer PubMed links)  Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 9/102 (8%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHM--WGDVWVDDEEAEAPLRDHSFLLPRGSFI 115 L P+AINVF+PL L + NG TEF GSH + V + P +P G + Sbjct 225 LFPYAINVFVPLVPLNKTNG-TEFFPGSHRVNYSSKPVSQQRPVTPT------VPLGKVL 277 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 L DYR +HRG N R Y RSW+ D+ N+ + Y Sbjct 278 LFDYRVLHRGLGNRLGFHRPCYYATYARSWYEDKFNFSSTRY 319 >emb|CAL51892.1| unnamed protein product [Ostreococcus tauri] Length=480 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 40/128 (31%), Positives = 55/128 (42%), Gaps = 8/128 (6%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q WH D R T+ R P+ + VF+PL HL D G T+F SH Sbjct 358 QEWH--------ADGRHLDTECDPRTGEGHAQPYGVCVFMPLIHLDRDTGYTQFFKRSHK 409 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 ++ E A LL G ++ DYR +HRG N SN R +L +Y + Sbjct 410 TSELIGFGEAASMLRLSFDGLLNTGQSVVYDYRLLHRGMYNRSNYVRPVLQFLYTAPAYR 469 Query 148 DRTNYGTE 155 + NYG + Sbjct 470 ETKNYGVD 477 >emb|CAL53283.1| 5FI8BORFP (ISS) [Ostreococcus tauri] Length=563 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 7/100 (7%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDDEEAEA--PLRDHSFLLPRGSFIL 116 NVF+P+ ++ G TEF GSH W V D++A+A P +P GS ++ Sbjct 460 FNVFVPMSAVSTIEGPTEFIHGSHQWDHNAAHVTTPDQKAQAAAPRFQPELRVP-GSLLV 518 Query 117 VDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED 156 DYR +HRG N S R R + ++YG S D N+ +D Sbjct 519 YDYRVMHRGGANASTRRRPLAYVMYGSSGTRDSWNFPLDD 558 >ref|XP_001566440.1| Gene info hypothetical protein LbrM29_V2.0950 [Leishmania braziliensis] emb|CAM39951.1| Gene info hypothetical protein, conserved [Leishmania braziliensis] Length=350 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+A+NVF+PL + NG TEF GSH+ G+ + A + G+ +L Sbjct 225 LFPYAVNVFVPLISVDSRNG-TEFFPGSHIVGNARRRKPVSPA--------VALGNALLF 275 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N R + + +SW+ D N+ + Y Sbjct 276 DYRVVHRGLRNAKIDPRPCYYVTFSQSWYQDIYNFSRKRY 315 >ref|XP_808587.1| Gene info ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain CL Brener] gb|EAN86736.1| Gene info ADP-ribosylation factor-like protein 3A, putative [Trypanosoma cruzi] Length=345 GENE ID: 3539035 Tc00.1047053504433.14 | ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)  Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVFIPL + ++NG TE GSH W D + + + ++P G +L Sbjct 225 LFPYAINVFIPLVPVDKNNG-TEVFPGSHRIE--W--DSRSSLKKKPVTPIIPFGKALLF 279 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGV 160 DYR +HRG N R + RSW+ D+ N+ Y V Sbjct 280 DYRLLHRGLGNRLGSPRPCYYATFVRSWYEDKFNFSFSRYRTV 322 >ref|XP_001417606.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO95899.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=314 GENE ID: 5001547 OSTLU_31394 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 40/129 (31%), Positives = 58/129 (44%), Gaps = 12/129 (9%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q WH D R + R PP+ + VF+PL L+ + G T+F + SH Sbjct 189 QEWH--------ADGRHLDVECDVRTGCGHAPPYGVCVFMPLIDLSRETGFTQFFMRSHK 240 Query 88 WGDVWVDDEEAEAPLRDHSF--LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + + +A LR SF +L G + DYR +HRG N S R +L +Y Sbjct 241 TSKL-IGFGDASLILR-LSFDGILDAGQSVAYDYRLLHRGMANDSLANRPVLQFLYTAPA 298 Query 146 WHDRTNYGT 154 + + NYGT Sbjct 299 YRETKNYGT 307 >ref|XP_818133.1| Gene info hypothetical protein [Trypanosoma cruzi strain CL Brener] gb|EAN96282.1| Gene info hypothetical protein, conserved [Trypanosoma cruzi] Length=345 GENE ID: 3550292 Tc00.1047053507951.179 | hypothetical protein [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)  Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVFIPL + ++NG TE GSH W D + + + +P G +L Sbjct 225 LFPYAINVFIPLVPVDKNNG-TEVFPGSHRIE--W--DSRSSLKKKPVTPSIPFGKALLF 279 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGV 160 DYR +HRG N + R + RSW+ D+ N+ Y V Sbjct 280 DYRLLHRGLGNRLSSPRPCYYATFVRSWYKDKFNFSFSRYRTV 322 >ref|YP_496299.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] gb|ABD25465.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] Length=296 GENE ID: 3915802 Saro_1020 | Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 39/125 (31%), Positives = 52/125 (41%), Gaps = 17/125 (13%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 QH H D + LF + G LP A+ + IPL + E NG TEF LG+H Sbjct 122 QHLHSDDTFLF----------AGSENDGK-LPAFALTIAIPLVEVNEVNGGTEFLLGTHR 170 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 P S L G ++ D+ HRG N+SN R M + R +W Sbjct 171 C------KSGKSYPGVPVSSPLAPGDCMIWDFMVRHRGRPNVSNAARPMFYITACRPFWI 224 Query 148 DRTNY 152 D N+ Sbjct 225 DSANF 229 >emb|CAN94331.1| hypothetical protein [Sorangium cellulosum 'So ce 56'] Length=270 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 38/129 (29%), Positives = 53/129 (41%), Gaps = 13/129 (10%) Query 17 ASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDN 76 A+D+P Q HRDA LFP G P + V PL +T +N Sbjct 103 ATDTPLLGSDYQDVHRDAPPLFP-------------EIGRETPAFQLAVNFPLVDVTAEN 149 Query 77 GATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSM 136 G E G+HM A+ + + G ++ D R +HRGT N S R M Sbjct 150 GPIEIARGTHMLSKAEGMRRLAQGEVALEPIAMELGDVMVRDVRGLHRGTPNRSREPRPM 209 Query 137 LMLIYGRSW 145 +++ Y R W Sbjct 210 VVIGYSRRW 218 >ref|ZP_01627897.1| hypothetical protein MGP2080_15899 [marine gamma proteobacterium HTCC2080] gb|EAW39438.1| hypothetical protein MGP2080_15899 [marine gamma proteobacterium HTCC2080] Length=269 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 42/147 (28%), Positives = 60/147 (40%), Gaps = 39/147 (26%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 QHWH D+ P AR HL P HAINV + L + G TE LGSH Sbjct 129 QHWHTDS----PHVARDHL------------PAHAINVMVALHDIPLAMGPTECALGSHF 172 Query 88 WG----------------------DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 ++ V D E E P + + GS ++ D R +HRG Sbjct 173 LSNHLSNPSLVLNELIYQHEGTTPEILVGDTETEIP-EACAQAMAAGSCLIFDDRLLHRG 231 Query 126 TVNLSNRTRSMLMLIYGRSWWHDRTNY 152 N SN+ R + Y ++ + + T++ Sbjct 232 LGNQSNKPRHVAYFAYRKNGYTENTHF 258 >ref|XP_384382.1| Gene info hypothetical protein FG04206.1 [Gibberella zeae PH-1] Length=299 GENE ID: 2785543 FG04206.1 | hypothetical protein [Gibberella zeae PH-1] Score = 50.1 bits (118), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 24/133 (18%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH-------------------MWGDVWVDDEEAEA 100 P A+ + IPL T +NG+TE LG+H + ++ +E Sbjct 139 PFALVINIPLVTTTPENGSTEIWLGTHNGYGLDTQEGAHGERASGRIREELLRQRKEVSP 198 Query 101 PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGT-EDYGG 159 P+R ++ +GS I+ D R H G NL+ +TR ML +I+ W+ +R ED Sbjct 199 PIRP---IIKKGSIIVRDLRLWHAGMPNLTQQTRVMLAMIHFAPWYRNRMRLELGEDVKS 255 Query 160 VGLSEARRDDGAG 172 + L E R+ G Sbjct 256 I-LEELEREGKLG 267 >ref|XP_747181.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL85143.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=291 GENE ID: 3504528 AFUA_8G00230 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 20/101 (19%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ +HRD DA L +H + A PP +++V PL TE+NGATE LGSH Sbjct 125 AQPFHRD-------DATHPL--MHYQPLEA--PPVSLSVIFPLTEFTEENGATEVILGSH 173 Query 87 MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRG 125 W +V P RD + L + G ++V R VH G Sbjct 174 RWTEVG-------TPERDQAVLATMDPGDVLIVRQRVVHAG 207 >dbj|BAD20765.1| hypothetical protein [Streptomyces kanamyceticus] emb|CAE46944.1| hypothetical protein [Streptomyces kanamyceticus] emb|CAF31594.2| putative kanamycin biosynthetic protein [Streptomyces kanamyceticus] Length=285 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 16/101 (15%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEE-------------AEAPLRDH 105 PP+ + V +PL T +NG+TE+ GSH+ DE P+R Sbjct 145 PPYCLCVDVPLIDFTLENGSTEYWPGSHVLNPDECYDERGCVLPAELERRRAVAPPVR-- 202 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 F +P GS ++ D R HRG NLS R +L + + W+ Sbjct 203 -FPIPVGSVVIRDGRLWHRGVPNLSAAPRPLLAMTHYTEWF 242 >ref|XP_001261651.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW19754.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=291 GENE ID: 4588684 NFIA_093740 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 20/101 (19%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ +HRD DA L +H + A PP +++V PL TE+NGATE LGSH Sbjct 125 AQPFHRD-------DATHPL--MHHQPLEA--PPISLSVIFPLTEFTEENGATEVILGSH 173 Query 87 MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRG 125 W +V P RD + L + G ++V R VH G Sbjct 174 RWMEVG-------TPERDQAVLATMDPGDVLVVRQRVVHAG 207 >ref|XP_001418352.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96645.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=566 GENE ID: 5002231 OSTLU_92828 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 7/100 (7%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEE----AEAPLRDHSFLLPRGSFIL 116 NVFI + +G T F GSH W +V E A AP L P GS ++ Sbjct 453 FNVFINTAKVETIDGPTAFIHGSHEWDHDACYVSTPERKAQALAPRTQPELLFP-GSVLI 511 Query 117 VDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED 156 DYR +H+G N S R RS+ +++ D N+ +D Sbjct 512 YDYRVMHKGGANDSARRRSLAYVMFCSRRARDSWNFPLDD 551 >ref|YP_629546.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] gb|ABF88170.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] Length=395 GENE ID: 4102795 MXAN_1289 | phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] (10 or fewer PubMed links)  Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 48/173 (27%), Positives = 73/173 (42%), Gaps = 24/173 (13%) Query 62 AINVFIPLQHLTEDNGATE----------------FTLGSHMWGDVWVDDEEAEAPLRDH 105 +I + IPL +T DNG E FT G+H + + P R Sbjct 165 SIAINIPLVDVTPDNGPMEVWPGTHQPPSEGRLAPFTTGAHRIDEPTLKSLVRRIPSR-- 222 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA 165 ++ RG+ ++ D+R VHRGT NL++ R ML L ++ Y G L+ + Sbjct 223 KLVMRRGAVLIRDHRMVHRGTPNLADAPRYMLSLY---CIAAEQVPYRLLSDAGATLALS 279 Query 166 RRDDGAGGGPEAAIQRRVLRALTVSEVGPSGEVCDLGTDEHDLWLRERMWWGL 218 R G G G AA++ R L L + +G E C L ++ +W L Sbjct 280 LRRMGRGSG--AAVRHRRLFDLG-AVLGRVVEECSLSDRDYRRTFSAELWASL 329 >ref|ZP_01627852.1| hypothetical protein MGP2080_02500 [marine gamma proteobacterium HTCC2080] gb|EAW39460.1| hypothetical protein MGP2080_02500 [marine gamma proteobacterium HTCC2080] Length=288 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 I+V L TE+NGAT GSH+ G D E+ P +PRGS ++ T+ Sbjct 161 ISVLWALDDFTEENGATRVIPGSHLSGPHPDDAEQTSYPAE-----MPRGSMVVYLGSTL 215 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N S++ R L+ Y W N Sbjct 216 HGGGANRSDKPRRALVNTYALGWLRQEEN 244 >ref|XP_001257330.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW15433.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=304 GENE ID: 4583844 NFIA_047690 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 16/105 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD 104 P A V +PL +T +NG+TE LG+H M GD + +D+ E +R Sbjct 149 PFAYVVNVPLIEMTPENGSTEIWLGTHINSGLHVQEGMHGDRASGRIKLDELEKRRAVRP 208 Query 105 HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 ++P+G+ +L D R H G N +++ R ML +I+ W+ + Sbjct 209 PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMIHFAPWYRN 253 >gb|AAD32731.1| MmcH [Streptomyces lavendulae] Length=254 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 5/138 (3%) Query 34 ASLLFPPDARFHLTDVHTRASGAFLP-PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW 92 A++ P +R HL T A + P P N L TEDNGAT GSH+ G Sbjct 101 ANIAGPGGSRMHLHADQTFARPPWPPYPLVANSMWMLDDFTEDNGATRLVPGSHLLGR-Q 159 Query 93 VDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 D + E + P GS ++ D R H+ N ++R R ++ Y R + + N+ Sbjct 160 PDYDRGEGNTETVAVCAPAGSVMVFDGRLWHQTGANTTDRPRHGILNYYCRGYVRQQQNF 219 Query 153 GT---EDYGGVGLSEARR 167 + ED E RR Sbjct 220 FSGLREDVATRATPELRR 237 >ref|XP_731501.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293] gb|EAL84211.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293] Length=152 GENE ID: 3503644 AFUA_6G00540 | conserved hypothetical protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 16/107 (14%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD 104 P A + IPL +T +NG+TE LG+H M GD + +D+ E +R Sbjct 26 PFAYVINIPLIEMTPENGSTEIWLGTHIDSGLHIQEGMHGDRASGRIKLDELEKRRAVRP 85 Query 105 HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRT 150 ++P+G+ +L D R H G N +++ R ML +I G H +T Sbjct 86 PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMINGLEGEHFQT 132 >ref|XP_001227983.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51] gb|EAQ83652.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51] Length=251 GENE ID: 4396037 CHGG_10056 | hypothetical protein [Chaetomium globosum CBS 148.51] Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 29/89 (32%), Positives = 38/89 (42%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 I + + T NGAT GSH+WGD + E A L RG +L T+ Sbjct 114 IGMLVAAVDTTYANGATLVVPGSHLWGDARIAQEHEVAAAE-----LSRGEALLFLTSTL 168 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N + R+M + Y RSW N Sbjct 169 HAGGANTTPDPRTMYAIFYCRSWVRPEAN 197 >ref|YP_001414577.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS64920.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=274 GENE ID: 5453899 Plav_3316 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 30/86 (34%), Positives = 39/86 (45%), Gaps = 11/86 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWG----DVWVDDEEAEAPLRDHSFLLPRGSFI 115 P AIN L T +NGAT GSH D VD + + P P GSFI Sbjct 143 PLAINALFCLDDFTTENGATYVLPGSHKQSAYPSDATVDALKVQIPA-------PAGSFI 195 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++D H G VN ++R R + +Y Sbjct 196 ILDCMLYHSGGVNRTDRERRAVNHVY 221 >ref|XP_001208474.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] gb|EAU37866.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] Length=294 GENE ID: 4315665 ATEG_01109 | conserved hypothetical protein [Aspergillus terreus NIH2624] Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 13/100 (13%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFL----------- 108 P A V I L + +NGATE LGSH+ D V D + L Sbjct 148 PFAFCVNINLVDTSPENGATEVWLGSHIDTDQSVLDHSVKHKQVKADLLEARRKISPGIQ 207 Query 109 --LPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LP+GS ++ D+R H G N ++ R ML+ I +W+ Sbjct 208 PGLPKGSLVIRDFRLWHAGMPNQTDDPRVMLVTIQFANWY 247 >ref|XP_001549420.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10] gb|EDN33467.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10] Length=311 GENE ID: 5429904 BC1G_12148 | hypothetical protein [Botryotinia fuckeliana B05.10] Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 5/80 (6%) Query 66 FIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 + T DNGAT GSH+W D + E P+ ++P GS + H G Sbjct 167 MVSFDDFTADNGATTVIPGSHLWSDERIPTREEMIPV-----IMPAGSMVYFLNTLWHSG 221 Query 126 TVNLSNRTRSMLMLIYGRSW 145 N SN+ R + + Y + W Sbjct 222 GANTSNKARRSITVQYCQPW 241 >ref|XP_001396026.1| Gene info hypothetical protein An12g09750 [Aspergillus niger] emb|CAL00879.1| Gene info unnamed protein product [Aspergillus niger] Length=338 GENE ID: 4986328 An12g09750 | hypothetical protein [Aspergillus niger CBS 513.88] (10 or fewer PubMed links)  Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 17/107 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHM----------------WGDVWVDDEEAEAPLR 103 P A + +PL +T +NG+TE LG+H G + V + E +R Sbjct 182 PFAYVINVPLVTMTPENGSTEIWLGTHADSGLHLQEGAHGADRASGRIKVQELEKRRAVR 241 Query 104 -DHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 ++P+GS ++ D R H G N + R ML +I+ W+ +R Sbjct 242 MPCQSVVPKGSLVIRDLRLWHAGMGNWTGNVRVMLAMIHFAPWYRNR 288 >ref|ZP_00112501.1| hypothetical protein Npun02000257 [Nostoc punctiforme PCC 73102] Length=277 Score = 43.9 bits (102), Expect = 0.006, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 6/129 (4%) Query 19 DSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGA 78 D P Q HRD LF R + D P +A+ V PL +T +NG Sbjct 110 DVPFQGSDYQEIHRDFRPLFSDGLRPAVGD------RIVTPLYALAVNFPLVEVTAENGP 163 Query 79 TEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLM 138 + G+H+ + A + SF + G ++ +HRG+ N +N+ R M++ Sbjct 164 FQMARGTHVLPREEGLKKVASGEIPMESFYMQPGDVMVRSPLALHRGSPNRTNQPRPMVV 223 Query 139 LIYGRSWWH 147 + Y W H Sbjct 224 MGYAMHWLH 232 >ref|XP_001558610.