ORF BC18020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160148.1
Annotathon code: ORF_BC18020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : LoDom
Annotated on : 2008-03-19 18:52:37
  • BOEUF dominique
  • GUILLOUX loïc

Synopsis

Genomic Sequence

>AACY01160148.1 ORF_BC18020 genomic DNA
TTTCTGGGGCTACACCAATATGCCTAGAACTCTAGGAAATAGTCTAGGCATCAAAGTTCCGAATGAAATTTATACGACTACTGGAGGAAATTCTCCTCAA
TTACTACTTAATGAGATTTGTAACAGAATAAAAGAAGGAGAATTAAACTGTGCTCTGCTTGCTGGAGGAGAAGCTTTGGATACATTTGTTTCTAGACTTA
AATTAGGACTAGAAGTAAATTGGGGAGATGAACCAGGTGGAGAACCTGAATCCATAGGGAGCTTACGAGACCTAGGAAGTGAATGCGAAAAAAAACACGG
TATTTTTGATCCCTCTTCTGTTTATCCTCTTTTTGCAAATAGCATAAGAGGCGATAAAGGCCAAACTGCACTAGAACATATGGAAGAAATTGGAGAAATG
TTCAGTAGGTTTTCACACATAGCTACAGAGAATCAAGCCTCTTGGTTTAAGGTTGCTAGAAGTCCAAAAGAAATCATTGAAGTAACTCCTCAAAATAGAA
TGATTGGCTTTCCTTATACTAAATATATGAACTCTATAATTAGAGTTAATCAATCCTCTGCTCTAGTAATAACTTCAGCTAAAAAGGCCAGAGAATTGGG
CATTCCTGAATCTAATTGGATATTTTTATATGCAGCTGCAAACCTAAATGATATTTGGAATATAACTGAAAGAGAAAACCTATACTCTTCTCCAGCAATA
AGAAAATGTAGCGAGGCAGTTTTTAGTAAAACAAACTGTTCTCTTGAAGATGTTAAATTTTTTGATCTTTATTCATGTTTCCCTAGTGCAGTACAAATTG
CAAAAAGAGAAATTGGTATATCAGATGAAGATTCAAGAGACCTAACAGTCACTGGAGGGTTGCCCTATTATGGAGGTGCAGGAAGTGCATATGTGG

Translation

[2 - 895/896]   direct strand
>ORF_BC18020 Translation [2-895   direct strand]
FWGYTNMPRTLGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDTFVSRLKLGLEVNWGDEPGGEPESIGSLRDLGSECEKKHG
IFDPSSVYPLFANSIRGDKGQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSIIRVNQSSALVITSAKKARELG
IPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTGGLPYYGGAGSAYV

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

Arbre(s) issus de neighbor :

  17 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


  +------------Aspergillu                                           (Ascomycota)
  ! 
  !                   +-----------------sequence  
  !                   !  
  !                +-12  +---------------1Caulobact            (aproteobacteria)
  !                !  !  !  
  !                !  +-14     +--------------------Hyphomonas (aproteobacteria)
  !                !     !  +-13  
  !                !     +-15  +----------------Comamonas_     (bproteobacteria)
  !                !        !  
  !          +----11        +--------------------gamma_prot    (gproteobacteria)
  !          !     !  
  !          !     !                 +----4Mycobacte          (Actinobacteridae)
  !          !     !               +-4 
  !          !     !               ! +---2Mycobacte           (Actinobacteridae)
  !          !     !     +---------6 
  !          !     !     !         ! +----1Mycobacte          (Actinobacteridae)
  !          !     +----10         +-5 
  3----------9           !           +---3Mycobacte           (Actinobacteridae)
  !          !           !  
  !          !           +-----------------Nocardia_f         (Actinobacteridae)
  !          ! 
  !          !      +--------------Sphingopyx                  (aproteobacteria)
  !          !      ! 
  !          ! +----7          +-----Rhodopseud                (aproteobacteria)
  !          ! !    !      +---1 
  !          ! !    +------2   +------Bradyrhizo               (aproteobacteria)
  !          +-8           ! 
  !            !           +--------2Caulobact                 (aproteobacteria)
  !            ! 
  !            +---------------------Rhodococcu               (Actinobacteridae)
  ! 
  +-----------Gibberella                                            (Ascomycota)

Noms des espèces : 

sequence
gamma_prot g-proteobacterium       (Bacteria; Proteobacteria; gproteobacteria)
1Caulobact Caulobacter crescentus  (Bacteria; Proteobacteria; aproteobacteria)
Comamonas_ Comamonas testosteroni  (Bacteria; Proteobacteria; bproteobacteria)
Hyphomonas Hyphomonas neptunium    (Bacteria; Proteobacteria; aproteobacteria)
Nocardia_f Nocardia farcinica      (Bacteria; Actinobacteria; Actinobacteridae)
1Mycobacte Mycobacterium sp.       (Bacteria; Actinobacteria; Actinobacteridae)
3Mycobacte Mycobacterium avium     (Bacteria; Actinobacteria; Actinobacteridae)
2Mycobacte Mycobacterium smegmatis (Bacteria; Actinobacteria; Actinobacteridae)
4Mycobacte Mycobacterium tuberculosis(Bacteria;Actinobacteria; Actinobacteridae)
Rhodococcu Rhodococcus sp.         (Bacteria; Actinobacteria; Actinobacteridae)
Bradyrhizo Bradyrhizobium japonicum(Bacteria; Proteobacteria; aproteobacteria)
Rhodopseud Rhodopseudomonas palustris(Bacteria;Proteobacteria; aproteobacteria)
2Caulobact Caulobacter sp.         (Bacteria; Proteobacteria; aproteobacteria)
Sphingopyx Sphingopyxis alaskensis (Bacteria; Proteobacteria; aproteobacteria)
Aspergillu Aspergillus nidulans(GE)(Eukaryota; Fungi; Ascomycota)
Gibberella Gibberella zeae   (GE)  (Eukaryota; Fungi; Ascomycota)

Groupe Externe : GE (Eucaryotes)
Groupe d'Etude : Bactéries

Annotator commentaries

Notre séquence mesure 896pb. La recherche d’ORF a révélé cinq cadres de lecture possibles : en commençant par un codon alternatif nous en obtenons quatre : en +2 de la base 2 à 895, en -1 de 496 à 699, en -3 de 129 à 347 et de 576 à 800 ; en commençant par un ATG nous en avons un en +2 de la base 20 à 895. Après avoir fait un blast contre nr de chacun d’entre eux, le plus concluant se révèle être le +2 commençant par un codon alternatif. Ce choix a été motivé car le blastp révèle de meilleurs e-values (les plus faibles) que le +2 commençant par un ATG. En effet, les autres cadres de lecture ont été écartés car ils ne révélaient aucunes homologies avec les organismes connus (en utilisant blastp contre nr). Cet ORF est choisi, bien qu’il soit tronqué en 3’. Il coderait pour un fragment de protéine de 298 AA, soit 32,96kDa. Pour la recherche de domaines protéiques, InterPro révèle deux domaines thiolase-like (SSF53901 pour les deux), prenant la quasi-totalité du fragment (de 4 à 199 et de 200 à 297). Le blastp contre swissprot ne donne rien d’intéressant, les e-values obtenus sont élevés (le plus faible étant 0.004) et le nombre de hits est faibles. Par contre, le blastp contre nr montre que les protéines orthologues (e-value 1e-71) sont des acetoacetyl-CoA thiolase. L’acetoacetyl-CoA thiolase est une enzyme qui catalyse la formation réversible de l’acetoacetyl-CoA à partir de deux molécules d’acetyl-CoA. Après obtention d'un arbre par la méthode Neighbor-joining, nous pouvons observer que notre séquence fait partie du groupe taxonomique des protéobactéries. En effet, il y aurait eu deux évènements de spéciation aux noeuds 11 et 8 suggérant que l'ancêtre 9 serait une protéobactérie, et que par conséquent le groupe d'actinobactérie descendant du noeud 10 et Rodococcus seraient une convergence. D'après le principe de l'horloge moléculaire, il y a peu de chance qu'il y ait eu évènement de spéciation entre le noeud 12 et notre protéine ; notre ORF ferait donc parti d'un génôme de protéobactérie. Selon cette hypothèse, seul les actinobactéries serait les orthologues à notre organisme et les protéobactérie seraient des paralogues. Ci-dessous, la liste des orthologues, leur numéro d’accession et leur nombre d’acide aminé : - Mycobacterium sp. EAS_95141 409 AA ; - Mycobacterium avium NP_960511 494 AA ; - Mycobacterium smegmatis YP_887911 488 AA ; - Mycobacterium tuberculosis NP_216383 494 AA ; - Nocardia farcinica YP_121661 509 AA ; - Rhodococcus sp. YP_7000393 499 AA ; Grâce à ces informations, nous pouvons déterminer qu’il manquerait à notre fragment de protéines environ 184,2AA.

Multiple Alignement

CLUSTAL W (1.83) multiple sequence alignment


sequence                         --------------------------------------------------
1Caulobacter_crescentus          -------MRDDTPVLIGAGQFT----YRGEAANSPSPLELLKVAAERAVL 39
Comamonas_testosteroni           ----MAQDKTRIPVIVGTGQVT---DTTSKPEDARSPLQLMVEAAQLAAQ 43
Hyphomonas_neptunium             ------MAKGDFPVLIGVGQAMSQWDGKNGADGAPSPLSLMADASNAALV 44
gamma_proteobacterium            ------MNSDSQPIIIGVGQAIWR-----ERDVTRTPVDALQDVGTKALS 39
1Mycobacterium_sp.               -----MPSPAHTPVLVGYGQVNQR-EDRPD----LEPVDLMEAAAREA-- 38
3Mycobacterium_smegmatis         -----MN---RTPVLVGYGQVSQY-DENPA----TEPVDLMAEAARNA-- 35
2Mycobacterium_avium             -----MTVDPRTPALIGYGQVNHR-DDIDPAVRSVEPVDLMAAAVERA-- 42
4Mycobacterium_tuberculosis      -----MPVDPRTPVLIGYGQVNHR-GDIDAEKQSIEPVDLMAAAARKA-- 42
Nocardia_farcinica               --MLPAGMDPRTPVLVGVGQVVHR-SGEPG---LPGPVELAAEALRRAGA 44
Gibberella_zeae                  ----MAALPSLTPVIIGIGESRQK--DFT-IETCREPAELILSAIRDASK 43
Aspergillus_nidulans             -----MPIAAEIPILVGVGEINDR--AAKGRDDAAEPLTLMLRAIGAAIQ 43
Rhodopseudomonas_palustris       MAS--QLPPERIPVIAGIGEIAD---HPKDIAQGLEPLALLEQAARRAGD 45
Bradyrhizobium_japonicum         MTDNTNIPEDRIPVIVGIGEIVD---RPKEITEGLEPFDLLEQALRRAEA 47
2Caulobacter_sp.                 ------MNPDRIPVIVGVGEAID---RPSDLARALEPLALMEAALREADA 41
Sphingopyxis_alaskensis          -----MTDPERIPVIIGVGQVND---RPADPDDGLDSLGLMVAALKVAAD 42
Rhodococcus_sp.                  ------MDPTRIPVIVGVGDIRSG--RAGDPAAPREPLDLITDAARAALA 42
                                                                                   

sequence                         ------------------------------------FWGYTNMPRTLGNS 14
1Caulobacter_crescentus          DAGLSG-TVLAELD---ALAVVAFSIDAPGGLSKLPLPRLSDPPASLARA 85
Comamonas_testosteroni           DSGADAKALLGSLD---SVTVIRLFADTSPRF-ASPFGKLANPPWSVARR 89
Hyphomonas_neptunium             DTGVSG--MAAAID---ALAVVRIFEDSVPGD-RHPHGHNTNLPGTLARE 88
gamma_proteobacterium            NTGSEQ--VLAAID---RIVHVPFLMNQVPGF---AEAMPVNPGAALAER 81
1Mycobacterium_sp.               ----ADARVLEAVD---AVRVVNLLS-----------WRYRDPGLLLAQR 70
3Mycobacterium_smegmatis         ----ADPRVLQAVD---SVRVVNLLS-----------WRYRDPGLLLAGR 67
2Mycobacterium_avium             ----ADAAVIEAVD---SIRVVNILS-----------AQYRDPGLLLGQR 74
4Mycobacterium_tuberculosis      ----ADSTVLEAVD---SIRVVHMLS-----------AHYRNPGQLLGER 74
Nocardia_farcinica               DS-GAGDRLVRAAD---VVAAVAPVS-----------KPYPDLAAMVAGE 79
Gibberella_zeae                  DSSIN--AVEKLD----SISVVPPWS----------WNYD-DLPKLLAQR 76
Aspergillus_nidulans             DTTLTTDAAQKLQSAIESVSVVANWT----------WPYP-DAPGLLVKR 82
Rhodopseudomonas_palustris       DS-SVHLLREIDS-----LDIVNFLS----------WRYH-APEQQLAAK 78
Bradyrhizobium_japonicum         DA-GAKLLGEVQS-----LDVVNFLS----------WRYR-DPEKLLAQR 80
2Caulobacter_sp.                 DA-GGGFLARIAS-----LDVVNQLS----------WRYA-DAAGELCAR 74
Sphingopyxis_alaskensis          DA-GVS-LTDIDS-----LAIVDQIS----------FHHLGKLCEPLAAA 75
Rhodococcus_sp.                  DSGSATLGSRIDA-----IHAVKTVS----------WSYD-DLPGLLAAR 76
                                                                               :   