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10] gb|EDN33003.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10] Length=384 GENE ID: 5439200 BC1G_02681 | hypothetical protein [Botryotinia fuckeliana B05.10] Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 18/104 (17%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH-MW--------GDVWVDDE------EAEAPLRD 104 P I +F+ L ++ NG+TE GSH W G WV E P + Sbjct 149 PTCIELFMYLHEVSPTNGSTEIWPGSHHEWNLGNHESHGRGWVKASAFNRRAEHSPPFQP 208 Query 105 HSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 +P+GS + D R H G NLS++ R ML IY W+ + Sbjct 209 ---TIPKGSIAIRDLRLWHAGMPNLSDQNRIMLGFIYFPRWYRN 249 >ref|YP_459107.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594] gb|ABC64310.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594] Length=293 GENE ID: 3869292 ELI_11090 | hypothetical protein [Erythrobacter litoralis HTCC2594] Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 38/140 (27%), Positives = 51/140 (36%), Gaps = 40/140 (28%) Query 26 VAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGS 85 AQ WH D S P R PP +++ F L T +NGATE GS Sbjct 124 TAQPWHFDDSHCDLPRPR---------------PPLSLSTFWSLTETTAENGATEIIPGS 168 Query 86 HMWGDVWVDDEEAEAPLRDHSFL--------------------LPRGSFILVDYRTVHRG 125 H+WG DE E FL +P GS ++ HRG Sbjct 169 HLWG-----DERPEGASGPDDFLTGKTDKAGGAGTHPDAIKATMPPGSLMIAKGTLWHRG 223 Query 126 TVNLSNRTRSMLMLIYGRSW 145 N S+ R ++ + + W Sbjct 224 GANTSHDRRLIVTPQFCKGW 243 >ref|ZP_01618410.1| hypothetical protein GP2143_06913 [marine gamma proteobacterium HTCC2143] gb|EAW29758.1| hypothetical protein GP2143_06913 [marine gamma proteobacterium HTCC2143] Length=279 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 5/83 (6%) Query 69 LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVN 128 L T NGATE GSH+W D D E + + ++P GS ++ +HRG N Sbjct 156 LDDFTTTNGATEVVPGSHLWAD---DREPQQHEI--EQVIMPAGSALVFAGSLIHRGGAN 210 Query 129 LSNRTRSMLMLIYGRSWWHDRTN 151 +S +R + Y W N Sbjct 211 VSASSRLAVTPQYCMPWLRQIEN 233 >gb|EAT83717.1| hypothetical protein SNOG_08549 [Phaeosphaeria nodorum SN15] Length=313 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 20/115 (17%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAE----APLRDHSFLL------ 109 P A+ V +PL + +NG+TE LG+H + D+E E A R S +L Sbjct 151 PFALVVNVPLVKMEVENGSTEIWLGTH--NGTTIADQEGEHGDRASGRIKSHILEARREV 208 Query 110 --------PRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED 156 +GS I+ D R H G NLS+ R ML I+ W+ ++ D Sbjct 209 RPPTQPTVKKGSIIIRDLRLWHGGKPNLSSVPRVMLAFIHFAPWYRNQMEVEIAD 263 >ref|XP_367927.2| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15] gb|EDJ97281.1| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15] Length=330 GENE ID: 2683758 MGG_07831 | hypothetical protein [Magnaporthe grisea 70-15] (10 or fewer PubMed links)  Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 17/106 (16%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A+ V +PL +T NG+TE LG+H D+ + E A +R Sbjct 156 PFALVVNVPLVTMTPHNGSTELWLGTHHLSDLSAQEGAHGERASGRIRQRLLDARRSTRG 215 Query 108 ----LLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHD 148 ++ +GS ++ D R H G NLS + R ML I+ W+ + Sbjct 216 PCQPVVKKGSVVVRDLRLWHAGMPNLSRDEVRVMLAFIHFAPWYRN 261 >ref|XP_001265897.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW24000.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=318 GENE ID: 4593154 NFIA_035680 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 42.0 bits (97), Expect = 0.025, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P V + L T NGATE G+H DV V + + +R Sbjct 173 PFGFCVNVNLVETTTTNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP 232 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LLP+GS I+ D+R H G N ++ R ML+ + W+ Sbjct 233 LLPKGSIIIRDFRLWHAGMPNQTDEPRVMLVTVLFARWY 271 >ref|XP_001593774.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980] gb|EDO02725.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980] Length=322 GENE ID: 5489739 SS1G_05202 | hypothetical protein [Sclerotinia sclerotiorum 1980] Score = 41.6 bits (96), Expect = 0.033, Method: Compositional matrix adjust. Identities = 31/127 (24%), Positives = 47/127 (37%), Gaps = 20/127 (15%) Query 25 RVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLG 84 + AQ H D L+ P R P + + T +NGAT G Sbjct 152 QTAQSIHCDDGLIALPRPR---------------PLIGVGTMVSFDDFTAENGATSVIPG 196 Query 85 SHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 SH+W D + E P+ ++P GS + H G N S++ R + + Y + Sbjct 197 SHLWSDDRIPTREEMIPV-----IMPAGSMVYFLNTLWHSGGANTSDKPRRSITVQYCQP 251 Query 145 WWHDRTN 151 W N Sbjct 252 WIRTYEN 258 >ref|XP_001216755.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] gb|EAU31307.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] Length=363 GENE ID: 4353480 ATEG_08134 | conserved hypothetical protein [Aspergillus terreus NIH2624] Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 22/108 (20%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-------------EEAE------A 100 P A + +PL +T +NG+TE LG+H + V + EE E A Sbjct 208 PFAYVINVPLITMTPENGSTEVWLGTHTDTGLHVQEGLHGERASGRIKLEELEKRRAVRA 267 Query 101 PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 P + +P+GS ++ D R H G N + R ML +I+ SW+ + Sbjct 268 PCQP---TVPKGSIVIRDLRLWHAGIGNQTEIPRVMLAMIHFASWYRN 312 >dbj|BAE66236.1| unnamed protein product [Aspergillus oryzae] Length=325 Score = 41.2 bits (95), Expect = 0.043, Method: Compositional matrix adjust. Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 16/105 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHM---------------WGDVWVDDEEAEAPLRD 104 P A V +PL +T +NG+TE LG+H G + + E + +R Sbjct 170 PFAYVVNVPLITMTPENGSTEVWLGTHTDSGLHVQEGMHGERASGRIQLSALEKQRMIRP 229 Query 105 HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 ++P+G+ +L D R H G N ++ R ML +I+ W+ + Sbjct 230 PCQPVVPKGALVLRDLRLWHAGIGNQTDDVRVMLAMIHFAPWYRN 274 >ref|XP_360888.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15] gb|EDJ94682.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15] Length=432 GENE ID: 2676529 MGG_03431 | hypothetical protein [Magnaporthe grisea 70-15] (10 or fewer PubMed links)  Score = 41.2 bits (95), Expect = 0.049, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 3/92 (3%) Query 61 HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYR 120 + +N+ L +T++ GAT GSH+ V EE A + P GS +L+D R Sbjct 290 YVLNMMWYLTDVTDEKGATRIYPGSHVE---HVIPEEMNAVGKSIPAAAPAGSCVLLDSR 346 Query 121 TVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 T H VN + TR +++ + R + NY Sbjct 347 TWHSTGVNTTEETRPVILQSFCRFFVRQIENY 378 >ref|XP_749468.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL87430.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=318 GENE ID: 3506925 AFUA_2G03330 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 40.8 bits (94), Expect = 0.059, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P V + L T NGATE G+H DV V + + +R Sbjct 173 PFGFCVNVNLVGTTATNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP 232 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LLP+GS I+ D+R H G N ++ R ML+ + W+ Sbjct 233 LLPKGSIIIRDFRLWHAGMPNRTDEPRVMLVTVLFARWY 271 >ref|ZP_00419196.1| Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP] gb|EAM04358.1| Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP] Length=261 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 21/128 (16%) Query 15 SGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTE 74 S + PA A WHRD + + F D T I + +PLQ ++ Sbjct 126 SNITRKPAGIGPAIGWHRDCT-----NTYFASDDERT-----------IRMLLPLQEMSS 169 Query 75 DNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR 134 NG T GSH+ + D A ++ GS +++D + +H GT N S R Sbjct 170 RNGGTAVLSGSHLHMESTPQDLSAAI-----CPVVSPGSALVIDSKVLHGGTPNRSELDR 224 Query 135 SMLMLIYG 142 +++L +G Sbjct 225 DVIILQFG 232 >ref|ZP_01616112.1| hypothetical protein GP2143_18106 [marine gamma proteobacterium HTCC2143] gb|EAW33195.1| hypothetical protein GP2143_18106 [marine gamma proteobacterium HTCC2143] Length=346 Score = 40.8 bits (94), Expect = 0.063, Method: Compositional matrix adjust. Identities = 34/113 (30%), Positives = 47/113 (41%), Gaps = 25/113 (22%) Query 47 TDVHTRASGAFLPPHA--INVFIPLQHLTEDNGATEFTLGSH------MWGDVWVDDEEA 98 T+ +A+G PP+ ++ + L +TE GATE GSH WG + Sbjct 141 TEQAAKAAGQSWPPNTTTVSCSLALSEITEALGATEIYPGSHRETAVTTWG-------KG 193 Query 99 EAPL----------RDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 E P+ + S +P G D R HRG N SN R M+ L Y Sbjct 194 EQPVHHPEIVKNWGQPASMTIPAGGVCFRDPRMWHRGVKNSSNTPRPMIALTY 246 >dbj|BAE65945.1| unnamed protein product [Aspergillus oryzae] Length=276 Score = 40.4 bits (93), Expect = 0.083, Method: Compositional matrix adjust. Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 7/122 (5%) Query 47 TDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS 106 +D+ + +L +NV L + +NGAT + GSH W E EA Sbjct 122 SDLSLQCPDPWLSTWGLNVIWCLHDVYYENGATLYIPGSHHWKTKAEVPPEEEARKLLVP 181 Query 107 FLLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA 165 F GS I++D R H N++ ++ R++L Y + + N+ GVGLSE Sbjct 182 FEAKAGSIIVMDGRLWHTSGCNVTQDKERALLFGAYNAPFLRGQVNW------GVGLSEE 235 Query 166 RR 167 + Sbjct 236 TK 237 >emb|CAD18985.1| putative oxigenase [Streptomyces cattleya] Length=259 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 7/92 (7%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW-VDDEEAEAPLRDHS------FLLPR 111 PP AI V++ L T +NG + LGSH G V V EE + + + P Sbjct 145 PPEAITVWMALDDATVENGCVHYVLGSHRHGRVEHVRPEEGAVMIEARTEQEPVAYPAPA 204 Query 112 GSFILVDYRTVHRGTVNLSNRTRSMLMLIYGR 143 G ++ T+H NLS+ R +++Y R Sbjct 205 GDALVHSVNTLHGSGPNLSDGPRRAYVVVYVR 236 >ref|XP_001392916.1| Gene info hypothetical protein An08g08010 [Aspergillus niger] emb|CAK45692.1| Gene info unnamed protein product [Aspergillus niger] Length=292 GENE ID: 4983120 An08g08010 | hypothetical protein [Aspergillus niger CBS 513.88] (10 or fewer PubMed links)  Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 9/96 (9%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGD------VWVDDEEAEAPLRDHSFL---LP 110 P + + I L + +NGATE GSH D V E EA R + LP Sbjct 150 PFGLCININLVATSPENGATELWPGSHRDADPRDSDDTGVIPEIVEARRRVSPPVQPSLP 209 Query 111 RGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 +G+ I+ D+R H G N ++ R ML+ I+ +W+ Sbjct 210 KGAIIIRDFRLWHAGMPNRTDDPRVMLVTIHFPAWY 245 >ref|XP_001417798.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96091.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=280 GENE ID: 5002111 OSTLU_87319 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGD--VWVDDEEAEAPLRDHSF---LLPRGSF 114 P F+ LQ + D G T F G++ + + E E P+ + ++ RG Sbjct 164 PSVFTCFVALQDVERDMGPTLFIPGTNNAQAHVEFREGNEREGPVFRRPYELGVISRGDA 223 Query 115 ILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 L D RT+H GT N S+R R + + R+ Sbjct 224 TLFDSRTLHCGTENDSSRRRVLFYFSFQRA 253 >ref|ZP_01501800.1| Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815] gb|EAU98489.1| Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815] Length=277 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 38/156 (24%), Positives = 60/156 (38%), Gaps = 24/156 (15%) Query 10 ALAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPL 69 L ++G + P WHRD S H T T A N + + Sbjct 112 VLMQQNGIINRPDRQNYQVKWHRDLSYQ-------HWTSSKT---------IAFNALLCV 155 Query 70 QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH--SFLLPRGSFILVDYRTVHRGTV 127 T NGA+ +H ++ + +R H P GSFI++D HRG + Sbjct 156 DEFTLKNGASFVLPATH-----HIEAFPTDRFVRQHERQIAAPAGSFIVLDAMLYHRGGI 210 Query 128 NLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLS 163 N+SN R + + G + + N+ T + G+S Sbjct 211 NVSNDVRRAVNHLIGLPFLAQQVNFET-GFASTGMS 245 >ref|XP_001536248.1| Gene info predicted protein [Ajellomyces capsulatus NAm1] gb|EDN05262.1| Gene info predicted protein [Ajellomyces capsulatus NAm1] Length=221 GENE ID: 5442548 HCAG_08912 | predicted protein [Ajellomyces capsulatus NAm1] Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 5/80 (6%) Query 72 LTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSN 131 T DNGAT GSH+WG + E P+ + P+GS + T H G N S Sbjct 113 FTADNGATRVVTGSHLWGADRRPECEESTPM-----VCPQGSVVYFLATTWHCGGPNNSP 167 Query 132 RTRSMLMLIYGRSWWHDRTN 151 R L + Y + + N Sbjct 168 NPRKSLTVQYCQPYIRQIEN 187 >ref|ZP_01749022.1| hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2] gb|EBA13005.1| hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2] Length=215 Score = 38.5 bits (88), Expect = 0.26, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Query 65 VFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAP-LRDHSFLLPRGSFILVDYRTVH 123 V + L +E++GA E LGSH G V D +A A H RG +++D T+H Sbjct 125 VRVHLDDTSEEDGAMEIALGSHRDGKVMADQSQAVADRYPKHVCPAQRGDILILDMLTLH 184 Query 124 RGTVNLSNRTRSMLMLIYG 142 R TR L + Y Sbjct 185 RSLPATVPSTRRTLRIDYA 203 >ref|XP_572755.1| Gene info hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] gb|AAW45448.1| Gene info expressed protein [Cryptococcus neoformans var. neoformans JEC21] Length=327 GENE ID: 3259545 CNI00020 | hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] (10 or fewer PubMed links)  Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A V + L + NG+T+ LG+H D+ + E A ++ Sbjct 175 PFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISP 234 Query 108 ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 +P+GS I+ D R H G N ++ R ML +I+ W+ R Sbjct 235 PLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPWYRQR 280 >ref|XP_774078.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans B-3501A] gb|EAL19431.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans B-3501A] Length=327 GENE ID: 4937528 CNBH0030 | hypothetical protein [Cryptococcus neoformans var. neoformans B-3501A] Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A V + L + NG+T+ LG+H D+ + E A ++ Sbjct 175 PFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISP 234 Query 108 ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 +P+GS I+ D R H G N ++ R ML +I+ W+ R Sbjct 235 PLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPWYRQR 280 >ref|ZP_00976791.1| COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Burkholderia cenocepacia PC184] Length=275 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 41/143 (28%), Positives = 56/143 (39%), Gaps = 30/143 (20%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 72 FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ 113 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P R + L G + Sbjct 114 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPARAVACPLMPGDCTVHA 173 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 RT+H NLS++ R L + Sbjct 174 GRTLHAAGANLSDQPRYAYALNF 196 >ref|XP_682496.