sequence                         LGIKVP-NEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDTFV 63
1Caulobacter_crescentus          VSASPR-WSVYTETGGNSPQQAVNVVCERIAQGESDLALVTGAEFLGSLM 134
Comamonas_testosteroni           VGANAASDLVYPPQGGDTPQVLLARVCERIAQGESQSALIVGGEALRSEL 139
Hyphomonas_neptunium             TNTNPG-YLVYETVGGQSPQALVNEFARRIHDGEFDAVLISGSEANRASK 137
gamma_proteobacterium            LGISAA--QFTSDVGGNLPQQLLNEFARRLSQGDGDVVLLCGVELLATFL 129
1Mycobacterium_sp.               IGADKAATRYTG-IGGNVPQSLVNQACLDIQSGRHNVVLIAGAETWRTRT 119
3Mycobacterium_smegmatis         IGAAGARTRYTG-IGGNVPQTLVNHACLDLQAGRAEVVLIAGAETWRTRS 116
2Mycobacterium_avium             IGARDFGTLYTP-VGGNVPQSLVNQACLDIQRGRANVVLLAGAETWRTRR 123
4Mycobacterium_tuberculosis      IKARTFTTGYSG-VGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWRTRT 123
Nocardia_farcinica               LGATPKRTAQTARFGGDGPQRLVNWAAQAIADGRAEVVLIAGAESVAAAN 129
Gibberella_zeae                  LGIQP-SHLELASHGGNTPALLCDKAAARVASGDVKMAVVTGGEALASLF 125
Aspergillus_nidulans             LGLPG-AVHTVESHHG---------GDSPVQSG------IENG------- 109
Rhodopseudomonas_palustris       LGVSPRHCYYGPVG-GESPIRFIHEAALRIARGEAHVAVVCGAEAQSTVT 127
Bradyrhizobium_japonicum         LGITPSHCHYGPVG-GESPIRYIHEAAKRIARGECSVAAVCGAEAQSTAT 129
2Caulobacter_sp.                 LAIAPTRAVYGPVG-GESPVRFLHEAALRIARGEAEVCAVVGAEAQWSVN 123
Sphingopyxis_alaskensis          IGANPAIKYQSAAPHGDTPVRLLNEAANRIGAGEVKLAAVVGGEALRTAA 125
Rhodococcus_sp.                  LNLPSPRSSTSPIG-GHWPAAFLDRIGDDIAAGRSSAALLVGGEAQATMT 125
                                                *             :  *      : .        

sequence                         SRLKLGLEVN-WGDEPGGEPES--IGSLRDLGSECEKKHGIFDPSSVYPL 110
1Caulobacter_crescentus          KRMKGGLGFEGWGDDITTAPQR--IGDPRPGVTRQEAAHGLGYPVNTYPL 182
Comamonas_testosteroni           AAKRAGLSLQ-WGEDAPTQPNT--LDGVKDMYTAEEEAHGMRSAIAMYGL 186
Hyphomonas_neptunium             GARKNGVEIN-WADQDARDYED--RGLGPMMLSRGEIKHGLVTPAYFYGL 184
gamma_proteobacterium            GAVRGGDGFPDWATGQEDTALQ--VGETPVMTAPTEQAHGLYEPINAYPL 177
1Mycobacterium_sp.               RLRAKGERPN-WTRQDESVPIADGADENVPMAGDAENRILLDRPSYVYPM 168
3Mycobacterium_smegmatis         RLRARGVRPD-WTRQDDTVPVAPGGDDNVPMAGDAENRIKLDRPAFVYPM 165
2Mycobacterium_avium             GLRAKGGKLV-WTEQDRSVPMAEVSGEDVAMAGEAEIRISLDRPAYVYPL 172
4Mycobacterium_tuberculosis      GLRAKGSKLE-WTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPI 172
Nocardia_farcinica               AAKRAGTVPD-WPDQPADATPDEVLGSDKGPNSEMETGAGLWGPIYFYAL 178
Gibberella_zeae                  ACQKAGKIPPPGWTEMSPDAKRYSPGDT-SLKKGAGATHSIGNPIQVYPL 174
Aspergillus_nidulans             --QRK-------LTELD-----------------LGSRHFLGAPIQVYPL 133
Rhodopseudomonas_palustris       -KAARAKLELPWTPFASDAPEPKRGA---AFQKPIATQLGVARPITVYPL 173
Bradyrhizobium_japonicum         -KAERAGAKLPWTPFAHDVEEPKRGA---AFQKPLAVKLGVFRPVTVYPF 175
2Caulobacter_sp.                 -KARAAGIDLPWTPKPPASGGGPR-----IEVHPLALKLGVFLPVSVYPF 167
Sphingopyxis_alaskensis          GRAAKAASGEDKSYNAVRRVATRR-------EPNYAQKHGLAAPVDVYPL 168
Rhodococcus_sp.                  -ALRKSGTDPASLGWASAPGGPPAFDPA-DLGSPAMQRAGLIVPTRVYPL 173
                                                                         :  .   * :

sequence                         FANSIRGDKGQTALEHMEEIGEMFSRFSHIATENQASWFK--VARSPKEI 158
1Caulobacter_crescentus          FENALRARDGRSQEEHQKQLGAFFAPFTKVAAANPHAWFP--VERTAEEL 230
Comamonas_testosteroni           IGQSLRQSAGQSVDEYREASARLFSGLAAVAKANPLATRR--AGYSAEAI 234
Hyphomonas_neptunium             FENAIAAREGRGRAGQRKAMAELFQPFSATAAKNPWSQFP--QEHSVEFL 232
gamma_proteobacterium            FESAQAHARGLSVDEHQALLGKLVSDMSHVAAENPYAWKN--QALSADAV 225
1Mycobacterium_sp.               FEQAVRIAAGETPDEHRRRIGELWAQFSAVAADNPHAWRR--DALAADAI 216
3Mycobacterium_smegmatis         FEQALRIAAGETPDEHRDRIGALWSRFSAVAARNPHAWNR--DAVTAQQI 213
2Mycobacterium_avium             FEQALRVATGESVEDHLTRIGRLWARFNAVAVDNPHAWIR--TPHSADDI 220
4Mycobacterium_tuberculosis      FEQALRIAYGESIENHRKRIGELWARFSAVAADNPHAWIR--NPVTADEI 220
Nocardia_farcinica               IENALRGRLGLSEPAYLERIGGLWSRFSEIAATNPYAWLP--ERHSVRGL 226
Gibberella_zeae                  YENAYRKQNQQSYIENHHESAELYTQFDKIACQHPNSWRAEETPRTLEDI 224
Aspergillus_nidulans             YEAAFRAHNKQTLSENHKESAELYAEFAQTAAKLPFSWSYGQKPETAESI 183
Rhodopseudomonas_palustris       YEAATAAHWGQTPRQALDESGVLWSRYAQAAAANPNAWIK--RAFAPSEI 221
Bradyrhizobium_japonicum         YEAASSAHWGQTPREAMAESGTLWSRYSEAAAQNPNAWLK--RRYAPDEI 223
2Caulobacter_sp.                 YENAAAHHWGQTPRQALAESGALWSAYAAVAAGQPNAWIK--TAFTPDQI 215
Sphingopyxis_alaskensis          YENATRAAWGQSLADAQLESAEIWSRFSEVAAGNEGAWIR--KPASPDDI 216
Rhodococcus_sp.                  FENRVAHESGVGPDQSLAESARMYSAFSELAAKNPASWTS--EVYSVQEI 221
                                                     . :       *     :        :   :

sequence                         IEVTPQNRMIGFPYTKYMNSIIRVNQSSALVITSAKKARELGIPESNWIF 208
1Caulobacter_crescentus          VTVTDRNRMVGYPYPKYLNAIMEVDQSAAVLIASVRKARELGVPEDKWVF 280
Comamonas_testosteroni           AEVTPDNPYVGFPFTKLMTASAFIDQSAAFIVVSEAKADELGIPVDKRVY 284
Hyphomonas_neptunium             STPSRENYEYADPFLKWFIAQDAVNQGAAAIIVSSSKADELGVPEGKRVY 282
gamma_proteobacterium            LSTDGGNRMISHPYTKVMNAVLAVDQAAAVVLTTVGKARELNIDPERWIY 275
1Mycobacterium_sp.               WQPSPENRMISFPYPKLMNSNNMVDQGAVLILTSVETARQLKIPSERWIF 266
3Mycobacterium_smegmatis         TQVGPDNRMISWPYPKLMNSNNMVDQGAVLILTTVQMATYLQIPMDRWVF 263
2Mycobacterium_avium             CRAGPHNRMISWPYTKLMNSNNMVDQGAALVLTSVEQARRLKVPPERWVY 270
4Mycobacterium_tuberculosis      WQPGPQNRMVSWPYTKLMNSNNMVDQGAALLLTSVERATRLRIPAERWVY 270
Nocardia_farcinica               ITATPDNRMVTSPYRKLLVANLSVDQGAGLILCSAAAADAAGVPRERWVF 276
Gibberella_zeae                  KTVSKRNRMICTPYPLLMNAFNGVNLAAACIITSTEYATKLGVPREKWVY 274
Aspergillus_nidulans             GNVTKRNRMICSPYPLLMNAFNTVNLAAACIITTTTFARELGIPESKWIY 233
Rhodopseudomonas_palustris       TTPSPDNRLIAWPYTKLMVANPSVNLGAAVLLTSLAKAREAGIAEEKLIY 271
Bradyrhizobium_japonicum         TTPTADNRLIAWPYHKLMVANPSVNMGGALLLTSLARARAAGIAEDRLVY 273
2Caulobacter_sp.                 VTPRPDNRPIAWPYTKLMVANMQVNQGAAVILTSLAAARAAGISDDRLVF 265
Sphingopyxis_alaskensis          LDVNERNRPIAFPYSKLMVANSSVNQGAGFLVASLAEARRRGIAEDRLIY 266
Rhodococcus_sp.                  ATVGPGNRMVCEPYPLMLNAMPFVDQAAAVLVCSLAVARDHGVPEERTVY 271
                                       *     *:   : :   :: ..  :: :   *    :   . ::

sequence                         LYAAANLNDIWNITERENLYSSPAIRKCSEAVFSKTNCSLEDVKFFDLYS 258
1Caulobacter_crescentus          LHGCADACDLWYPLERQDYHSSPAMRLTGQRAFEMAGISVDDLDVIDLYS 330
Comamonas_testosteroni           LHGSAAAHDQWFVSERPQLDESPAMRLSARHALAQAGRTMDQVEFLDIYS 334
Hyphomonas_neptunium             LHGGGEAGDD-HISVRPVLDRSWAMDTAVSRALAQAGKTTADIHHFDLYS 331
gamma_proteobacterium            LRGAASAHDSWYLGQRMKLSESPALKAACDGALSQSGLDVEELTHFDLYS 325
1Mycobacterium_sp.               PYAGTDSHDTYAIGERAEFHRSPAIRIAGQRVLELADTAIEDVELIDVYS 316
3Mycobacterium_smegmatis         PYAGTDSHDTYAIGERDELHRSPAIRIAGRRVLELAGADIDAIDFVDVYS 313
2Mycobacterium_avium             PLAGTDAHDTASIAERHELHRSAAIRIAGARALQLAGLGIDDVDHVDLYS 320
4Mycobacterium_tuberculosis      PQAGTDAHDTPAVADRHRLHRSTAIRIAGARALELAGLGLDDIEYVDLYS 320
Nocardia_farcinica               PHGGATGNEVWFVSERADMAASPAIAAVGAQALSDAGVGIDDIAHIDLYS 326
Gibberella_zeae                  VTGGAGSNDSSDFWERSNYYSSPAIEYSIDNALKAAGLKKDEIDCFDFYS 324
Aspergillus_nidulans             PLGGAGTSDSSRFWERPFFHASRSLSQSLDAALKITELRTDDIDLFDIYS 283
Rhodopseudomonas_palustris       IHGGASAEEPRDYLARDQFHQSHAQNAVLETIKAMVGGDGRVFDAIELYS 321
Bradyrhizobium_japonicum         PLGGASAEEPRDYLLRDQFYESHPQNAVLKAAVDLAGGDGTAFEAIELYS 323
2Caulobacter_sp.                 VWGGAAAREPGDYLQRDHYHGSVAQDAVLEAVAGMAP-DG--FDALELYS 312
Sphingopyxis_alaskensis          IGMGAAAKEPASILARDRYDHSVSMETSIARTLALNGMTAHDFDCVELYS 316
Rhodococcus_sp.                  LWGGAGAADPVDVLSRNGFGTSAAMTNAVHRALSRASIDASALDIVDAYS 321
                                         :      *     * .                  .  .: **