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4] gb|EAA61518.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4] Length=416 GENE ID: 2868057 AN9227.2 | hypothetical protein [Aspergillus nidulans FGSC A4] (10 or fewer PubMed links)  Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 39/136 (28%), Positives = 55/136 (40%), Gaps = 28/136 (20%) Query 16 GASDSPATARVAQHWHRDASLLFP------PDARFHLTDVHTRASGAFLPPHAINVFIPL 69 GA A + AQ HRD P PDA P +IN + L Sbjct 227 GAVMELAPSNPAQPLHRDMRFSHPIVEYLKPDA----------------PATSINFLVAL 270 Query 70 QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNL 129 T +NGAT LGSH W + + + +A +R L+ G +L+ T+H G Sbjct 271 SPFTAENGATHVILGSHKWQN--LSNVSMDATVR---ALMNPGDALLITDSTIHCGGAET 325 Query 130 S-NRTRSMLMLIYGRS 144 + TR +L + G S Sbjct 326 TGTETRRLLTITMGIS 341 >ref|XP_953820.1| Gene info hypothetical protein TA06590 [Theileria annulata strain Ankara] emb|CAI73142.1| Gene info hypothetical protein [Theileria annulata] Length=502 GENE ID: 3863425 TA06590 | hypothetical protein [Theileria annulata strain Ankara] (10 or fewer PubMed links)  Score = 38.1 bits (87), Expect = 0.40, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 23/88 (26%) Query 63 INVFIPLQHLTEDNGATEFTLGSH---------MWGDVWVDDEEAEAPLRDHSFLLPRGS 113 IN+ +PLQ + NG +F G+H G V VD E + + + S L Sbjct 381 INIVVPLQDTNKVNGRMQFLPGTHNEPSRLNPYTCGPVGVDLNEGDVLIYNSSVL----- 435 Query 114 FILVDYRTVHRGTVNLSNRTRSMLMLIY 141 HR T+N SN +SM++ Y Sbjct 436 ---------HRNTINESNVCQSMVVFTY 454 >ref|ZP_01867932.1| Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1] gb|EDL53417.1| Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1] Length=252 Score = 38.1 bits (87), Expect = 0.41, Method: Compositional matrix adjust. Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 2/87 (2%) Query 57 FLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-EEAEAPLRDHSFL-LPRGSF 114 F H +N L L DNGA G+H+ ++ D E+ EA D +L P GS Sbjct 133 FPKVHLVNSIWALDDLCRDNGAPRIIPGTHLRPELPEDVLEDTEATHPDEVYLECPAGSI 192 Query 115 ILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ + T H GTVN R +L +Y Sbjct 193 MIFNAHTWHGGTVNTLGTRRRVLHGLY 219 >ref|XP_001161510.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 1 [Pan troglodytes] Length=277 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >emb|CAI10841.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] Length=255 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|NP_001094347.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform c [Homo sapiens] gb|AAH51300.1| UniGene infoGene info PHYHD1 protein [Homo sapiens] gb|EAW87847.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_d [Homo sapiens] Length=270 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 37.4 bits (85), Expect = 0.58, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|XP_001161891.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 5 [Pan troglodytes] Length=270 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 37.4 bits (85), Expect = 0.61, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|NP_001094346.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform a [Homo sapiens] pdb|2OPW|A Related structures Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 (Apo) gb|AAH53853.1| UniGene infoGene info PHYHD1 protein [Homo sapiens] emb|CAI10842.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] gb|EAW87844.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_a [Homo sapiens] Length=291 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >ref|XP_001161929.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 6 [Pan troglodytes] ref|XP_001161970.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 7 [Pan troglodytes] ref|XP_001162007.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 8 [Pan troglodytes] Length=291 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 37.4 bits (85), Expect = 0.68, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >ref|XP_001610743.1| Gene info conserved hypothetical protein [Babesia bovis] gb|EDO07175.1| Gene info conserved hypothetical protein [Babesia bovis] Length=1596 GENE ID: 5478977 BBOV_IV008210 | conserved hypothetical protein [Babesia bovis] Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 23/89 (25%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHM---------WGDVWVDDEEAEAPLRDHSFLLPRG 112 + V + L + E+NG +F G+H +G V VD L +G Sbjct 1483 GVTVVLALDCVEENNGRIQFLPGTHKTQPEINPYKFGKVGVD--------------LNKG 1528 Query 113 SFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ D R +HR T+N SN+ S L+ Y Sbjct 1529 DVLIFDSRVLHRNTINESNKCCSCLVFSY 1557 >ref|XP_664422.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4] gb|EAA58217.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4] Length=271 GENE ID: 2870496 AN6818.2 | hypothetical protein [Aspergillus nidulans FGSC A4] (10 or fewer PubMed links)  Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 11/98 (11%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP----RGSFI 115 P A+N+ L + +NGAT + GSH W + E P L P GS I Sbjct 137 PWAVNIIWCLSDVYFENGATLYIPGSHRW------KRKNEVPSNAVEMLKPFVAKAGSII 190 Query 116 LVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY 152 +D R H N++ ++ R++L Y + + N+ Sbjct 191 AMDARVWHTSGANITKDQDRALLFAFYSAPFLRQQVNW 228 >ref|XP_001418033.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96326.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=326 GENE ID: 5002112 OSTLU_15487 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 39/113 (34%), Positives = 52/113 (46%), Gaps = 14/113 (12%) Query 56 AFLPPHA--INVFIPLQHLTEDNGATEFTLG-----SHMWGDVWVDDEEAEAPL---RDH 105 AF PHA ++FI LQ + + G T F LG SH V +EE A L R Sbjct 188 AFDAPHAPLYSLFIALQDVIPEMGPTCFVLGTQDKASHDAFPVTKWNEEQFARLAKSRCC 247 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD---RTNYGTE 155 L +G +L D RT H+G N R R+++ L + + D R N G E Sbjct 248 DAELRKGDAVLYDARTFHQGGANEYGR-RALMTLTFLKPPIPDAPTRRNAGAE 299 >ref|ZP_01103950.1| conserved hypothetical protein [gamma proteobacterium KT 71] gb|EAQ96749.1| conserved hypothetical protein [Congregibacter litoralis KT71] Length=315 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 6/95 (6%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGD-VWVDDEEAEAPLRDHSFLLPRGSFILV 117 P ++ + TEDNGAT GSH+WG+ + D + ++P GS IL Sbjct 173 PVLSVATVFAIDDFTEDNGATVAIPGSHLWGEGRFPTDSDPRV-----KAVMPAGSCILF 227 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 H G N S +R Y + + NY Sbjct 228 LGNLWHGGGENYSGESRMAFTGQYCEPYLRTQENY 262 >ref|NP_962094.1| Gene info hypothetical protein MAP3160 [Mycobacterium avium subsp. paratuberculosis K-10] gb|AAS05708.1| Gene info hypothetical protein MAP_3160 [Mycobacterium avium subsp. paratuberculosis K-10] Length=277 GENE ID: 2721210 MAP3160 | hypothetical protein [Mycobacterium avium subsp. paratuberculosis K-10] (10 or fewer PubMed links)  Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P A + T DNGAT GSH WG ++ P+ ++P GS +L Sbjct 143 PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPAGSCVLFVG 197 Query 120 RTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N ++R R + Y + W Sbjct 198 TLWHGGGANTTDRDRLAVTAQYCQPW 223 >ref|ZP_01034759.1| hypothetical protein ROS217_22977 [Roseovarius sp. 217] gb|EAQ27440.1| hypothetical protein ROS217_22977 [Roseovarius sp. 217] Length=265 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 9/85 (10%) Query 69 LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT 126 L T +NGAT GS + +D+ +A ++PRGS + TVH G Sbjct 144 LDDFTAENGATRVVPGSQDLRPIKSITEDQITQA-------VMPRGSVLFYLGATVHAGG 196 Query 127 VNLSNRTRSMLMLIYGRSWWHDRTN 151 N SN R L+ Y W N Sbjct 197 ANRSNAPRKGLITTYSLGWLRQEEN 221 >ref|ZP_01721295.1| hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1] gb|EAZ79312.1| hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1] Length=245 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Query 69 LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH----SFLLPRGSFILVDYRTVHR 124 L TE+NGAT SH W + + DE PL H + P GS + + H Sbjct 138 LDDFTENNGATRIVPSSHKWSE--LPDEALINPLDKHPKEIKIIAPAGSVFIFNSHVWHG 195 Query 125 GTVNLSNRTR 134 GT+N +++ R Sbjct 196 GTMNETSKIR 205 >ref|XP_001224329.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51] gb|EAQ88496.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51] Length=613 GENE ID: 4392423 CHGG_05115 | hypothetical protein [Chaetomium globosum CBS 148.51] Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 5/100 (5%) Query 54 SGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGS 113 SG P ++N + L T++NGAT GSH W D+ ++ P + G Sbjct 472 SGPDAPEASVNFVVALTEFTDENGATRVIPGSHRWQDL----QQNGTPEDTIPAEMEVGD 527 Query 114 FILVDYRTVHRGTVN-LSNRTRSMLMLIYGRSWWHDRTNY 152 + + VH G N + TR + L++ S+ Y Sbjct 528 ACFITGKVVHGGGANRTKDFTRRAITLVFQCSYLTPEEAY 567 >ref|YP_366487.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] gb|ABB05843.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] Length=291 GENE ID: 3733825 Bcep18194_C6796 | Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 31/108 (28%), Positives = 43/108 (39%), Gaps = 13/108 (12%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD FPP A G P N+ I L TE+NGAT GS Sbjct 131 AQMLHRDVGN-FPPLC----------ALGINGPTVFTNLMIALTRFTEENGATRIIPGSQ 179 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR 134 W + + D + P + + G +L + +H G N++ R Sbjct 180 NWDEDYFDSK--GTPDMTIAAEMDAGDALLFSGKVIHGGGANVTQNER 225 >ref|XP_001261676.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW19779.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=267 GENE ID: 4588607 NFIA_093990 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 3/95 (3%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT 121 A+NV L +TE+NGAT + GS+ W W +D AP F G +++D R Sbjct 127 AVNVIWCLTRMTEENGATLYIPGSNKWT-TW-EDVPDNAPDLLVPFEADAGDIVVIDGRL 184 Query 122 VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE 155 H N++ + R++L Y TN+ + Sbjct 185 WHTSGSNVTKDEDRAILFAYYSAPHMRPLTNWSAK 219 >ref|XP_001267631.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW25734.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=297 GENE ID: 4594309 NFIA_045530 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDV 91 PP AI+ + L T+DNG T LGSH W ++ Sbjct 149 PPLAISFILALTDFTKDNGGTRVILGSHKWPEI 181 >ref|YP_883146.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] gb|ABK69454.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] Length=287 GENE ID: 4527072 MAV_3990 | phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P A + T DNGAT GSH WG ++ P+ ++P GS +L Sbjct 153 PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPVGSCVLFVG 207 Query 120 RTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N ++R R + Y + W Sbjct 208 TLWHGGGANTTDRDRLAVTAQYCQPW 233 >emb|CAL54074.1| unnamed protein product [Ostreococcus tauri] Length=330 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 21/98 (21%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRD-------------HS 106 P F+ LQ + D G T F G++ + +A A R+ Sbjct 213 PSVYTCFVALQDVDADMGPTLFIPGTN--------NAQAHAEFREGLERGGPVLQRPNEL 264 Query 107 FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 L+ RG L D RT+H GT N S+R R + + R+ Sbjct 265 GLISRGDATLFDSRTLHCGTENASSRRRVLFYFSFQRT 302 >ref|NP_001069711.1| UniGene infoGene info hypothetical protein LOC540828 [Bos taurus] gb|AAI22728.1| UniGene infoGene info Similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos taurus] Length=291 GENE ID: 540828 MGC152146 | similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos taurus] Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 21/120 (17%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHM-----------WGDVWVDDE 96 H AS + P + ++I L+ +NG F GSH G V Sbjct 156 HQDASFLYTEPLGRVLGLWIALEDAMLENGCLWFIPGSHTGGVSRRMVRTPAGSVPGTSF 215 Query 97 EAEAPLRDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSWWHD 148 P+RD+S +P RG+ +L+ VH+ NLS+R+R LM G W D Sbjct 216 LGSEPIRDNSLFVPTPVLRGALVLIHGEVVHKSEQNLSDRSRQAYTFHLMEAAGTIWSPD 275 >ref|ZP_01562106.1| Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia MC0-3] gb|EAV60109.1| Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia MC0-3] Length=303 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 40/143 (27%), Positives = 55/143 (38%), Gaps = 30/143 (20%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 100 FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ 141 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P + L G + Sbjct 142 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHA 201 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 RT+H NLS++ R L + Sbjct 202 GRTLHAAGANLSDQPRYAYALNF 224 >ref|YP_621422.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054] ref|YP_839910.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia HI2424] gb|ABF76449.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054] gb|ABK13017.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia HI2424] Length=303 GENE ID: 4092656 Bcen_1544 | Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054] Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 40/143 (27%), Positives = 55/143 (38%), Gaps = 30/143 (20%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 100 FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ 141 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P + L G + Sbjct 142 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHA 201 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 RT+H NLS++ R L + Sbjct 202 GRTLHAAGANLSDQPRYAYALNF 224 >ref|YP_001539320.1| Gene info Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205] gb|ABW00330.1| Gene info Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205] Length=264 GENE ID: 5705419 Sare_4561 | Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205] Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 22/104 (21%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW------------VD-DEEAEAP----- 101 P +NV + L +TE NG F GSH G + +D DE + P Sbjct 125 PSQVNVALFLDDVTEFNGPVIFLRGSHQLGPLERPGSTEGHESGHIDPDEYSLTPAELAD 184 Query 102 -LRDHSFLLP---RGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ H + P RG +L + VH N+S R +L+L Y Sbjct 185 LVKQHEMVSPKGARGGVLLFSSQIVHGSGTNISPFARRLLILTY 228 >ref|XP_963174.1| Gene info hypothetical protein [Neurospora crassa OR74A] emb|CAD70289.1| conserved hypothetical protein [Neurospora crassa] gb|EAA33938.1| Gene info conserved hypothetical protein [Neurospora crassa OR74A] Length=336 GENE ID: 3879322 NCU09596.1 | hypothetical protein [Neurospora crassa OR74A] (10 or fewer PubMed links)  Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 29/115 (25%), Positives = 47/115 (40%), Gaps = 28/115 (24%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH------------------------MWGDVWVDD 95 P A+ + +PL +T DNG+TE LG+H + ++ Sbjct 174 PFALVINVPLITMTPDNGSTELWLGTHNLAGEDSSGHAAQEGAHGERASGRIRPELLARR 233 Query 96 EEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVN-LSNRTRSMLMLIYGRSWWHDR 149 AP + + +GS ++ D R H G N S R ML +I+ W+ +R Sbjct 234 AAVRAPCQP---TVRKGSIVVRDLRLWHAGMPNRTSGEVRIMLAMIHFAPWYRNR 285 >ref|XP_313252.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST] gb|EAA08759.