sequence                         CFPSAVQIAKREIGIS-DEDSRDLTVTGGLPYYGGAGSAYV--------- 298
1Caulobacter_crescentus          CFPSAVRIGAEEIGLA-LDDPRGLTITGGLPYFGGPGNNYALHAIAEMVA 379
Comamonas_testosteroni           CFPSAVQIACKELGIR-PDDPRQLSVTGGLPYFGGPGNNYVTHAIAEMVQ 383
Hyphomonas_neptunium             CFPCAVFSGAAALGIDWKTDKRPLTLTGGLPFFGGPGNNYSLHGIAEMVA 381
gamma_proteobacterium            CFPAAVQAGCDALGIQ-PDDPRGVTVTGGLSLFGGPGNNYSLHGIASMAD 374
1Mycobacterium_sp.               CFPSAVQVAATELGLPVGDPARPLTVTGGLTFAGGPWNNYVSHSIATMAE 366
3Mycobacterium_smegmatis         CFPSAVQVAAAELGLPTDDPARPLTVTGGLTFAGGPWNNYVTHSIATMAE 363
2Mycobacterium_avium             CFPSAVQVAAAELGLGLDDPARPLTVTGGLTFAGGPWSNYVMHSIATMAE 370
4Mycobacterium_tuberculosis      CFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNYVTHSIATMAE 370
Nocardia_farcinica               CFPIAVQVGAEALGLPLDDPSRPLSLTGGLTFGGGPGNNYTTHAIAALAE 376
Gibberella_zeae                  CFPIVPKIACKHVGLDLLNPKKPITLLGGLTSFGGAGNNYSLHAIAEMVR 374
Aspergillus_nidulans             CFPIVPKLAAHHLGLPLHG-TKPITVLGGLTSFGGAGNNYSMHAITEMAR 332
Rhodopseudomonas_palustris       CFPVVPKMARRTLGLGDDV---QPTVTGGLTFFGAPLNTYMTHAACAMVR 368
Bradyrhizobium_japonicum         CFPCVPKMARRTLGLSADV---QPTVTGGLTFFGAPLNTYMTHAACAMVR 370
2Caulobacter_sp.                 CFPCVPKMARRTLGLPTDV---TPTVTGGLTFFGAPMNDYMTHAAVAMTR 359
Sphingopyxis_alaskensis          CFPCVPKMARRILGWPLDR---PASVFGGLTFGGGPIANYMSHAVVSMVE 363
Rhodococcus_sp.                  CFPVVPKLLTRTLGLPESI---VPSVTGGHSFFGGPLNSYTLHSIAEVTR 368
                                 *** .       :*          :: ** .  *..   *          

sequence                         --------------------------------------------------
1Caulobacter_crescentus          KLRA-----RPGAYGLSTANGWFLTKQSVGIYSTRPVEG-KWEREPPSVI 423
Comamonas_testosteroni           RVRS-----QPGSFGLVMANGGLVTKEAVGVFSTQRPDK-PFVREPASVI 427
Hyphomonas_neptunium             LLRE-----NPGNTGLVLANGGWMTKEAAGVYSAAKP---------AKFT 417
gamma_proteobacterium            RLRE-----TPGGAGLVWANGGYLTKHAVGVYAREPGDS-PWVPGDDEML 418
1Mycobacterium_sp.               RLAA-----NPGQRGLITANGGYLTKHSFGVYGTEPPQH-EFRWEDVQSE 410
3Mycobacterium_smegmatis         KLVA-----EPGTRGLITANGGYLTKHSFGVYGTEPPEQ-EFRWEDVQSV 407
2Mycobacterium_avium             LLVA-----NPGRRGLITANGGYLTKHSFGVYGTEPPA--EFRWEDTQSA 413
4Mycobacterium_tuberculosis      LLAA-----NPGRRGLITANGGYLTKHSFGVYGTEPPS--EFRWEDMQPA 413
Nocardia_farcinica               RLRA-----EPDSFGLATALGWYATKHGVGVYSTRPPAR-LFRAVEVP-- 418
Gibberella_zeae                  VIRK-----GKYQNGLVLANGGVLSWQHAICLSAKPKRNGSAYEAPAVLD 419
Aspergillus_nidulans             QLRTRKQASSKAQNGLVLANGGVLSYHHTVILSTRP-RQDADYPMWNPLP 381
Rhodopseudomonas_palustris       RLRG------GARLGLLYGQGGFVTKHHALVLSRTPSQQ--ALSESVSVQ 410
Bradyrhizobium_japonicum         RLRD------GARLGLLYGQGGFVTKHHALVVSKAPPRA--ALAQETSVQ 412
2Caulobacter_sp.                 RLRE------GG-TGLLYGQGEFVTKHHGLVLADRPASDGVRALEDISVQ 402
Sphingopyxis_alaskensis          KLRS------EGRYGFLFANGGFATDNHCIVLGNQPIAA-ASFPQDFDYQ 406
Rhodococcus_sp.                  RLRE------GAGPALVHGNGGYLTYQHVVLLAGAPHPG------GYVGD 406
                                                                                   