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST] Length=287 GENE ID: 1274172 AgaP_AGAP003514 | AGAP003514-PA [Anopheles gambiae str. PEST] (10 or fewer PubMed links)  Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 16/92 (17%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEEA----------EAPLRDHS 106 P I +IPL+ T NG F GSH G W+ + + APL S Sbjct 160 PSTTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRWIRNPDKGADELLVYDRPAPLYPQS 219 Query 107 FL----LPRGSFILVDYRTVHRGTVNLSNRTR 134 + GS +L+ + VHR N S+R+R Sbjct 220 NFVAVPVKAGSCVLIHSQAVHRSDANKSDRSR 251 >emb|CAL54075.1| unnamed protein product [Ostreococcus tauri] Length=346 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 30/95 (31%), Positives = 42/95 (44%), Gaps = 17/95 (17%) Query 60 PHA--INVFIPLQHLTEDNGATEFTLGSH-----------MWGDVWVDDEEAEAPLRDHS 106 PHA ++FI LQ + + G T F LG+ WGD EA A Sbjct 217 PHAPLYSLFIALQDVVPEMGPTCFVLGTQDRASHDAFPNAKWGDAQF---EALAGREWCD 273 Query 107 FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 L +G +L D RT H+G N R R+++ L + Sbjct 274 ATLRKGDAVLYDARTFHQGGANEHGR-RALMTLTF 307 >ref|ZP_01662317.1| phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J] ref|ZP_02009228.1| Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D] gb|EAX44268.1| phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J] gb|EDN39860.1| Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D] Length=292 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 5/90 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 + + I + +E+NG T GSH W D + +E P + G ++ T Sbjct 151 VQIMIAITDFSEENGGTLVIPGSHKWDDERMPKQEEAIPTS-----MEAGDALIFIGSTY 205 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 H G N SN R+ L + Y + N+ Sbjct 206 HGGGQNRSNAPRTGLTMSYDLAILRQEENH 235 >ref|YP_001339697.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] gb|ABR69762.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] Length=267 GENE ID: 5365525 Mmwyl1_0830 | Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] Score = 34.7 bits (78), Expect = 3.8, Method: Compositional matrix adjust. Identities = 22/102 (21%), Positives = 48/102 (47%), Gaps = 11/102 (10%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDDEEAEAPLRDHSFLLPRGSFI 115 P A+N + T DNG+T+ GSH G+ ++++ + + F + G ++ Sbjct 139 PIALNALYCVCDFTFDNGSTQVLPGSHKIEKFPGNKFLEENKMQ-------FYVSSGDYL 191 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 L+D H G++N ++ R + +Y + ++ + D+ Sbjct 192 LIDSMLYHSGSINKTSDRRIGINNVYSTPIIRRQIDFNSSDF 233 >ref|YP_001414417.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS64760.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=302 GENE ID: 5453830 Plav_3154 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 N + T++NGAT+ GS W D + E+ + +P GS ++ Sbjct 137 FNTIWAISDFTKENGATQVCPGSLGWPDDYQPTED-----QIGYAEMPAGSVLVYSGGVF 191 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N+SN R + + Y W N Sbjct 192 HGGGANVSNGDRIGINITYTLGWLRQEEN 220 >ref|XP_747157.2| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL85119.2| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=309 GENE ID: 3504545 AFUA_8G00480 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 3/95 (3%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT 121 A+NV L +T++NGAT + GS+ W W +D AP F G +++D R Sbjct 169 AVNVIWCLTRMTKENGATLYIPGSNKWT-TW-EDVPDNAPDLLVPFEADAGDIVVIDGRL 226 Query 122 VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE 155 H N++ + R++L Y TN+ + Sbjct 227 WHTSGSNVTEDEDRAILFAYYSAPHMRPLTNWSAK 261 >ref|ZP_01626096.1| hypothetical protein MGP2080_09703 [marine gamma proteobacterium HTCC2080] gb|EAW41112.1| hypothetical protein MGP2080_09703 [marine gamma proteobacterium HTCC2080] Length=279 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%) Query 59 PPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEAEAPLRDH- 105 PPH I+ F L T +NGATE SH+W + V D+ + DH Sbjct 124 PPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDGVDEAADHE 183 Query 106 ------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + L GS ++ HRG NLS +R ++ Y W Sbjct 184 CHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW 229 >ref|YP_508892.1| Gene info Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1] gb|ABD53867.1| Gene info Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1] Length=230 GENE ID: 3933394 Jann_0950 | Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1] Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 20/120 (16%) Query 41 DARFHLTDVHTRAS------GAFLP----PHAINVFIPLQHLTEDNGAT---------EF 81 + +F + HT AS GA++P P+ ++V+I L T +NG+ E Sbjct 91 NEQFVVKGPHTGASFAWHQDGAYVPFAHKPY-LSVWIALDDATLENGSLSCLPRDLDREG 149 Query 82 TLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 + H W D+ + + P + P G+ ++ T+HR N +NR R + Y Sbjct 150 HIDPHHWNDIGKEKVGYDGPDPGEALPCPAGTMVIFSSLTLHRSGANTTNRPRRAYLAQY 209 >ref|XP_001657669.1| Gene info conserved hypothetical protein [Aedes aegypti] gb|EAT48860.1| Gene info conserved hypothetical protein [Aedes aegypti] Length=286 GENE ID: 5567769 AaeL_AAEL000102 | conserved hypothetical protein [Aedes aegypti] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 20/94 (21%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--------------DVWVDDEEAEAPLRD 104 P I +IPL+ T NG F GSH G ++ + D APL Sbjct 159 PSSTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRYIRNPDKSSPELLIYDR--PAPLYP 216 Query 105 HSFL----LPRGSFILVDYRTVHRGTVNLSNRTR 134 S + GS +L+ + VHR N S+R+R Sbjct 217 QSNFCAAPVKAGSLVLIHSQVVHRSDANRSDRSR 250 >gb|AAR37958.1| conserved hypothetical protein [uncultured marine bacterium 561] Length=295 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%) Query 59 PPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEAEAPLRDH- 105 PPH I+ F L T +NGATE SH+W + V D+ + DH Sbjct 140 PPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDGVDEAADHE 199 Query 106 ------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + L GS ++ HRG NLS +R ++ Y W Sbjct 200 CHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW 245 >ref|YP_545348.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] gb|ABE49507.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] Length=295 GENE ID: 4000736 Mfla_1239 | Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 9/83 (10%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP---RGSFILVDY 119 + + IPLQ ++++NG T GSH+ D + L + P G + + Sbjct 151 LRLLIPLQDMSQENGGTAVVPGSHL------DHSMNKHTLDKDAIAHPDVEAGDVLAIHP 204 Query 120 RTVHRGTVNLSNRTRSMLMLIYG 142 R +H G N S+R R ++++ +G Sbjct 205 RLLHGGNPNRSDRERDVIIVQFG 227 >gb|ABC25279.1| phytanoyl-CoA dioxygenase (PhyH) family [uncultured marine bacterium Ant4E12] Length=287 Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Query 61 HAINVF-IPLQHLTEDNGATEFTLGSHMWGDVWVDDE 96 H I F + L H+T D+GA EF GSH+W D+W E Sbjct 142 HQIMSFWVALDHVTLDSGALEFIRGSHLW-DIWYQPE 177 >ref|XP_646498.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum AX4] gb|EAL72707.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum AX4] Length=147 GENE ID: 3397778 DDBDRAFT_0201933 | hypothetical protein [Dictyostelium discoideum AX4] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 57 FLPPHAINVFIPLQHLTEDNGATEFTLGSHMW 88 FLP I +++PL ++ +NG E+ GSH W Sbjct 39 FLPAETIAIWVPLNDVSIENGTLEYATGSHNW 70 >ref|XP_462625.1| Gene info hypothetical protein DEHA0G26389g [Debaryomyces hansenii CBS767] emb|CAG91144.1| Gene info unnamed protein product [Debaryomyces hansenii CBS767] Length=348 GENE ID: 2904357 DEHA0G26389g | hypothetical protein [Debaryomyces hansenii CBS767] (10 or fewer PubMed links)  Score = 33.9 bits (76), Expect = 6.4, Method: Compositional matrix adjust. Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Query 67 IPLQHLTEDNGATEFTLGSHMWG-DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 I L T+ NGAT GSH+WG + D+ E A + L +G + T H Sbjct 198 IALTDTTKANGATRVIPGSHLWGPNRCPDNNEGNACYLE----LEKGDCAFILGSTYHAA 253 Query 126 TVNLSNRTRSMLMLIYGRSWWHDRTNY 152 + N+++ R +S+ NY Sbjct 254 SSNMTSEDRITSFYFMTKSYLKQEENY 280 >ref|YP_001412132.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS62475.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=265 GENE ID: 5455998 Plav_0852 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 31/96 (32%), Positives = 43/96 (44%), Gaps = 8/96 (8%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS--FLLPRGSFILV 117 P AINV L T +NGAT F GSH+ D +A R + + GS ++ Sbjct 138 PLAINVAWALDDFTVENGATRFVPGSHL-----KDHGPGKASERAQTVPIICKAGSIFVM 192 Query 118 DYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY 152 D R H+ N S TR+ L Y R + + N+ Sbjct 193 DGRVWHQTGPNTSGGDTRAGLFAYYVRPFIRPQWNW 228 >ref|ZP_01878938.1| hypothetical protein RTM1035_05470 [Roseovarius sp. TM1035] gb|EDM33041.1| hypothetical protein RTM1035_05470 [Roseovarius sp. TM1035] Length=265 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 25/85 (29%), Positives = 34/85 (40%), Gaps = 9/85 (10%) Query 69 LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT 126 L T +NGAT GS + DD+ +A ++PRGS + TVH G Sbjct 144 LDDFTAENGATRVVPGSQDLRPINSITDDQITQA-------VMPRGSVLFYLGATVHAGG 196 Query 127 VNLSNRTRSMLMLIYGRSWWHDRTN 151 N + R L+ Y W N Sbjct 197 ANRAAAPRKGLITTYSLGWLRQEEN 221 >gb|AAK01519.1| hypothetical protein [Pseudomonas aeruginosa] gb|EAZ58108.1| hypothetical protein PA2G_01326 [Pseudomonas aeruginosa 2192] Length=309 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD + P F + H P N+ + L TE+NGAT GS Sbjct 151 AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ 199 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P LL G +L + VH G N++ Sbjct 200 DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT 239 >ref|NP_744958.1| Gene info hypothetical protein PP_2814 [Pseudomonas putida KT2440] gb|AAN68422.1|AE016475_1 Gene info conserved hypothetical protein [Pseudomonas putida KT2440] Length=289 GENE ID: 1042682 PP_2814 | hypothetical protein [Pseudomonas putida KT2440] (10 or fewer PubMed links)  Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Query 60 PHAI-NVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVD 118 P AI N+ + L TE+NGAT GS W D ++ P LL G +L Sbjct 152 PRAITNLMLALTDFTEENGATRLIPGSQDWDDF----DDVGTPEMTIPALLKAGDAVLFG 207 Query 119 YRTVHRGTVNLS 130 + VH G N++ Sbjct 208 GKVVHGGGANVT 219 >ref|ZP_00975555.1| COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Pseudomonas aeruginosa 2192] ref|ZP_01365588.1| hypothetical protein PaerPA_01002714 [Pseudomonas aeruginosa PACS2] Length=288 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD + P F + H P N+ + L TE+NGAT GS Sbjct 130 AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ 178 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P LL G +L + VH G N++ Sbjct 179 DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT 218 f|YP_476788.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] gb|ABD01525.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] Length=272 GENE ID: 3901624 CYB_0534 | phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-2-3B'a(2-13)] (10 or fewer PubMed links)  Score = 70.1 bits (170), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 49/157 (31%), Positives = 67/157 (42%), Gaps = 15/157 (9%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 L+G P +A Q HRD S LF A +P +A+N+ IPL Sbjct 116 LSGLGAVVSLPGSAD--QQVHRDLSHLF-----------GDETLDAIIPCYALNLLIPLV 162 Query 71 HLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 + E+NG T GSH D + + P D L +GS +L DYR +H G N S Sbjct 163 EVNEENGMTRLWPGSHAVFDAHYTELAQQMPFIDPP--LAKGSCLLFDYRLIHLGRANRS 220 Query 131 NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARR 167 R +L Y R+W+ D NY + + E R Sbjct 221 PAPRPLLYNTYSRAWFRDPINYTQQPPLVIPAQEKER 257 >ref|YP_475540.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] gb|ABD00277.1| Gene info phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] Length=264 GENE ID: 3899087 CYA_2137 | phytanoyl-CoA dioxygenase PhyH family protein [Synechococcus sp. JA-3-3Ab] (10 or fewer PubMed links)  Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 46/140 (32%), Positives = 63/140 (45%), Gaps = 13/140 (9%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q HRD S LF DA A +P +A+N+ IPL + E+NG T GSH Sbjct 123 QQVHRDLSHLFG-DAIL----------DAIVPCYALNLLIPLVEVNEENGMTRLWPGSHA 171 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 + + + P D L +GS +L DYR +H G N S R +L Y R W+ Sbjct 172 VFEAHYTELARQMPFVDPP--LAKGSCLLFDYRLIHLGRANRSAAPRPLLYNTYSRPWFR 229 Query 148 DRTNYGTEDYGGVGLSEARR 167 D NY + + +E R Sbjct 230 DPVNYTRQPPLVIPAAEKER 249 >ref|XP_001466614.1| Gene info hypothetical protein [Leishmania infantum] emb|CAM69654.1| Gene info hypothetical protein, conserved [Leishmania infantum] Length=349 GENE ID: 5070647 LinJ29.1090 | hypothetical protein [Leishmania infantum JPCM5] Score = 65.9 bits (159), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 224 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QSKSVSPPV-------ALGSVLLF 274 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 275 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 314 >gb|AAF25825.1|AF185069_1 5FI8BORFP [Leishmania donovani] Length=309 Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 184 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QSKSVSPPV-------ALGSVLLF 234 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 235 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 274 >ref|XP_847751.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin] gb|AAZ09543.1| Gene info hypothetical protein, conserved [Leishmania major strain Friedlin] Length=349 GENE ID: 3608432 LmjF29.0885 | hypothetical protein, conserved [Leishmania major strain Friedlin] (10 or fewer PubMed links)  Score = 65.5 bits (158), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVF+PL + NG TEF GSH+ GD + P+ GS +L Sbjct 224 LFPYAINVFVPLISVDSRNG-TEFFPGSHVVGDRR-QRKSVSPPV-------ALGSVLLF 274 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N + R + + RSW+ D N+ Y Sbjct 275 DYRVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRY 314 >ref|XP_843936.1| Gene info hypothetical protein, conserved [Trypanosoma brucei] gb|AAX69674.1| hypothetical protein, conserved [Trypanosoma brucei] gb|AAZ10377.1| Gene info hypothetical protein, conserved [Trypanosoma brucei] Length=345 GENE ID: 3656284 Tb927.3.3440 | hypothetical protein, conserved [Trypanosoma brucei TREU927] (10 or fewer PubMed links)  Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 9/102 (8%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHM--WGDVWVDDEEAEAPLRDHSFLLPRGSFI 115 L P+AINVF+PL L + NG TEF GSH + V + P +P G + Sbjct 225 LFPYAINVFVPLVPLNKTNG-TEFFPGSHRVNYSSKPVSQQRPVTPT------VPLGKVL 277 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 L DYR +HRG N R Y RSW+ D+ N+ + Y Sbjct 278 LFDYRVLHRGLGNRLGFHRPCYYATYARSWYEDKFNFSSTRY 319 >emb|CAL51892.1| unnamed protein product [Ostreococcus tauri] Length=480 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 40/128 (31%), Positives = 55/128 (42%), Gaps = 8/128 (6%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q WH D R T+ R P+ + VF+PL HL D G T+F SH Sbjct 358 QEWH--------ADGRHLDTECDPRTGEGHAQPYGVCVFMPLIHLDRDTGYTQFFKRSHK 409 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 ++ E A LL G ++ DYR +HRG N SN R +L +Y + Sbjct 410 TSELIGFGEAASMLRLSFDGLLNTGQSVVYDYRLLHRGMYNRSNYVRPVLQFLYTAPAYR 469 Query 148 DRTNYGTE 155 + NYG + Sbjct 470 ETKNYGVD 477 >emb|CAL53283.1| 5FI8BORFP (ISS) [Ostreococcus tauri] Length=563 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 7/100 (7%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDDEEAEA--PLRDHSFLLPRGSFIL 116 NVF+P+ ++ G TEF GSH W V D++A+A P +P GS ++ Sbjct 460 FNVFVPMSAVSTIEGPTEFIHGSHQWDHNAAHVTTPDQKAQAAAPRFQPELRVP-GSLLV 518 Query 117 VDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED 156 DYR +HRG N S R R + ++YG S D N+ +D Sbjct 519 YDYRVMHRGGANASTRRRPLAYVMYGSSGTRDSWNFPLDD 558 >ref|XP_001566440.1| Gene info hypothetical protein LbrM29_V2.0950 [Leishmania braziliensis] emb|CAM39951.1| Gene info hypothetical protein, conserved [Leishmania braziliensis] Length=350 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+A+NVF+PL + NG TEF GSH+ G+ + A + G+ +L Sbjct 225 LFPYAVNVFVPLISVDSRNG-TEFFPGSHIVGNARRRKPVSPA--------VALGNALLF 275 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 DYR VHRG N R + + +SW+ D N+ + Y Sbjct 276 DYRVVHRGLRNAKIDPRPCYYVTFSQSWYQDIYNFSRKRY 315 >ref|XP_808587.1| Gene info ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain CL Brener] gb|EAN86736.1| Gene info ADP-ribosylation factor-like protein 3A, putative [Trypanosoma cruzi] Length=345 GENE ID: 3539035 Tc00.1047053504433.14 | ADP-ribosylation factor-like protein 3A [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)  Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVFIPL + ++NG TE GSH W D + + + ++P G +L Sbjct 225 LFPYAINVFIPLVPVDKNNG-TEVFPGSHRIE--W--DSRSSLKKKPVTPIIPFGKALLF 279 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGV 160 DYR +HRG N R + RSW+ D+ N+ Y V Sbjct 280 DYRLLHRGLGNRLGSPRPCYYATFVRSWYEDKFNFSFSRYRTV 322 >ref|XP_001417606.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO95899.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=314 GENE ID: 5001547 OSTLU_31394 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 40/129 (31%), Positives = 58/129 (44%), Gaps = 12/129 (9%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 Q WH D R + R PP+ + VF+PL L+ + G T+F + SH Sbjct 189 QEWH--------ADGRHLDVECDVRTGCGHAPPYGVCVFMPLIDLSRETGFTQFFMRSHK 240 Query 88 WGDVWVDDEEAEAPLRDHSF--LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + + +A LR SF +L G + DYR +HRG N S R +L +Y Sbjct 241 TSKL-IGFGDASLILR-LSFDGILDAGQSVAYDYRLLHRGMANDSLANRPVLQFLYTAPA 298 Query 146 WHDRTNYGT 154 + + NYGT Sbjct 299 YRETKNYGT 307 >ref|XP_818133.1| Gene info hypothetical protein [Trypanosoma cruzi strain CL Brener] gb|EAN96282.1| Gene info hypothetical protein, conserved [Trypanosoma cruzi] Length=345 GENE ID: 3550292 Tc00.1047053507951.179 | hypothetical protein [Trypanosoma cruzi strain CL Brener] (10 or fewer PubMed links)  Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%) Query 58 LPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILV 117 L P+AINVFIPL + ++NG TE GSH W D + + + +P G +L Sbjct 225 LFPYAINVFIPLVPVDKNNG-TEVFPGSHRIE--W--DSRSSLKKKPVTPSIPFGKALLF 279 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGV 160 DYR +HRG N + R + RSW+ D+ N+ Y V Sbjct 280 DYRLLHRGLGNRLSSPRPCYYATFVRSWYKDKFNFSFSRYRTV 322 >ref|YP_496299.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] gb|ABD25465.1| Gene info Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] Length=296 GENE ID: 3915802 Saro_1020 | Phytanoyl-CoA dioxygenase [Novosphingobium aromaticivorans DSM 12444] Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 39/125 (31%), Positives = 52/125 (41%), Gaps = 17/125 (13%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 QH H D + LF + G LP A+ + IPL + E NG TEF LG+H Sbjct 122 QHLHSDDTFLF----------AGSENDGK-LPAFALTIAIPLVEVNEVNGGTEFLLGTHR 170 Query 88 WGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWH 147 P S L G ++ D+ HRG N+SN R M + R +W Sbjct 171 C------KSGKSYPGVPVSSPLAPGDCMIWDFMVRHRGRPNVSNAARPMFYITACRPFWI 224 Query 148 DRTNY 152 D N+ Sbjct 225 DSANF 229 >emb|CAN94331.1| hypothetical protein [Sorangium cellulosum 'So ce 56'] Length=270 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 38/129 (29%), Positives = 53/129 (41%), Gaps = 13/129 (10%) Query 17 ASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDN 76 A+D+P Q HRDA LFP G P + V PL +T +N Sbjct 103 ATDTPLLGSDYQDVHRDAPPLFP-------------EIGRETPAFQLAVNFPLVDVTAEN 149 Query 77 GATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSM 136 G E G+HM A+ + + G ++ D R +HRGT N S R M Sbjct 150 GPIEIARGTHMLSKAEGMRRLAQGEVALEPIAMELGDVMVRDVRGLHRGTPNRSREPRPM 209 Query 137 LMLIYGRSW 145 +++ Y R W Sbjct 210 VVIGYSRRW 218 >ref|ZP_01627897.1| hypothetical protein MGP2080_15899 [marine gamma proteobacterium HTCC2080] gb|EAW39438.1| hypothetical protein MGP2080_15899 [marine gamma proteobacterium HTCC2080] Length=269 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 42/147 (28%), Positives = 60/147 (40%), Gaps = 39/147 (26%) Query 28 QHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHM 87 QHWH D+ P AR HL P HAINV + L + G TE LGSH Sbjct 129 QHWHTDS----PHVARDHL------------PAHAINVMVALHDIPLAMGPTECALGSHF 172 Query 88 WG----------------------DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 ++ V D E E P + + GS ++ D R +HRG Sbjct 173 LSNHLSNPSLVLNELIYQHEGTTPEILVGDTETEIP-EACAQAMAAGSCLIFDDRLLHRG 231 Query 126 TVNLSNRTRSMLMLIYGRSWWHDRTNY 152 N SN+ R + Y ++ + + T++ Sbjct 232 LGNQSNKPRHVAYFAYRKNGYTENTHF 258 >ref|XP_384382.1| Gene info hypothetical protein FG04206.1 [Gibberella zeae PH-1] Length=299 GENE ID: 2785543 FG04206.1 | hypothetical protein [Gibberella zeae PH-1] Score = 50.1 bits (118), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 24/133 (18%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH-------------------MWGDVWVDDEEAEA 100 P A+ + IPL T +NG+TE LG+H + ++ +E Sbjct 139 PFALVINIPLVTTTPENGSTEIWLGTHNGYGLDTQEGAHGERASGRIREELLRQRKEVSP 198 Query 101 PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGT-EDYGG 159 P+R ++ +GS I+ D R H G NL+ +TR ML +I+ W+ +R ED Sbjct 199 PIRP---IIKKGSIIVRDLRLWHAGMPNLTQQTRVMLAMIHFAPWYRNRMRLELGEDVKS 255 Query 160 VGLSEARRDDGAG 172 + L E R+ G Sbjct 256 I-LEELEREGKLG 267 >ref|XP_747181.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL85143.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=291 GENE ID: 3504528 AFUA_8G00230 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 20/101 (19%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ +HRD DA L +H + A PP +++V PL TE+NGATE LGSH Sbjct 125 AQPFHRD-------DATHPL--MHYQPLEA--PPVSLSVIFPLTEFTEENGATEVILGSH 173 Query 87 MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRG 125 W +V P RD + L + G ++V R VH G Sbjct 174 RWTEVG-------TPERDQAVLATMDPGDVLIVRQRVVHAG 207 >dbj|BAD20765.1| hypothetical protein [Streptomyces kanamyceticus] emb|CAE46944.1| hypothetical protein [Streptomyces kanamyceticus] emb|CAF31594.2| putative kanamycin biosynthetic protein [Streptomyces kanamyceticus] Length=285 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 16/101 (15%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEE-------------AEAPLRDH 105 PP+ + V +PL T +NG+TE+ GSH+ DE P+R Sbjct 145 PPYCLCVDVPLIDFTLENGSTEYWPGSHVLNPDECYDERGCVLPAELERRRAVAPPVR-- 202 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 F +P GS ++ D R HRG NLS R +L + + W+ Sbjct 203 -FPIPVGSVVIRDGRLWHRGVPNLSAAPRPLLAMTHYTEWF 242 >ref|XP_001261651.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW19754.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=291 GENE ID: 4588684 NFIA_093740 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 20/101 (19%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ +HRD DA L +H + A PP +++V PL TE+NGATE LGSH Sbjct 125 AQPFHRD-------DATHPL--MHHQPLEA--PPISLSVIFPLTEFTEENGATEVILGSH 173 Query 87 MWGDVWVDDEEAEAPLRDHSFL--LPRGSFILVDYRTVHRG 125 W +V P RD + L + G ++V R VH G Sbjct 174 RWMEVG-------TPERDQAVLATMDPGDVLVVRQRVVHAG 207 >ref|XP_001418352.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96645.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=566 GENE ID: 5002231 OSTLU_92828 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 7/100 (7%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEE----AEAPLRDHSFLLPRGSFIL 116 NVFI + +G T F GSH W +V E A AP L P GS ++ Sbjct 453 FNVFINTAKVETIDGPTAFIHGSHEWDHDACYVSTPERKAQALAPRTQPELLFP-GSVLI 511 Query 117 VDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED 156 DYR +H+G N S R RS+ +++ D N+ +D Sbjct 512 YDYRVMHKGGANDSARRRSLAYVMFCSRRARDSWNFPLDD 551 >ref|YP_629546.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] gb|ABF88170.1| Gene info phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] Length=395 GENE ID: 4102795 MXAN_1289 | phytanoyl-CoA dioxygenase family protein [Myxococcus xanthus DK 1622] (10 or fewer PubMed links)  Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 48/173 (27%), Positives = 73/173 (42%), Gaps = 24/173 (13%) Query 62 AINVFIPLQHLTEDNGATE----------------FTLGSHMWGDVWVDDEEAEAPLRDH 105 +I + IPL +T DNG E FT G+H + + P R Sbjct 165 SIAINIPLVDVTPDNGPMEVWPGTHQPPSEGRLAPFTTGAHRIDEPTLKSLVRRIPSR-- 222 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA 165 ++ RG+ ++ D+R VHRGT NL++ R ML L ++ Y G L+ + Sbjct 223 KLVMRRGAVLIRDHRMVHRGTPNLADAPRYMLSLY---CIAAEQVPYRLLSDAGATLALS 279 Query 166 RRDDGAGGGPEAAIQRRVLRALTVSEVGPSGEVCDLGTDEHDLWLRERMWWGL 218 R G G G AA++ R L L + +G E C L ++ +W L Sbjct 280 LRRMGRGSG--AAVRHRRLFDLG-AVLGRVVEECSLSDRDYRRTFSAELWASL 329 >ref|ZP_01627852.1| hypothetical protein MGP2080_02500 [marine gamma proteobacterium HTCC2080] gb|EAW39460.1| hypothetical protein MGP2080_02500 [marine gamma proteobacterium HTCC2080] Length=288 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 I+V L TE+NGAT GSH+ G D E+ P +PRGS ++ T+ Sbjct 161 ISVLWALDDFTEENGATRVIPGSHLSGPHPDDAEQTSYPAE-----MPRGSMVVYLGSTL 215 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N S++ R L+ Y W N Sbjct 216 HGGGANRSDKPRRALVNTYALGWLRQEEN 244 >ref|XP_001257330.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW15433.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=304 GENE ID: 4583844 NFIA_047690 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 16/105 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD 104 P A V +PL +T +NG+TE LG+H M GD + +D+ E +R Sbjct 149 PFAYVVNVPLIEMTPENGSTEIWLGTHINSGLHVQEGMHGDRASGRIKLDELEKRRAVRP 208 Query 105 HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 ++P+G+ +L D R H G N +++ R ML +I+ W+ + Sbjct 209 PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMIHFAPWYRN 253 >gb|AAD32731.1| MmcH [Streptomyces lavendulae] Length=254 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 5/138 (3%) Query 34 ASLLFPPDARFHLTDVHTRASGAFLP-PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW 92 A++ P +R HL T A + P P N L TEDNGAT GSH+ G Sbjct 101 ANIAGPGGSRMHLHADQTFARPPWPPYPLVANSMWMLDDFTEDNGATRLVPGSHLLGR-Q 159 Query 93 VDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 D + E + P GS ++ D R H+ N ++R R ++ Y R + + N+ Sbjct 160 PDYDRGEGNTETVAVCAPAGSVMVFDGRLWHQTGANTTDRPRHGILNYYCRGYVRQQQNF 219 Query 153 GT---EDYGGVGLSEARR 167 + ED E RR Sbjct 220 FSGLREDVATRATPELRR 237 >ref|XP_731501.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293] gb|EAL84211.1| Gene info conserved hypothetical protein [Aspergillus fumigatus Af293] Length=152 GENE ID: 3503644 AFUA_6G00540 | conserved hypothetical protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 16/107 (14%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH----------MWGD-----VWVDDEEAEAPLRD 104 P A + IPL +T +NG+TE LG+H M GD + +D+ E +R Sbjct 26 PFAYVINIPLIEMTPENGSTEIWLGTHIDSGLHIQEGMHGDRASGRIKLDELEKRRAVRP 85 Query 105 HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRT 150 ++P+G+ +L D R H G N +++ R ML +I G H +T Sbjct 86 PCQPVVPKGAIVLRDLRLWHAGVGNQTDQVRVMLAMINGLEGEHFQT 132 >ref|XP_001227983.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51] gb|EAQ83652.1| Gene info hypothetical protein CHGG_10056 [Chaetomium globosum CBS 148.51] Length=251 GENE ID: 4396037 CHGG_10056 | hypothetical protein [Chaetomium globosum CBS 148.51] Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 29/89 (32%), Positives = 38/89 (42%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 I + + T NGAT GSH+WGD + E A L RG +L T+ Sbjct 114 IGMLVAAVDTTYANGATLVVPGSHLWGDARIAQEHEVAAAE-----LSRGEALLFLTSTL 168 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N + R+M + Y RSW N Sbjct 169 HAGGANTTPDPRTMYAIFYCRSWVRPEAN 197 >ref|YP_001414577.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS64920.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=274 GENE ID: 5453899 Plav_3316 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 30/86 (34%), Positives = 39/86 (45%), Gaps = 11/86 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWG----DVWVDDEEAEAPLRDHSFLLPRGSFI 115 P AIN L T +NGAT GSH D VD + + P P GSFI Sbjct 143 PLAINALFCLDDFTTENGATYVLPGSHKQSAYPSDATVDALKVQIPA-------PAGSFI 195 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++D H G VN ++R R + +Y Sbjct 196 ILDCMLYHSGGVNRTDRERRAVNHVY 221 >ref|XP_001208474.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] gb|EAU37866.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] Length=294 GENE ID: 4315665 ATEG_01109 | conserved hypothetical protein [Aspergillus terreus NIH2624] Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 13/100 (13%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFL----------- 108 P A V I L + +NGATE LGSH+ D V D + L Sbjct 148 PFAFCVNINLVDTSPENGATEVWLGSHIDTDQSVLDHSVKHKQVKADLLEARRKISPGIQ 207 Query 109 --LPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LP+GS ++ D+R H G N ++ R ML+ I +W+ Sbjct 208 PGLPKGSLVIRDFRLWHAGMPNQTDDPRVMLVTIQFANWY 247 >ref|XP_001549420.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10] gb|EDN33467.1| Gene info hypothetical protein BC1G_12148 [Botryotinia fuckeliana B05.10] Length=311 GENE ID: 5429904 BC1G_12148 | hypothetical protein [Botryotinia fuckeliana B05.10] Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 5/80 (6%) Query 66 FIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 + T DNGAT GSH+W D + E P+ ++P GS + H G Sbjct 167 MVSFDDFTADNGATTVIPGSHLWSDERIPTREEMIPV-----IMPAGSMVYFLNTLWHSG 221 Query 126 TVNLSNRTRSMLMLIYGRSW 145 N SN+ R + + Y + W Sbjct 222 GANTSNKARRSITVQYCQPW 241 >ref|XP_001396026.1| Gene info hypothetical protein An12g09750 [Aspergillus niger] emb|CAL00879.1| Gene info unnamed protein product [Aspergillus niger] Length=338 GENE ID: 4986328 An12g09750 | hypothetical protein [Aspergillus niger CBS 513.88] (10 or fewer PubMed links)  Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 17/107 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHM----------------WGDVWVDDEEAEAPLR 103 P A + +PL +T +NG+TE LG+H G + V + E +R Sbjct 182 PFAYVINVPLVTMTPENGSTEIWLGTHADSGLHLQEGAHGADRASGRIKVQELEKRRAVR 241 Query 104 -DHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 ++P+GS ++ D R H G N + R ML +I+ W+ +R Sbjct 242 MPCQSVVPKGSLVIRDLRLWHAGMGNWTGNVRVMLAMIHFAPWYRNR 288 >ref|ZP_00112501.1| hypothetical protein Npun02000257 [Nostoc punctiforme PCC 73102] Length=277 Score = 43.9 bits (102), Expect = 0.006, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 6/129 (4%) Query 19 DSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGA 78 D P Q HRD LF R + D P +A+ V PL +T +NG Sbjct 110 DVPFQGSDYQEIHRDFRPLFSDGLRPAVGD------RIVTPLYALAVNFPLVEVTAENGP 163 Query 79 TEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLM 138 + G+H+ + A + SF + G ++ +HRG+ N +N+ R M++ Sbjct 164 FQMARGTHVLPREEGLKKVASGEIPMESFYMQPGDVMVRSPLALHRGSPNRTNQPRPMVV 223 Query 139 LIYGRSWWH 147 + Y W H Sbjct 224 MGYAMHWLH 232 >ref|XP_001558610.