sequence                         --------------------------------------------------
1Caulobacter_crescentus          QARIDALP-HPEIIEKPQGRAVIETYTVVHG--REGVRMGIVIGRDSRG- 469
Comamonas_testosteroni           QDEIDRLTPRQALNAKPEGEAVIETCAVLHG--KKGPERGVLFGRLLSTN 475
Hyphomonas_neptunium             PAEKGAKPAEQVEIATESCEGTLETFTVTHG--KEGPERGIIFARLADG- 464
gamma_proteobacterium            QAAIDALPLVELVDAG-EGGFLLEAHTVTYA--REGPTRAIALGKLADG- 464
1Mycobacterium_sp.               VDREPTRTLAVEWSGTGTVESWTTPFN------RDGIPEKAFLAVRTPEG 454
3Mycobacterium_smegmatis         VDAEPTRKLAVEWVGTGTVESWTTPFN------RDGAPEKAFLAVRTPDG 451
2Mycobacterium_avium             VDREPTTDAAVEWEGVGTVEAWTTPHD------REGEPEKAFLAVRTPDG 457
4Mycobacterium_tuberculosis      VDREPTGDGLVEWEGIGTVEAWTTPVN------RDGQPEKAFLAVRTPDG 457
Nocardia_farcinica               -TPDAHRATAPGYTGPATVESYTVPYRKGPAPERADEPEAVVVSALNPAG 467
Gibberella_zeae                  NGQTSQG---PTFTAQAQGEAIIETYTVDHD--RSG-PKLGHIIGRLVE- 462
Aspergillus_nidulans             SNVDEEH---PPIKEQAEGGGIIETYTVQFG--RDGSPVMGFVVGRLLDR 426
Rhodopseudomonas_palustris       TKADAAYGDVPPFVTDASGDGTVESFTVIFT--GKGDVEHGVVVLRTSD- 457
Bradyrhizobium_japonicum         EEADRNKRAVPNFVAEASGKGKVESFTVLYG--RGGDVEHGVVMLRTED- 459
2Caulobacter_sp.                 ATADARREPVPAFVEIAIGPAALETHTVLYD--RDGAPTHGVAIVRTAD- 449
Sphingopyxis_alaskensis          AEAEAKRGPVPELAEDYAGPATIESYTVFYG--RDGEPKAGVVVARTPD- 453
Rhodococcus_sp.                  PEPVQLASEAPELVTSYEGRADIVTSTVEHG--RDGAPATGFVVAHTPD- 453
                                                                                   

sequence                         --------------------------------------------------
1Caulobacter_crescentus          ----RRFVAQTPDDPEILRDLESREGVGRTGTVGPHPDGVRNLFVPD--- 512
Comamonas_testosteroni           ----ERFLANTPSDAATLALLQSDQALGLR-GQVSQVDGLNVFVPAA--- 517
Hyphomonas_neptunium             ----RRAIANN-ADAATLAVLREDASPVGR-KVAITVDGETGSFQFK--- 505
gamma_proteobacterium            -----RRCAAVSDDPDVMHALVSG-NYVGQLAQVRHEDGLNRFRLVAAD- 507
1Mycobacterium_sp.               ----ARTLAVIHDAQDAAATVEGDIAGAAVTVYADGTARLAI-------- 492
3Mycobacterium_smegmatis         ----ARTLAVITDESQAAATVREDIAGARVEVHADGTATLL--------- 488
2Mycobacterium_avium             ----SRALAVVTDRAAAQATVREDIGGAKVAVAADGSATLQ--------- 494
4Mycobacterium_tuberculosis      ----SRSLAVITDPASVQATVREDIAGVKVAVAPDGTATLR--------- 494
Nocardia_farcinica               ----ARTLVRVSDPGIIAAFTETDPLGAKIDIVAADRITLSERTAR---- 509
Gibberella_zeae                  ----TGDRFIANHGDEMTLSALPH-------------------------- 482
Aspergillus_nidulans             FGNGNGDRFIANVEDANTLQQLCSGTEQVGKQGWVSTKDGRNLFVYKQAK 476
Rhodopseudomonas_palustris       ---GARTLARVPAQDQATLAVLTNMDRSPVGTNGPITTSADGVLEWRAV- 503
Bradyrhizobium_japonicum         ---DRRTLARIPAGDTATLAHLLNMDRTPVGSLGEIAMAGDGVPEWRVS- 505
2Caulobacter_sp.                 ---GGRALARVPAEDTDTLAALTNPDAFAIGRTGTLQAGGDGVLDWRL-- 494
Sphingopyxis_alaskensis          ---GQRTLAHVDVSDAAMLAFLTDGTREPVGTEGQVVQLVEG-YGWRTA- 498
Rhodococcus_sp.                  ---GRRLAGHTGSEEALALSAFAQTPARSVIGRSVDVTDRDGILSLRF-- 498
                                                                                   

sequence                         -
1Caulobacter_crescentus          -
Comamonas_testosteroni           -
Hyphomonas_neptunium             -
gamma_proteobacterium            -
1Mycobacterium_sp.               -
3Mycobacterium_smegmatis         -
2Mycobacterium_avium             -
4Mycobacterium_tuberculosis      -
Nocardia_farcinica               -
Gibberella_zeae                  -
Aspergillus_nidulans             I 477
Rhodopseudomonas_palustris       -
Bradyrhizobium_japonicum         -
2Caulobacter_sp.                 -
Sphingopyxis_alaskensis          -
Rhodococcus_sp.                  -
                                  

BLAST

Blastp contre nr :

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,198,544 sequences; 1,444,632,299 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  Translation of ORF number 1 in reading frame 2 on the direct strand.
Length=298