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10] gb|EDN33003.1| Gene info hypothetical protein BC1G_02681 [Botryotinia fuckeliana B05.10] Length=384 GENE ID: 5439200 BC1G_02681 | hypothetical protein [Botryotinia fuckeliana B05.10] Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 18/104 (17%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH-MW--------GDVWVDDE------EAEAPLRD 104 P I +F+ L ++ NG+TE GSH W G WV E P + Sbjct 149 PTCIELFMYLHEVSPTNGSTEIWPGSHHEWNLGNHESHGRGWVKASAFNRRAEHSPPFQP 208 Query 105 HSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 +P+GS + D R H G NLS++ R ML IY W+ + Sbjct 209 ---TIPKGSIAIRDLRLWHAGMPNLSDQNRIMLGFIYFPRWYRN 249 >ref|YP_459107.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594] gb|ABC64310.1| Gene info hypothetical protein ELI_11090 [Erythrobacter litoralis HTCC2594] Length=293 GENE ID: 3869292 ELI_11090 | hypothetical protein [Erythrobacter litoralis HTCC2594] Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 38/140 (27%), Positives = 51/140 (36%), Gaps = 40/140 (28%) Query 26 VAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGS 85 AQ WH D S P R PP +++ F L T +NGATE GS Sbjct 124 TAQPWHFDDSHCDLPRPR---------------PPLSLSTFWSLTETTAENGATEIIPGS 168 Query 86 HMWGDVWVDDEEAEAPLRDHSFL--------------------LPRGSFILVDYRTVHRG 125 H+WG DE E FL +P GS ++ HRG Sbjct 169 HLWG-----DERPEGASGPDDFLTGKTDKAGGAGTHPDAIKATMPPGSLMIAKGTLWHRG 223 Query 126 TVNLSNRTRSMLMLIYGRSW 145 N S+ R ++ + + W Sbjct 224 GANTSHDRRLIVTPQFCKGW 243 >ref|ZP_01618410.1| hypothetical protein GP2143_06913 [marine gamma proteobacterium HTCC2143] gb|EAW29758.1| hypothetical protein GP2143_06913 [marine gamma proteobacterium HTCC2143] Length=279 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 5/83 (6%) Query 69 LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVN 128 L T NGATE GSH+W D D E + + ++P GS ++ +HRG N Sbjct 156 LDDFTTTNGATEVVPGSHLWAD---DREPQQHEI--EQVIMPAGSALVFAGSLIHRGGAN 210 Query 129 LSNRTRSMLMLIYGRSWWHDRTN 151 +S +R + Y W N Sbjct 211 VSASSRLAVTPQYCMPWLRQIEN 233 >gb|EAT83717.1| hypothetical protein SNOG_08549 [Phaeosphaeria nodorum SN15] Length=313 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 20/115 (17%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAE----APLRDHSFLL------ 109 P A+ V +PL + +NG+TE LG+H + D+E E A R S +L Sbjct 151 PFALVVNVPLVKMEVENGSTEIWLGTH--NGTTIADQEGEHGDRASGRIKSHILEARREV 208 Query 110 --------PRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTED 156 +GS I+ D R H G NLS+ R ML I+ W+ ++ D Sbjct 209 RPPTQPTVKKGSIIIRDLRLWHGGKPNLSSVPRVMLAFIHFAPWYRNQMEVEIAD 263 >ref|XP_367927.2| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15] gb|EDJ97281.1| Gene info hypothetical protein MGG_07831 [Magnaporthe grisea 70-15] Length=330 GENE ID: 2683758 MGG_07831 | hypothetical protein [Magnaporthe grisea 70-15] (10 or fewer PubMed links)  Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 17/106 (16%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A+ V +PL +T NG+TE LG+H D+ + E A +R Sbjct 156 PFALVVNVPLVTMTPHNGSTELWLGTHHLSDLSAQEGAHGERASGRIRQRLLDARRSTRG 215 Query 108 ----LLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHD 148 ++ +GS ++ D R H G NLS + R ML I+ W+ + Sbjct 216 PCQPVVKKGSVVVRDLRLWHAGMPNLSRDEVRVMLAFIHFAPWYRN 261 >ref|XP_001265897.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW24000.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=318 GENE ID: 4593154 NFIA_035680 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 42.0 bits (97), Expect = 0.025, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P V + L T NGATE G+H DV V + + +R Sbjct 173 PFGFCVNVNLVETTTTNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP 232 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LLP+GS I+ D+R H G N ++ R ML+ + W+ Sbjct 233 LLPKGSIIIRDFRLWHAGMPNQTDEPRVMLVTVLFARWY 271 >ref|XP_001593774.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980] gb|EDO02725.1| Gene info hypothetical protein SS1G_05202 [Sclerotinia sclerotiorum 1980] Length=322 GENE ID: 5489739 SS1G_05202 | hypothetical protein [Sclerotinia sclerotiorum 1980] Score = 41.6 bits (96), Expect = 0.033, Method: Compositional matrix adjust. Identities = 31/127 (24%), Positives = 47/127 (37%), Gaps = 20/127 (15%) Query 25 RVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLG 84 + AQ H D L+ P R P + + T +NGAT G Sbjct 152 QTAQSIHCDDGLIALPRPR---------------PLIGVGTMVSFDDFTAENGATSVIPG 196 Query 85 SHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 SH+W D + E P+ ++P GS + H G N S++ R + + Y + Sbjct 197 SHLWSDDRIPTREEMIPV-----IMPAGSMVYFLNTLWHSGGANTSDKPRRSITVQYCQP 251 Query 145 WWHDRTN 151 W N Sbjct 252 WIRTYEN 258 >ref|XP_001216755.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] gb|EAU31307.1| Gene info conserved hypothetical protein [Aspergillus terreus NIH2624] Length=363 GENE ID: 4353480 ATEG_08134 | conserved hypothetical protein [Aspergillus terreus NIH2624] Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 22/108 (20%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-------------EEAE------A 100 P A + +PL +T +NG+TE LG+H + V + EE E A Sbjct 208 PFAYVINVPLITMTPENGSTEVWLGTHTDTGLHVQEGLHGERASGRIKLEELEKRRAVRA 267 Query 101 PLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 P + +P+GS ++ D R H G N + R ML +I+ SW+ + Sbjct 268 PCQP---TVPKGSIVIRDLRLWHAGIGNQTEIPRVMLAMIHFASWYRN 312 >dbj|BAE66236.1| unnamed protein product [Aspergillus oryzae] Length=325 Score = 41.2 bits (95), Expect = 0.043, Method: Compositional matrix adjust. Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 16/105 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHM---------------WGDVWVDDEEAEAPLRD 104 P A V +PL +T +NG+TE LG+H G + + E + +R Sbjct 170 PFAYVVNVPLITMTPENGSTEVWLGTHTDSGLHVQEGMHGERASGRIQLSALEKQRMIRP 229 Query 105 HSF-LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD 148 ++P+G+ +L D R H G N ++ R ML +I+ W+ + Sbjct 230 PCQPVVPKGALVLRDLRLWHAGIGNQTDDVRVMLAMIHFAPWYRN 274 >ref|XP_360888.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15] gb|EDJ94682.1| Gene info hypothetical protein MGG_03431 [Magnaporthe grisea 70-15] Length=432 GENE ID: 2676529 MGG_03431 | hypothetical protein [Magnaporthe grisea 70-15] (10 or fewer PubMed links)  Score = 41.2 bits (95), Expect = 0.049, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 3/92 (3%) Query 61 HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYR 120 + +N+ L +T++ GAT GSH+ V EE A + P GS +L+D R Sbjct 290 YVLNMMWYLTDVTDEKGATRIYPGSHVE---HVIPEEMNAVGKSIPAAAPAGSCVLLDSR 346 Query 121 TVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 T H VN + TR +++ + R + NY Sbjct 347 TWHSTGVNTTEETRPVILQSFCRFFVRQIENY 378 >ref|XP_749468.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL87430.1| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=318 GENE ID: 3506925 AFUA_2G03330 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 40.8 bits (94), Expect = 0.059, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 12/99 (12%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSF------------ 107 P V + L T NGATE G+H DV V + + +R Sbjct 173 PFGFCVNVNLVGTTATNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEARRKLCPPVQP 232 Query 108 LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 LLP+GS I+ D+R H G N ++ R ML+ + W+ Sbjct 233 LLPKGSIIIRDFRLWHAGMPNRTDEPRVMLVTVLFARWY 271 >ref|ZP_00419196.1| Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP] gb|EAM04358.1| Phytanoyl-CoA dioxygenase [Azotobacter vinelandii AvOP] Length=261 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 21/128 (16%) Query 15 SGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTE 74 S + PA A WHRD + + F D T I + +PLQ ++ Sbjct 126 SNITRKPAGIGPAIGWHRDCT-----NTYFASDDERT-----------IRMLLPLQEMSS 169 Query 75 DNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR 134 NG T GSH+ + D A ++ GS +++D + +H GT N S R Sbjct 170 RNGGTAVLSGSHLHMESTPQDLSAAI-----CPVVSPGSALVIDSKVLHGGTPNRSELDR 224 Query 135 SMLMLIYG 142 +++L +G Sbjct 225 DVIILQFG 232 >ref|ZP_01616112.1| hypothetical protein GP2143_18106 [marine gamma proteobacterium HTCC2143] gb|EAW33195.1| hypothetical protein GP2143_18106 [marine gamma proteobacterium HTCC2143] Length=346 Score = 40.8 bits (94), Expect = 0.063, Method: Compositional matrix adjust. Identities = 34/113 (30%), Positives = 47/113 (41%), Gaps = 25/113 (22%) Query 47 TDVHTRASGAFLPPHA--INVFIPLQHLTEDNGATEFTLGSH------MWGDVWVDDEEA 98 T+ +A+G PP+ ++ + L +TE GATE GSH WG + Sbjct 141 TEQAAKAAGQSWPPNTTTVSCSLALSEITEALGATEIYPGSHRETAVTTWG-------KG 193 Query 99 EAPL----------RDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 E P+ + S +P G D R HRG N SN R M+ L Y Sbjct 194 EQPVHHPEIVKNWGQPASMTIPAGGVCFRDPRMWHRGVKNSSNTPRPMIALTY 246 >dbj|BAE65945.1| unnamed protein product [Aspergillus oryzae] Length=276 Score = 40.4 bits (93), Expect = 0.083, Method: Compositional matrix adjust. Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 7/122 (5%) Query 47 TDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS 106 +D+ + +L +NV L + +NGAT + GSH W E EA Sbjct 122 SDLSLQCPDPWLSTWGLNVIWCLHDVYYENGATLYIPGSHHWKTKAEVPPEEEARKLLVP 181 Query 107 FLLPRGSFILVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEA 165 F GS I++D R H N++ ++ R++L Y + + N+ GVGLSE Sbjct 182 FEAKAGSIIVMDGRLWHTSGCNVTQDKERALLFGAYNAPFLRGQVNW------GVGLSEE 235 Query 166 RR 167 + Sbjct 236 TK 237 >emb|CAD18985.1| putative oxigenase [Streptomyces cattleya] Length=259 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 7/92 (7%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW-VDDEEAEAPLRDHS------FLLPR 111 PP AI V++ L T +NG + LGSH G V V EE + + + P Sbjct 145 PPEAITVWMALDDATVENGCVHYVLGSHRHGRVEHVRPEEGAVMIEARTEQEPVAYPAPA 204 Query 112 GSFILVDYRTVHRGTVNLSNRTRSMLMLIYGR 143 G ++ T+H NLS+ R +++Y R Sbjct 205 GDALVHSVNTLHGSGPNLSDGPRRAYVVVYVR 236 >ref|XP_001392916.1| Gene info hypothetical protein An08g08010 [Aspergillus niger] emb|CAK45692.1| Gene info unnamed protein product [Aspergillus niger] Length=292 GENE ID: 4983120 An08g08010 | hypothetical protein [Aspergillus niger CBS 513.88] (10 or fewer PubMed links)  Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 9/96 (9%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGD------VWVDDEEAEAPLRDHSFL---LP 110 P + + I L + +NGATE GSH D V E EA R + LP Sbjct 150 PFGLCININLVATSPENGATELWPGSHRDADPRDSDDTGVIPEIVEARRRVSPPVQPSLP 209 Query 111 RGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWW 146 +G+ I+ D+R H G N ++ R ML+ I+ +W+ Sbjct 210 KGAIIIRDFRLWHAGMPNRTDDPRVMLVTIHFPAWY 245 >ref|XP_001417798.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96091.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=280 GENE ID: 5002111 OSTLU_87319 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGD--VWVDDEEAEAPLRDHSF---LLPRGSF 114 P F+ LQ + D G T F G++ + + E E P+ + ++ RG Sbjct 164 PSVFTCFVALQDVERDMGPTLFIPGTNNAQAHVEFREGNEREGPVFRRPYELGVISRGDA 223 Query 115 ILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 L D RT+H GT N S+R R + + R+ Sbjct 224 TLFDSRTLHCGTENDSSRRRVLFYFSFQRA 253 >ref|ZP_01501800.1| Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815] gb|EAU98489.1| Phytanoyl-CoA dioxygenase [Burkholderia phymatum STM815] Length=277 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 38/156 (24%), Positives = 60/156 (38%), Gaps = 24/156 (15%) Query 10 ALAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPL 69 L ++G + P WHRD S H T T A N + + Sbjct 112 VLMQQNGIINRPDRQNYQVKWHRDLSYQ-------HWTSSKT---------IAFNALLCV 155 Query 70 QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH--SFLLPRGSFILVDYRTVHRGTV 127 T NGA+ +H ++ + +R H P GSFI++D HRG + Sbjct 156 DEFTLKNGASFVLPATH-----HIEAFPTDRFVRQHERQIAAPAGSFIVLDAMLYHRGGI 210 Query 128 NLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLS 163 N+SN R + + G + + N+ T + G+S Sbjct 211 NVSNDVRRAVNHLIGLPFLAQQVNFET-GFASTGMS 245 >ref|XP_001536248.1| Gene info predicted protein [Ajellomyces capsulatus NAm1] gb|EDN05262.1| Gene info predicted protein [Ajellomyces capsulatus NAm1] Length=221 GENE ID: 5442548 HCAG_08912 | predicted protein [Ajellomyces capsulatus NAm1] Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 5/80 (6%) Query 72 LTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSN 131 T DNGAT GSH+WG + E P+ + P+GS + T H G N S Sbjct 113 FTADNGATRVVTGSHLWGADRRPECEESTPM-----VCPQGSVVYFLATTWHCGGPNNSP 167 Query 132 RTRSMLMLIYGRSWWHDRTN 151 R L + Y + + N Sbjct 168 NPRKSLTVQYCQPYIRQIEN 187 >ref|ZP_01749022.1| hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2] gb|EBA13005.1| hypothetical protein RCCS2_03949 [Roseobacter sp. CCS2] Length=215 Score = 38.5 bits (88), Expect = 0.26, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Query 65 VFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAP-LRDHSFLLPRGSFILVDYRTVH 123 V + L +E++GA E LGSH G V D +A A H RG +++D T+H Sbjct 125 VRVHLDDTSEEDGAMEIALGSHRDGKVMADQSQAVADRYPKHVCPAQRGDILILDMLTLH 184 Query 124 RGTVNLSNRTRSMLMLIYG 142 R TR L + Y Sbjct 185 RSLPATVPSTRRTLRIDYA 203 >ref|XP_572755.1| Gene info hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] gb|AAW45448.1| Gene info expressed protein [Cryptococcus neoformans var. neoformans JEC21] Length=327 GENE ID: 3259545 CNI00020 | hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] (10 or fewer PubMed links)  Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A V + L + NG+T+ LG+H D+ + E A ++ Sbjct 175 PFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISP 234 Query 108 ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 +P+GS I+ D R H G N ++ R ML +I+ W+ R Sbjct 235 PLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPWYRQR 280 >ref|XP_774078.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans B-3501A] gb|EAL19431.1| Gene info hypothetical protein CNBH0030 [Cryptococcus neoformans var. neoformans B-3501A] Length=327 GENE ID: 4937528 CNBH0030 | hypothetical protein [Cryptococcus neoformans var. neoformans B-3501A] Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 16/106 (15%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD----EEAEAPLRDHSF-------- 107 P A V + L + NG+T+ LG+H D+ + E A ++ Sbjct 175 PFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERASGRIKQDLLDARKSISP 234 Query 108 ----LLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDR 149 +P+GS I+ D R H G N ++ R ML +I+ W+ R Sbjct 235 PLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPWYRQR 280 >ref|ZP_00976791.1| COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Burkholderia cenocepacia PC184] Length=275 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 41/143 (28%), Positives = 56/143 (39%), Gaps = 30/143 (20%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 72 FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ 113 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P R + L G + Sbjct 114 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPARAVACPLMPGDCTVHA 173 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 RT+H NLS++ R L + Sbjct 174 GRTLHAAGANLSDQPRYAYALNF 196 >ref|XP_682496.