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|16126210|ref|NP_420774.1|  acetyl-CoA acetyltransferase [Ca...   272    1e-71 
gi|118054381|ref|ZP_01522911.1|  acetyl-CoA acetyltransferase ...   238    2e-61
gi|118054324|ref|ZP_01522862.1|  acetyl-CoA acetyltransferase ...   229    1e-58
gi|92907510|ref|ZP_01276290.1|  conserved hypothetical protein...   209    9e-53
gi|92912755|ref|ZP_01281385.1|  conserved hypothetical protein...   208    2e-52
gi|88705016|ref|ZP_01102728.1|  conserved hypothetical protein...   205    2e-51
gi|89340999|ref|ZP_01193245.1|  conserved hypothetical protein...   203    7e-51
gi|118466577|ref|YP_882037.1|  acetyl-CoA acetyltransferase [M...   201    4e-50 
gi|41407675|ref|NP_960511.1|  acetyl-CoA acetyltransferase [My...   200    7e-50 
gi|118473382|ref|YP_887911.1|  acetyl-CoA acetyltransferase [M...   199    1e-49 
gi|90204423|ref|ZP_01207066.1|  conserved hypothetical protein...   199    2e-49
gi|111017421|ref|YP_700393.1|  hypothetical protein RHA1_ro003...   197    4e-49 
gi|81254063|ref|ZP_00878590.1|  COG0183: Acetyl-CoA acetyltran...   197    6e-49
gi|15609004|ref|NP_216383.1|  acetyl-CoA acetyltransferase [My...   195    2e-48 
gi|76784384|ref|ZP_00771569.1|  COG0183: Acetyl-CoA acetyltran...   195    2e-48
gi|89337543|ref|ZP_01190321.1|  conserved hypothetical protein...   185    3e-45
gi|118570510|gb|ABL05261.1|  conserved hypothetical protein [Myco   185    3e-45
gi|92907855|ref|ZP_01276634.1|  conserved hypothetical protein...   184    4e-45
gi|85710281|ref|ZP_01041346.1|  acetyl-CoA acetyltransferase [...   169    1e-40
gi|46139307|ref|XP_391344.1|  hypothetical protein FG11168.1 [...   169    1e-40 
gi|111224155|ref|YP_714949.1|  Putative enoyl-CoA hydratase [F...   166    1e-39 
gi|92912259|ref|ZP_01280893.1|  conserved hypothetical protein...   164    6e-39
gi|92917661|ref|ZP_01286272.1|  conserved hypothetical protein...   163    7e-39
gi|54027419|ref|YP_121661.1|  acetyl-CoA acetyltransferase [No...   160    5e-38 
gi|115384060|ref|XP_001208577.1|  conserved hypothetical prote...   160    6e-38 
gi|111022651|ref|YP_705623.1|  hypothetical protein RHA1_ro056...   160    9e-38 
gi|118571897|gb|ABL06648.1|  thiolase [Mycobacterium ulcerans Agy   158    4e-37
gi|87200515|ref|YP_497772.1|  hypothetical protein Saro_2502 [...   155    2e-36 
gi|111066943|gb|EAT88063.1|  hypothetical protein SNOG_04303 [Pha   153    1e-35
gi|89341489|ref|ZP_01193733.1|  conserved hypothetical protein...   153    1e-35
gi|41406996|ref|NP_959832.1|  acetyl-CoA acetyltransferase [My...   152    1e-35 
gi|91976335|ref|YP_568994.1|  putative acetyl-CoA acetyltransf...   149    2e-34 
gi|118463301|ref|YP_880330.1|  acetyl-CoA acetyltransferase [M...   147    5e-34 
gi|113932644|ref|ZP_01418546.1|  possible acetyl-CoA acetyltra...   147    7e-34
gi|115523719|ref|YP_780630.1|  putative acetyl-CoA acetyltrans...   146    1e-33 
gi|85372884|ref|YP_456946.1|  hypothetical protein ELI_00285 [...   146    1e-33 
gi|39934825|ref|NP_947101.1|  acetyl-CoA acetyltransferase [Rh...   145    2e-33 
gi|86750717|ref|YP_487213.1|  acetyl-CoA acetyltransferase [Rh...   145    2e-33 
gi|114797538|ref|YP_759708.1|  hypothetical protein HNE_0984 [...   143    9e-33 
gi|90201366|ref|ZP_01204012.1|  conserved hypothetical protein...   143    9e-33
gi|78695742|ref|ZP_00860253.1|  conserved hypothetical protein...   143    1e-32
gi|103487293|ref|YP_616854.1|  acetyl-CoA acetyltransferase [S...   142    2e-32 
gi|27378047|ref|NP_769576.1|  acetyl-CoA acetyltransferase [Br...   139    1e-31 
gi|118468053|ref|YP_889758.1|  acetyl-CoA acetyltransferase [M...   137    4e-31 
gi|67539366|ref|XP_663457.1|  hypothetical protein AN5853.2 [A...   132    1e-29 
gi|90306415|gb|EAS36046.1|  hypothetical protein CIMG_01400 [Cocc   124    4e-27
gi|1197356|emb|CAA59498.1|  acetyl CoA synthase [Pyrococcus furio  54.7    6e-06
gi|18977345|ref|NP_578702.1|  acetyl-CoA acetyltransferase [Py...  54.7    6e-06 
gi|111058279|gb|EAT79399.1|  hypothetical protein SNOG_13072 [Pha  53.1    2e-05
gi|14590558|ref|NP_142626.1|  acetyl-CoA acetyltransferase [Py...  47.0    0.001 
gi|11498050|ref|NP_069274.1|  acetyl-CoA acetyltransferase [Ar...  46.2    0.002 
gi|14521569|ref|NP_127045.1|  acetyl-CoA acetyltransferase [Py...  46.2    0.002 
gi|89902052|ref|YP_524523.1|  Thiolase [Rhodoferax ferrireduce...  43.1    0.017 
gi|83955988|ref|ZP_00964499.1|  acetyl-CoA acetyltransferase [...  42.4    0.030
gi|57640115|ref|YP_182593.1|  acetyl-CoA acetyltransferase [Th...  41.6    0.044 
gi|71365311|ref|ZP_00655864.1|  Thiolase [Nocardioides sp. JS6...  41.6    0.046
gi|83944548|ref|ZP_00956999.1|  acetyl-CoA acetyltransferase [...  41.6    0.047
gi|15669744|ref|NP_248557.1|  acetyl-CoA acetyltransferase [Me...  41.6    0.051 
gi|86133993|ref|ZP_01052575.1|  acetyl-CoA acetyltransferase [...  41.6    0.051
gi|111613433|ref|ZP_01400514.1|  putative lipid transfer prote...  41.2    0.054
gi|118466253|ref|YP_881812.1|  thiolase [Mycobacterium avium 1...  40.8    0.087 
gi|70607488|ref|YP_256358.1|  acetyl-CoA acetyltransferase [Su...  40.4    0.094 