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4] gb|EAA61518.1| Gene info hypothetical protein AN9227.2 [Aspergillus nidulans FGSC A4] Length=416 GENE ID: 2868057 AN9227.2 | hypothetical protein [Aspergillus nidulans FGSC A4] (10 or fewer PubMed links)  Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 39/136 (28%), Positives = 55/136 (40%), Gaps = 28/136 (20%) Query 16 GASDSPATARVAQHWHRDASLLFP------PDARFHLTDVHTRASGAFLPPHAINVFIPL 69 GA A + AQ HRD P PDA P +IN + L Sbjct 227 GAVMELAPSNPAQPLHRDMRFSHPIVEYLKPDA----------------PATSINFLVAL 270 Query 70 QHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNL 129 T +NGAT LGSH W + + + +A +R L+ G +L+ T+H G Sbjct 271 SPFTAENGATHVILGSHKWQN--LSNVSMDATVR---ALMNPGDALLITDSTIHCGGAET 325 Query 130 S-NRTRSMLMLIYGRS 144 + TR +L + G S Sbjct 326 TGTETRRLLTITMGIS 341 >ref|XP_953820.1| Gene info hypothetical protein TA06590 [Theileria annulata strain Ankara] emb|CAI73142.1| Gene info hypothetical protein [Theileria annulata] Length=502 GENE ID: 3863425 TA06590 | hypothetical protein [Theileria annulata strain Ankara] (10 or fewer PubMed links)  Score = 38.1 bits (87), Expect = 0.40, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 23/88 (26%) Query 63 INVFIPLQHLTEDNGATEFTLGSH---------MWGDVWVDDEEAEAPLRDHSFLLPRGS 113 IN+ +PLQ + NG +F G+H G V VD E + + + S L Sbjct 381 INIVVPLQDTNKVNGRMQFLPGTHNEPSRLNPYTCGPVGVDLNEGDVLIYNSSVL----- 435 Query 114 FILVDYRTVHRGTVNLSNRTRSMLMLIY 141 HR T+N SN +SM++ Y Sbjct 436 ---------HRNTINESNVCQSMVVFTY 454 >ref|ZP_01867932.1| Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1] gb|EDL53417.1| Phytanoyl-CoA dioxygenase [Vibrio shilonii AK1] Length=252 Score = 38.1 bits (87), Expect = 0.41, Method: Compositional matrix adjust. Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 2/87 (2%) Query 57 FLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDD-EEAEAPLRDHSFL-LPRGSF 114 F H +N L L DNGA G+H+ ++ D E+ EA D +L P GS Sbjct 133 FPKVHLVNSIWALDDLCRDNGAPRIIPGTHLRPELPEDVLEDTEATHPDEVYLECPAGSI 192 Query 115 ILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ + T H GTVN R +L +Y Sbjct 193 MIFNAHTWHGGTVNTLGTRRRVLHGLY 219 >ref|XP_001161510.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 1 [Pan troglodytes] Length=277 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >emb|CAI10841.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] Length=255 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|NP_001094347.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform c [Homo sapiens] gb|AAH51300.1| UniGene infoGene info PHYHD1 protein [Homo sapiens] gb|EAW87847.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_d [Homo sapiens] Length=270 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 37.4 bits (85), Expect = 0.58, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|XP_001161891.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 5 [Pan troglodytes] Length=270 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 37.4 bits (85), Expect = 0.61, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 191 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 192 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 251 >ref|NP_001094346.1| UniGene infoGene info phytanoyl-CoA dioxygenase domain containing 1 isoform a [Homo sapiens] pdb|2OPW|A Related structures Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 (Apo) gb|AAH53853.1| UniGene infoGene info PHYHD1 protein [Homo sapiens] emb|CAI10842.1| Gene info phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] gb|EAW87844.1| Gene info phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_a [Homo sapiens] Length=291 GENE ID: 254295 PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] (10 or fewer PubMed links)  Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >ref|XP_001161929.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 6 [Pan troglodytes] ref|XP_001161970.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 7 [Pan troglodytes] ref|XP_001162007.1| Gene info PREDICTED: phytanoyl-CoA dioxygenase domain containing 1 isoform 8 [Pan troglodytes] Length=291 GENE ID: 464911 LOC464911 | similar to Phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] Score = 37.4 bits (85), Expect = 0.68, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 27/120 (22%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPL----- 102 H AS + P + V+I ++ T +NG F GSH G V AP+ Sbjct 156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSG---VSRRMVRAPVGSAPG 212 Query 103 ---------RDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSW 145 RD+S +P RG+ +L+ VH+ NLS+R+R LM G +W Sbjct 213 TSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTW 272 >ref|XP_001610743.1| Gene info conserved hypothetical protein [Babesia bovis] gb|EDO07175.1| Gene info conserved hypothetical protein [Babesia bovis] Length=1596 GENE ID: 5478977 BBOV_IV008210 | conserved hypothetical protein [Babesia bovis] Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 23/89 (25%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHM---------WGDVWVDDEEAEAPLRDHSFLLPRG 112 + V + L + E+NG +F G+H +G V VD L +G Sbjct 1483 GVTVVLALDCVEENNGRIQFLPGTHKTQPEINPYKFGKVGVD--------------LNKG 1528 Query 113 SFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ D R +HR T+N SN+ S L+ Y Sbjct 1529 DVLIFDSRVLHRNTINESNKCCSCLVFSY 1557 >ref|XP_664422.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4] gb|EAA58217.1| Gene info hypothetical protein AN6818.2 [Aspergillus nidulans FGSC A4] Length=271 GENE ID: 2870496 AN6818.2 | hypothetical protein [Aspergillus nidulans FGSC A4] (10 or fewer PubMed links)  Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 11/98 (11%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP----RGSFI 115 P A+N+ L + +NGAT + GSH W + E P L P GS I Sbjct 137 PWAVNIIWCLSDVYFENGATLYIPGSHRW------KRKNEVPSNAVEMLKPFVAKAGSII 190 Query 116 LVDYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY 152 +D R H N++ ++ R++L Y + + N+ Sbjct 191 AMDARVWHTSGANITKDQDRALLFAFYSAPFLRQQVNW 228 >ref|XP_001418033.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] gb|ABO96326.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901] Length=326 GENE ID: 5002112 OSTLU_15487 | predicted protein [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)  Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 39/113 (34%), Positives = 52/113 (46%), Gaps = 14/113 (12%) Query 56 AFLPPHA--INVFIPLQHLTEDNGATEFTLG-----SHMWGDVWVDDEEAEAPL---RDH 105 AF PHA ++FI LQ + + G T F LG SH V +EE A L R Sbjct 188 AFDAPHAPLYSLFIALQDVIPEMGPTCFVLGTQDKASHDAFPVTKWNEEQFARLAKSRCC 247 Query 106 SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHD---RTNYGTE 155 L +G +L D RT H+G N R R+++ L + + D R N G E Sbjct 248 DAELRKGDAVLYDARTFHQGGANEYGR-RALMTLTFLKPPIPDAPTRRNAGAE 299 >ref|ZP_01103950.1| conserved hypothetical protein [gamma proteobacterium KT 71] gb|EAQ96749.1| conserved hypothetical protein [Congregibacter litoralis KT71] Length=315 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 6/95 (6%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGD-VWVDDEEAEAPLRDHSFLLPRGSFILV 117 P ++ + TEDNGAT GSH+WG+ + D + ++P GS IL Sbjct 173 PVLSVATVFAIDDFTEDNGATVAIPGSHLWGEGRFPTDSDPRV-----KAVMPAGSCILF 227 Query 118 DYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 H G N S +R Y + + NY Sbjct 228 LGNLWHGGGENYSGESRMAFTGQYCEPYLRTQENY 262 >ref|NP_962094.1| Gene info hypothetical protein MAP3160 [Mycobacterium avium subsp. paratuberculosis K-10] gb|AAS05708.1| Gene info hypothetical protein MAP_3160 [Mycobacterium avium subsp. paratuberculosis K-10] Length=277 GENE ID: 2721210 MAP3160 | hypothetical protein [Mycobacterium avium subsp. paratuberculosis K-10] (10 or fewer PubMed links)  Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P A + T DNGAT GSH WG ++ P+ ++P GS +L Sbjct 143 PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPAGSCVLFVG 197 Query 120 RTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N ++R R + Y + W Sbjct 198 TLWHGGGANTTDRDRLAVTAQYCQPW 223 >ref|ZP_01034759.1| hypothetical protein ROS217_22977 [Roseovarius sp. 217] gb|EAQ27440.1| hypothetical protein ROS217_22977 [Roseovarius sp. 217] Length=265 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 9/85 (10%) Query 69 LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT 126 L T +NGAT GS + +D+ +A ++PRGS + TVH G Sbjct 144 LDDFTAENGATRVVPGSQDLRPIKSITEDQITQA-------VMPRGSVLFYLGATVHAGG 196 Query 127 VNLSNRTRSMLMLIYGRSWWHDRTN 151 N SN R L+ Y W N Sbjct 197 ANRSNAPRKGLITTYSLGWLRQEEN 221 >ref|ZP_01721295.1| hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1] gb|EAZ79312.1| hypothetical protein ALPR1_16728 [Algoriphagus sp. PR1] Length=245 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Query 69 LQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDH----SFLLPRGSFILVDYRTVHR 124 L TE+NGAT SH W + + DE PL H + P GS + + H Sbjct 138 LDDFTENNGATRIVPSSHKWSE--LPDEALINPLDKHPKEIKIIAPAGSVFIFNSHVWHG 195 Query 125 GTVNLSNRTR 134 GT+N +++ R Sbjct 196 GTMNETSKIR 205 >ref|XP_001224329.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51] gb|EAQ88496.1| Gene info hypothetical protein CHGG_05115 [Chaetomium globosum CBS 148.51] Length=613 GENE ID: 4392423 CHGG_05115 | hypothetical protein [Chaetomium globosum CBS 148.51] Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 5/100 (5%) Query 54 SGAFLPPHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGS 113 SG P ++N + L T++NGAT GSH W D+ ++ P + G Sbjct 472 SGPDAPEASVNFVVALTEFTDENGATRVIPGSHRWQDL----QQNGTPEDTIPAEMEVGD 527 Query 114 FILVDYRTVHRGTVN-LSNRTRSMLMLIYGRSWWHDRTNY 152 + + VH G N + TR + L++ S+ Y Sbjct 528 ACFITGKVVHGGGANRTKDFTRRAITLVFQCSYLTPEEAY 567 >ref|YP_366487.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] gb|ABB05843.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] Length=291 GENE ID: 3733825 Bcep18194_C6796 | Phytanoyl-CoA dioxygenase [Burkholderia sp. 383] Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 31/108 (28%), Positives = 43/108 (39%), Gaps = 13/108 (12%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD FPP A G P N+ I L TE+NGAT GS Sbjct 131 AQMLHRDVGN-FPPLC----------ALGINGPTVFTNLMIALTRFTEENGATRIIPGSQ 179 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTR 134 W + + D + P + + G +L + +H G N++ R Sbjct 180 NWDEDYFDSK--GTPDMTIAAEMDAGDALLFSGKVIHGGGANVTQNER 225 >ref|XP_001261676.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW19779.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=267 GENE ID: 4588607 NFIA_093990 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 3/95 (3%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT 121 A+NV L +TE+NGAT + GS+ W W +D AP F G +++D R Sbjct 127 AVNVIWCLTRMTEENGATLYIPGSNKWT-TW-EDVPDNAPDLLVPFEADAGDIVVIDGRL 184 Query 122 VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE 155 H N++ + R++L Y TN+ + Sbjct 185 WHTSGSNVTKDEDRAILFAYYSAPHMRPLTNWSAK 219 >ref|XP_001267631.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] gb|EAW25734.1| Gene info phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Length=297 GENE ID: 4594309 NFIA_045530 | phytanoyl-CoA dioxygenase, putative [Neosartorya fischeri NRRL 181] Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWGDV 91 PP AI+ + L T+DNG T LGSH W ++ Sbjct 149 PPLAISFILALTDFTKDNGGTRVILGSHKWPEI 181 >ref|YP_883146.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] gb|ABK69454.1| Gene info phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] Length=287 GENE ID: 4527072 MAV_3990 | phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 104] Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDY 119 P A + T DNGAT GSH WG ++ P+ ++P GS +L Sbjct 153 PLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPV-----VMPVGSCVLFVG 207 Query 120 RTVHRGTVNLSNRTRSMLMLIYGRSW 145 H G N ++R R + Y + W Sbjct 208 TLWHGGGANTTDRDRLAVTAQYCQPW 233 >emb|CAL54074.1| unnamed protein product [Ostreococcus tauri] Length=330 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 21/98 (21%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRD-------------HS 106 P F+ LQ + D G T F G++ + +A A R+ Sbjct 213 PSVYTCFVALQDVDADMGPTLFIPGTN--------NAQAHAEFREGLERGGPVLQRPNEL 264 Query 107 FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRS 144 L+ RG L D RT+H GT N S+R R + + R+ Sbjct 265 GLISRGDATLFDSRTLHCGTENASSRRRVLFYFSFQRT 302 >ref|NP_001069711.1| UniGene infoGene info hypothetical protein LOC540828 [Bos taurus] gb|AAI22728.1| UniGene infoGene info Similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos taurus] Length=291 GENE ID: 540828 MGC152146 | similar to phytanoyl-CoA dioxygenase domain containing 1 [Bos taurus] Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 21/120 (17%) Query 50 HTRASGAFLPP--HAINVFIPLQHLTEDNGATEFTLGSHM-----------WGDVWVDDE 96 H AS + P + ++I L+ +NG F GSH G V Sbjct 156 HQDASFLYTEPLGRVLGLWIALEDAMLENGCLWFIPGSHTGGVSRRMVRTPAGSVPGTSF 215 Query 97 EAEAPLRDHSFLLP----RGSFILVDYRTVHRGTVNLSNRTRSM----LMLIYGRSWWHD 148 P+RD+S +P RG+ +L+ VH+ NLS+R+R LM G W D Sbjct 216 LGSEPIRDNSLFVPTPVLRGALVLIHGEVVHKSEQNLSDRSRQAYTFHLMEAAGTIWSPD 275 >ref|ZP_01562106.1| Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia MC0-3] gb|EAV60109.1| Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia MC0-3] Length=303 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 40/143 (27%), Positives = 55/143 (38%), Gaps = 30/143 (20%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 100 FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ 141 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P + L G + Sbjct 142 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHA 201 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 RT+H NLS++ R L + Sbjct 202 GRTLHAAGANLSDQPRYAYALNF 224 >ref|YP_621422.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054] ref|YP_839910.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia HI2424] gb|ABF76449.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054] gb|ABK13017.1| Gene info Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia HI2424] Length=303 GENE ID: 4092656 Bcen_1544 | Phytanoyl-CoA dioxygenase [Burkholderia cenocepacia AU 1054] Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 40/143 (27%), Positives = 55/143 (38%), Gaps = 30/143 (20%) Query 11 LAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQ 70 AG S P T V WH+D + DAR +V N +IPLQ Sbjct 100 FAGDSFFLKQPRTGTVTP-WHQDDAFT---DARIEHREV--------------NFWIPLQ 141 Query 71 HLTEDNGATEFTLGSHMW---------GDVWVDDEEAEA---PLRDHSFLLPRGSFILVD 118 ++ DNG +F GSH++ GDV E P + L G + Sbjct 142 AVSVDNGCMQFIPGSHLYDVLPHGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHA 201 Query 119 YRTVHRGTVNLSNRTRSMLMLIY 141 RT+H NLS++ R L + Sbjct 202 GRTLHAAGANLSDQPRYAYALNF 224 >ref|YP_001539320.1| Gene info Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205] gb|ABW00330.1| Gene info Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205] Length=264 GENE ID: 5705419 Sare_4561 | Phytanoyl-CoA dioxygenase [Salinispora arenicola CNS-205] Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 22/104 (21%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVW------------VD-DEEAEAP----- 101 P +NV + L +TE NG F GSH G + +D DE + P Sbjct 125 PSQVNVALFLDDVTEFNGPVIFLRGSHQLGPLERPGSTEGHESGHIDPDEYSLTPAELAD 184 Query 102 -LRDHSFLLP---RGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 ++ H + P RG +L + VH N+S R +L+L Y Sbjct 185 LVKQHEMVSPKGARGGVLLFSSQIVHGSGTNISPFARRLLILTY 228 >ref|XP_963174.1| Gene info hypothetical protein [Neurospora crassa OR74A] emb|CAD70289.1| conserved hypothetical protein [Neurospora crassa] gb|EAA33938.1| Gene info conserved hypothetical protein [Neurospora crassa OR74A] Length=336 GENE ID: 3879322 NCU09596.1 | hypothetical protein [Neurospora crassa OR74A] (10 or fewer PubMed links)  Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 29/115 (25%), Positives = 47/115 (40%), Gaps = 28/115 (24%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSH------------------------MWGDVWVDD 95 P A+ + +PL +T DNG+TE LG+H + ++ Sbjct 174 PFALVINVPLITMTPDNGSTELWLGTHNLAGEDSSGHAAQEGAHGERASGRIRPELLARR 233 Query 96 EEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVN-LSNRTRSMLMLIYGRSWWHDR 149 AP + + +GS ++ D R H G N S R ML +I+ W+ +R Sbjct 234 AAVRAPCQP---TVRKGSIVVRDLRLWHAGMPNRTSGEVRIMLAMIHFAPWYRNR 285 >ref|XP_313252.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST] gb|EAA08759.4| Gene info AGAP003514-PA [Anopheles gambiae str. PEST] Length=287 GENE ID: 1274172 AgaP_AGAP003514 | AGAP003514-PA [Anopheles gambiae str. PEST] (10 or fewer PubMed links)  Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 16/92 (17%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--DVWVDDEEA----------EAPLRDHS 106 P I +IPL+ T NG F GSH G W+ + + APL S Sbjct 160 PSTTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRWIRNPDKGADELLVYDRPAPLYPQS 219 Query 107 FL----LPRGSFILVDYRTVHRGTVNLSNRTR 134 + GS +L+ + VHR N S+R+R Sbjct 220 NFVAVPVKAGSCVLIHSQAVHRSDANKSDRSR 251 >emb|CAL54075.1| unnamed protein product [Ostreococcus tauri] Length=346 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 30/95 (31%), Positives = 42/95 (44%), Gaps = 17/95 (17%) Query 60 PHA--INVFIPLQHLTEDNGATEFTLGSH-----------MWGDVWVDDEEAEAPLRDHS 106 PHA ++FI LQ + + G T F LG+ WGD EA A Sbjct 217 PHAPLYSLFIALQDVVPEMGPTCFVLGTQDRASHDAFPNAKWGDAQF---EALAGREWCD 273 Query 107 FLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 L +G +L D RT H+G N R R+++ L + Sbjct 274 ATLRKGDAVLYDARTFHQGGANEHGR-RALMTLTF 307 >ref|ZP_01662317.1| phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J] ref|ZP_02009228.1| Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D] gb|EAX44268.1| phytanoyl-CoA dioxygenase [Ralstonia pickettii 12J] gb|EDN39860.1| Phytanoyl-CoA dioxygenase [Ralstonia pickettii 12D] Length=292 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 5/90 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 + + I + +E+NG T GSH W D + +E P + G ++ T Sbjct 151 VQIMIAITDFSEENGGTLVIPGSHKWDDERMPKQEEAIPTS-----MEAGDALIFIGSTY 205 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTNY 152 H G N SN R+ L + Y + N+ Sbjct 206 HGGGQNRSNAPRTGLTMSYDLAILRQEENH 235 >ref|YP_001339697.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] gb|ABR69762.1| Gene info Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] Length=267 GENE ID: 5365525 Mmwyl1_0830 | Phytanoyl-CoA dioxygenase [Marinomonas sp. MWYL1] Score = 34.7 bits (78), Expect = 3.8, Method: Compositional matrix adjust. Identities = 22/102 (21%), Positives = 48/102 (47%), Gaps = 11/102 (10%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMW----GDVWVDDEEAEAPLRDHSFLLPRGSFI 115 P A+N + T DNG+T+ GSH G+ ++++ + + F + G ++ Sbjct 139 PIALNALYCVCDFTFDNGSTQVLPGSHKIEKFPGNKFLEENKMQ-------FYVSSGDYL 191 Query 116 LVDYRTVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDY 157 L+D H G++N ++ R + +Y + ++ + D+ Sbjct 192 LIDSMLYHSGSINKTSDRRIGINNVYSTPIIRRQIDFNSSDF 233 >ref|YP_001414417.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS64760.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=302 GENE ID: 5453830 Plav_3154 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 5/89 (5%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTV 122 N + T++NGAT+ GS W D + E+ + +P GS ++ Sbjct 137 FNTIWAISDFTKENGATQVCPGSLGWPDDYQPTED-----QIGYAEMPAGSVLVYSGGVF 191 Query 123 HRGTVNLSNRTRSMLMLIYGRSWWHDRTN 151 H G N+SN R + + Y W N Sbjct 192 HGGGANVSNGDRIGINITYTLGWLRQEEN 220 >ref|XP_747157.2| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] gb|EAL85119.2| Gene info phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] Length=309 GENE ID: 3504545 AFUA_8G00480 | phytanoyl-CoA dioxygenase family protein [Aspergillus fumigatus Af293] (10 or fewer PubMed links)  Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 3/95 (3%) Query 62 AINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRT 121 A+NV L +T++NGAT + GS+ W W +D AP F G +++D R Sbjct 169 AVNVIWCLTRMTKENGATLYIPGSNKWT-TW-EDVPDNAPDLLVPFEADAGDIVVIDGRL 226 Query 122 VHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNYGTE 155 H N++ + R++L Y TN+ + Sbjct 227 WHTSGSNVTEDEDRAILFAYYSAPHMRPLTNWSAK 261 >ref|ZP_01626096.1| hypothetical protein MGP2080_09703 [marine gamma proteobacterium HTCC2080] gb|EAW41112.1| hypothetical protein MGP2080_09703 [marine gamma proteobacterium HTCC2080] Length=279 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%) Query 59 PPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEAEAPLRDH- 105 PPH I+ F L T +NGATE SH+W + V D+ + DH Sbjct 124 PPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDGVDEAADHE 183 Query 106 ------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + L GS ++ HRG NLS +R ++ Y W Sbjct 184 CHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW 229 >ref|YP_508892.1| Gene info Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1] gb|ABD53867.1| Gene info Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1] Length=230 GENE ID: 3933394 Jann_0950 | Phytanoyl-CoA dioxygenase [Jannaschia sp. CCS1] Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 20/120 (16%) Query 41 DARFHLTDVHTRAS------GAFLP----PHAINVFIPLQHLTEDNGAT---------EF 81 + +F + HT AS GA++P P+ ++V+I L T +NG+ E Sbjct 91 NEQFVVKGPHTGASFAWHQDGAYVPFAHKPY-LSVWIALDDATLENGSLSCLPRDLDREG 149 Query 82 TLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIY 141 + H W D+ + + P + P G+ ++ T+HR N +NR R + Y Sbjct 150 HIDPHHWNDIGKEKVGYDGPDPGEALPCPAGTMVIFSSLTLHRSGANTTNRPRRAYLAQY 209 >ref|XP_001657669.1| Gene info conserved hypothetical protein [Aedes aegypti] gb|EAT48860.1| Gene info conserved hypothetical protein [Aedes aegypti] Length=286 GENE ID: 5567769 AaeL_AAEL000102 | conserved hypothetical protein [Aedes aegypti] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 20/94 (21%) Query 59 PPHAINVFIPLQHLTEDNGATEFTLGSHMWG--------------DVWVDDEEAEAPLRD 104 P I +IPL+ T NG F GSH G ++ + D APL Sbjct 159 PSSTIGFWIPLEDATLQNGCLHFIKGSHKSGVHRRYIRNPDKSSPELLIYDR--PAPLYP 216 Query 105 HSFL----LPRGSFILVDYRTVHRGTVNLSNRTR 134 S + GS +L+ + VHR N S+R+R Sbjct 217 QSNFCAAPVKAGSLVLIHSQVVHRSDANRSDRSR 250 >gb|AAR37958.1| conserved hypothetical protein [uncultured marine bacterium 561] Length=295 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%) Query 59 PPH---AINVFIPLQHLTEDNGATEFTLGSHMWGD---------VWVDDEEAEAPLRDH- 105 PPH I+ F L T +NGATE SH+W + V D+ + DH Sbjct 140 PPHEILGISAFWALSDTTVENGATEVLPRSHLWAEQDLPGALTAVDFDNTDGVDEAADHE 199 Query 106 ------SFLLPRGSFILVDYRTVHRGTVNLSNRTRSMLMLIYGRSW 145 + L GS ++ HRG NLS +R ++ Y W Sbjct 200 CHSAAKTVTLTAGSLMVARGDLWHRGGANLSGGSRLIVTPQYCAGW 245 >ref|YP_545348.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] gb|ABE49507.1| Gene info Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] Length=295 GENE ID: 4000736 Mfla_1239 | Phytanoyl-CoA dioxygenase [Methylobacillus flagellatus KT] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 9/83 (10%) Query 63 INVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLP---RGSFILVDY 119 + + IPLQ ++++NG T GSH+ D + L + P G + + Sbjct 151 LRLLIPLQDMSQENGGTAVVPGSHL------DHSMNKHTLDKDAIAHPDVEAGDVLAIHP 204 Query 120 RTVHRGTVNLSNRTRSMLMLIYG 142 R +H G N S+R R ++++ +G Sbjct 205 RLLHGGNPNRSDRERDVIIVQFG 227 >gb|ABC25279.1| phytanoyl-CoA dioxygenase (PhyH) family [uncultured marine bacterium Ant4E12] Length=287 Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Query 61 HAINVF-IPLQHLTEDNGATEFTLGSHMWGDVWVDDE 96 H I F + L H+T D+GA EF GSH+W D+W E Sbjct 142 HQIMSFWVALDHVTLDSGALEFIRGSHLW-DIWYQPE 177 >ref|XP_646498.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum AX4] gb|EAL72707.1| Gene info hypothetical protein DDBDRAFT_0201933 [Dictyostelium discoideum AX4] Length=147 GENE ID: 3397778 DDBDRAFT_0201933 | hypothetical protein [Dictyostelium discoideum AX4] (10 or fewer PubMed links)  Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 57 FLPPHAINVFIPLQHLTEDNGATEFTLGSHMW 88 FLP I +++PL ++ +NG E+ GSH W Sbjct 39 FLPAETIAIWVPLNDVSIENGTLEYATGSHNW 70 >ref|XP_462625.1| Gene info hypothetical protein DEHA0G26389g [Debaryomyces hansenii CBS767] emb|CAG91144.1| Gene info unnamed protein product [Debaryomyces hansenii CBS767] Length=348 GENE ID: 2904357 DEHA0G26389g | hypothetical protein [Debaryomyces hansenii CBS767] (10 or fewer PubMed links)  Score = 33.9 bits (76), Expect = 6.4, Method: Compositional matrix adjust. Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Query 67 IPLQHLTEDNGATEFTLGSHMWG-DVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRG 125 I L T+ NGAT GSH+WG + D+ E A + L +G + T H Sbjct 198 IALTDTTKANGATRVIPGSHLWGPNRCPDNNEGNACYLE----LEKGDCAFILGSTYHAA 253 Query 126 TVNLSNRTRSMLMLIYGRSWWHDRTNY 152 + N+++ R +S+ NY Sbjct 254 SSNMTSEDRITSFYFMTKSYLKQEENY 280 >ref|YP_001412132.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] gb|ABS62475.1| Gene info Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] Length=265 GENE ID: 5455998 Plav_0852 | Phytanoyl-CoA dioxygenase [Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)  Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 31/96 (32%), Positives = 43/96 (44%), Gaps = 8/96 (8%) Query 60 PHAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHS--FLLPRGSFILV 117 P AINV L T +NGAT F GSH+ D +A R + + GS ++ Sbjct 138 PLAINVAWALDDFTVENGATRFVPGSHL-----KDHGPGKASERAQTVPIICKAGSIFVM 192 Query 118 DYRTVHRGTVNLS-NRTRSMLMLIYGRSWWHDRTNY 152 D R H+ N S TR+ L Y R + + N+ Sbjct 193 DGRVWHQTGPNTSGGDTRAGLFAYYVRPFIRPQWNW 228 >ref|ZP_01878938.1| hypothetical protein RTM1035_05470 [Roseovarius sp. TM1035] gb|EDM33041.1| hypothetical protein RTM1035_05470 [Roseovarius sp. TM1035] Length=265 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 25/85 (29%), Positives = 34/85 (40%), Gaps = 9/85 (10%) Query 69 LQHLTEDNGATEFTLGSHMWGDV--WVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGT 126 L T +NGAT GS + DD+ +A ++PRGS + TVH G Sbjct 144 LDDFTAENGATRVVPGSQDLRPINSITDDQITQA-------VMPRGSVLFYLGATVHAGG 196 Query 127 VNLSNRTRSMLMLIYGRSWWHDRTN 151 N + R L+ Y W N Sbjct 197 ANRAAAPRKGLITTYSLGWLRQEEN 221 >gb|AAK01519.1| hypothetical protein [Pseudomonas aeruginosa] gb|EAZ58108.1| hypothetical protein PA2G_01326 [Pseudomonas aeruginosa 2192] Length=309 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD + P F + H P N+ + L TE+NGAT GS Sbjct 151 AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ 199 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P LL G +L + VH G N++ Sbjct 200 DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT 239 >ref|NP_744958.1| Gene info hypothetical protein PP_2814 [Pseudomonas putida KT2440] gb|AAN68422.1|AE016475_1 Gene info conserved hypothetical protein [Pseudomonas putida KT2440] Length=289 GENE ID: 1042682 PP_2814 | hypothetical protein [Pseudomonas putida KT2440] (10 or fewer PubMed links)  Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Query 60 PHAI-NVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVD 118 P AI N+ + L TE+NGAT GS W D ++ P LL G +L Sbjct 152 PRAITNLMLALTDFTEENGATRLIPGSQDWDDF----DDVGTPEMTIPALLKAGDAVLFG 207 Query 119 YRTVHRGTVNLS 130 + VH G N++ Sbjct 208 GKVVHGGGANVT 219 >ref|ZP_00975555.1| COG5285: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Pseudomonas aeruginosa 2192] ref|ZP_01365588.1| hypothetical protein PaerPA_01002714 [Pseudomonas aeruginosa PACS2] Length=288 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 41/104 (39%), Gaps = 15/104 (14%) Query 27 AQHWHRDASLLFPPDARFHLTDVHTRASGAFLPPHAINVFIPLQHLTEDNGATEFTLGSH 86 AQ HRD + P F + H P N+ + L TE+NGAT GS Sbjct 130 AQMLHRDMAQYQP----FVAMNKHA-------PRTITNLMLALTDFTEENGATRLIPGSQ 178 Query 87 MWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYRTVHRGTVNLS 130 W D ++ P LL G +L + VH G N++ Sbjct 179 DWDDF----DDVGTPEMTIPALLKAGDAVLFGGKVVHGGGANVT 218 

ORF finding

ORF Finder/ any codon /  standard code/ 60AA /frame 1,2,3/direct
Results for 664 residue sequence "Untitled" starting "GAGCTTAAAT"

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 663. 
GAGCTTAAATCCTCCCACGCCATACACGCGCTCGCGGGCAAGTCCGGAGCTTCTGACTCC
CCGGCGACAGCGCGCGTCGCGCAGCACTGGCACCGTGATGCCAGCCTCCTTTTTCCTCCG 
GACGCGCGATTCCACCTGACTGACGTGCACACGCGAGCATCAGGGGCCTTCCTTCCACCA 
CACGCGATTAATGTCTTCATTCCACTGCAGCACCTGACTGAGGACAATGGGGCGACGGAA 
TTCACTTTGGGTTCTCACATGTGGGGAGACGTGTGGGTCGACGACGAGGAAGCGGAGGCT 
CCGTTACGCGATCACTCCTTTCTCTTACCGAGAGGCAGCTTTATTCTCGTTGACTATCGA 
ACGGTCCACAGGGGGACCGTGAACCTGTCCAATAGAACAAGATCCATGTTGATGCTAATC 
TATGGGCGATCCTGGTGGCACGACCGAACCAACTACGGTACTGAGGACTATGGTGGCGTC 
GGGCTGTCGGAGGCTCGCCGCGACGACGGGGCCGGTGGTGGACCAGAGGCTGCGATTCAG 
CGTCGCGTTCTCAGGGCGCTCACAGTGTCGGAGGTGGGGCCTTCGGGCGAAGTCTGTGAT 
CTGGGCACAGATGAACATGACCTCTGGCTTCGAGAGCGAATGTGGTGGGGTCTCACGACG 

ATG >Translation of ORF number 1 in reading frame 1 on the direct strand. 
ELKSSHAIHALAGKSGASDSPATARVAQHWHRDASLLFPPDARFHLTDVHTRASGAFLPP 
HAINVFIPLQHLTEDNGATEFTLGSHMWGDVWVDDEEAEAPLRDHSFLLPRGSFILVDYR 
TVHRGTVNLSNRTRSMLMLIYGRSWWHDRTNYGTEDYGGVGLSEARRDDGAGGGPEAAIQ 
RRVLRALTVSEVGPSGEVCDLGTDEHDLWLRERMWWGLTTM 

>ORF number 1 in reading frame 2 on the direct strand extends from base 419 to base 664. 
TCTATGGGCGATCCTGGTGGCACGACCGAACCAACTACGGTACTGAGGACTATGGTGGCG 
TCGGGCTGTCGGAGGCTCGCCGCGACGACGGGGCCGGTGGTGGACCAGAGGCTGCGATTC 
AGCGTCGCGTTCTCAGGGCGCTCACAGTGTCGGAGGTGGGGCCTTCGGGCGAAGTCTGTG 
ATCTGGGCACAGATGAACATGACCTCTGGCTTCGAGAGCGAATGTGGTGGGGTCTCACGA 
CGATGT 

>Translation of ORF number 1 in reading frame 2 on the direct strand. 
SMGDPGGTTEPTTVLRTMVASGCRRLAATTGPVVDQRLRFSVAFSGRSQCRRWGLRAKSV 
IWAQMNMTSGFESECGGVSRRC 

No ORFs were found in reading frame 3.

Même résultat si bacterial code


ORF Finder/ any codon /  standard code/ 60AA /frame 1,2,3/reverse

>ORF number 1 in reading frame 1 on the reverse strand extends from base 115 to base 324.
GAACGCGACGCTGAATCGCAGCCTCTGGTCCACCACCGGCCCCGTCGTCGCGGCGAGCCT
CCGACAGCCCGACGCCACCATAGTCCTCAGTACCGTAGTTGGTTCGGTCGTGCCACCAGG
ATCGCCCATAGATTAGCATCAACATGGATCTTGTTCTATTGGACAGGTTCACGGTCCCCC
TGTGGACCGTTCGATAGTCAACGAGAATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
ERDAESQPLVHHRPRRRGEPPTARRHHSPQYRSWFGRATRIAHRLASTWILFYWTGSRSP
CGPFDSQRE*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 478 to base 660.
TCGCGTGTGGTGGAAGGAAGGCCCCTGATGCTCGCGTGTGCACGTCAGTCAGGTGGAATC
GCGCGTCCGGAGGAAAAAGGAGGCTGGCATCACGGTGCCAGTGCTGCGCGACGCGCGCTG
TCGCCGGGGAGTCAGAAGCTCCGGACTTGCCCGCGAGCGCGTGTATGGCGTGGGAGGATT
TAA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
SRVVEGRPLMLACARQSGGIARPEEKGGWHHGASAARRALSPGSQKLRTCPRARVWRGRI
*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 250.
CATCGTCGTGAGACCCCACCACATTCGCTCTCGAAGCCAGAGGTCATGTTCATCTGTGCC
CAGATCACAGACTTCGCCCGAAGGCCCCACCTCCGACACTGTGAGCGCCCTGAGAACGCG
ACGCTGAATCGCAGCCTCTGGTCCACCACCGGCCCCGTCGTCGCGGCGAGCCTCCGACAG
CCCGACGCCACCATAGTCCTCAGTACCGTAGTTGGTTCGGTCGTGCCACCAGGATCGCCC
ATAGATTAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
HRRETPPHSLSKPEVMFICAQITDFARRPHLRHCERPENATLNRSLWSTTGPVVAASLRQ
PDATIVLSTVVGSVVPPGSPID*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 411 to base 662.
GAACCCAAAGTGAATTCCGTCGCCCCATTGTCCTCAGTCAGGTGCTGCAGTGGAATGAAG
ACATTAATCGCGTGTGGTGGAAGGAAGGCCCCTGATGCTCGCGTGTGCACGTCAGTCAGG
TGGAATCGCGCGTCCGGAGGAAAAAGGAGGCTGGCATCACGGTGCCAGTGCTGCGCGACG
CGCGCTGTCGCCGGGGAGTCAGAAGCTCCGGACTTGCCCGCGAGCGCGTGTATGGCGTGG
GAGGATTTAAGC

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
EPKVNSVAPLSSVRCCSGMKTLIACGGRKAPDARVCTSVRWNRASGGKRRLASRCQCCAT
RAVAGESEAPDLPASACMAWEDLS

Même résultat avec bacterial code