gi|78042759|ref|YP_360558.1|  acetyl-CoA acetyltransferase [Ca...  40.4    0.10  
gi|45476581|ref|NP_035457.1|  sterol carrier protein 2, liver ...  39.3    0.21  
gi|90961844|ref|YP_535760.1|  Pyruvate kinase [Lactobacillus s...  39.3    0.23  
gi|293794|gb|AAA40098.1|  sterol-carrier protein X                 38.5    0.35  
gi|205770|gb|AAA41726.1|  non-specific lipid transfer protein      38.5    0.40  
gi|111222835|ref|YP_713629.1|  Putative thiolase [Frankia alni...  38.5    0.40  
gi|393341|gb|AAB27044.1|  3-oxoacyl-CoA thiolase homolog {N-te...  38.5    0.40 
gi|56773|emb|CAA43061.1|  unnamed protein product [Rattus norvegi  38.5    0.40  
gi|202553|gb|AAA40622.1|  60 kDa protein >gi|51980631|gb|AAH81...  38.5    0.41  
gi|128391|sp|P11915|NLTP_RAT  Nonspecific lipid-transfer prote...  38.5    0.41  
gi|99078250|ref|YP_611508.1|  Thiolase [Silicibacter sp. TM104...  38.5    0.42  
gi|90422378|ref|YP_530748.1|  Thiolase [Rhodopseudomonas palus...  38.1    0.49  
gi|50356003|ref|NP_612517.2|  sterol carrier protein 2 [Rattus...  38.1    0.49  
gi|116501826|gb|EAU84721.1|  hypothetical protein CC1G_00240 [...  38.1    0.50 
gi|116748842|ref|YP_845529.1|  acetyl-CoA acetyltransferases [...  38.1    0.51  
gi|70607918|ref|YP_256788.1|  acetyl-CoA acetyltransferase [Su...  38.1    0.52  
gi|85860483|ref|YP_462685.1|  acetyl-CoA acetyltransferase [Sy...  38.1    0.52  
gi|15789866|ref|NP_279690.1|  3-ketoacyl-CoA thiolase [Halobac...  38.1    0.54  
gi|56478728|ref|YP_160317.1|  lipid-transfer protein [Azoarcus...  37.7    0.66  
gi|94970266|ref|YP_592314.1|  Acetyl-CoA C-acetyltransferase [...  37.7    0.71  
gi|12055072|emb|CAC20921.1|  PimS2 protein [Streptomyces natalens  37.4    0.83 
gi|68232922|ref|ZP_00572057.1|  Thiolase [Frankia sp. EAN1pec]...  37.4    0.85 
gi|29832409|ref|NP_827043.1|  lipid-transfer protein [Streptom...  37.4    0.88  
gi|52141468|ref|YP_085361.1|  acetyl-CoA acetyltransferase [Ba...  37.4    0.98  
gi|20092835|ref|NP_618910.1|  acetyl-CoA acetyltransferase [Me...  37.0    1.1   
gi|94494985|ref|ZP_01301566.1|  acetyl-CoA acetyltransferase [...  37.0    1.2  
gi|110592564|ref|ZP_01380920.1|  Thiolase [Acidovorax sp. JS42...  37.0    1.3  
gi|111221137|ref|YP_711931.1|  Putative nonspecific lipid-tran...  36.6    1.4   
gi|111615158|ref|ZP_01402225.1|  putative thiolase [Verminephr...  36.6    1.4  
gi|15803385|ref|NP_289418.1|  type III secretion protein [Esch...  36.6    1.5   
gi|88793298|ref|ZP_01109014.1|  acetyl-CoA acetyltransferase w...  36.6    1.5  
gi|94985406|ref|YP_604770.1|  Acetyl-CoA C-acetyltransferase [...  36.6    1.5   
gi|118463076|ref|YP_881131.1|  thiolase [Mycobacterium avium 1...  36.6    1.5   
gi|11497899|ref|NP_069121.1|  acetyl-CoA acetyltransferase [Ar...  36.2    1.8   
gi|111616650|ref|ZP_01403681.1|  Acetyl-CoA C-acetyltransferas...  35.8    2.3  
gi|86156835|ref|YP_463620.1|  Acetyl-CoA C-acyltransferase [An...  35.8    2.4   
gi|94313947|ref|YP_587156.1|  Thiolase [Ralstonia metalliduran...  35.8    2.4   
gi|66512039|ref|XP_392432.2|  PREDICTED: similar to Sterol car...  35.8    2.5   
gi|89202300|ref|ZP_01181027.1|  Thiolase [Bacillus cereus subs...  35.8    2.7  
gi|118059994|ref|ZP_01528447.1|  acetyl-CoA acetyltransferases...  35.4    3.0  
gi|104781647|ref|YP_608145.1|  3-ketoacyl-CoA thiolase [Pseudo...  35.4    3.2   
gi|92906977|ref|ZP_01275757.1|  Thiolase [Mycobacterium sp. JL...  35.4    3.2  
gi|92914033|ref|ZP_01282661.1|  Thiolase [Mycobacterium sp. KM...  35.4    3.6  
gi|54036166|sp|O62742|NLTP_RABIT  Nonspecific lipid-transfer p...  35.4    3.7  
gi|115375172|ref|ZP_01462439.1|  3-ketoacyl-CoA thiolase A, pe...  35.0    3.8  
gi|21226972|ref|NP_632894.1|  acetyl-CoA acetyltransferase [Me...  35.0    3.9   
gi|56475593|ref|YP_157182.1|  lipid-transfer protein [Azoarcus...  35.0    4.0   
gi|71413464|ref|XP_808869.1|  nonspecific lipid-transfer prote...  35.0    4.1   
gi|83857493|ref|ZP_00951021.1|  probable acetyl-CoA acetyltran...  35.0    4.2  
gi|118462688|ref|YP_880444.1|  acetyl-CoA acetyltransferase [M...  35.0    4.3   
gi|115298663|ref|NP_001041631.1|  SCL/TAL1 interrupting locus iso  35.0    4.5   
gi|55960525|emb|CAI13466.1|  TAL1 (SCL) interrupting locus [Ho...  35.0    4.5   
gi|115298661|ref|NP_003026.2|  SCL/TAL1 interrupting locus iso...  35.0    4.5   
gi|32172756|gb|AAH53615.1|  STIL protein [Homo sapiens]            35.0    4.5   
gi|338088|gb|AAA60550.1|  SIL >gi|13991571|gb|AAK51418.1| SIL pro  35.0    4.5   
gi|51491279|emb|CAH18699.1|  hypothetical protein [Homo sapiens]   35.0    4.5   
gi|114762368|ref|ZP_01441826.1|  acetyl-CoA acetyltransferase ...  35.0    4.5  
gi|29828775|ref|NP_823409.1|  3-ketoacyl-CoA thiolase/acetyl-C...  35.0    4.6   
gi|118434906|gb|EAV41556.1|  hypothetical protein SIAM614_3063...  35.0    4.6  
gi|84501904|ref|ZP_01000062.1|  thiolase [Oceanicola batsensis...  35.0    4.7  
gi|106893105|ref|ZP_01360231.1|  Thiolase [Clostridium sp. OhI...  35.0    4.7  
gi|75760092|ref|ZP_00740154.1|  Acetyl-CoA acetyltransferase [...  35.0    4.7  
gi|89206684|ref|ZP_01185238.1|  Thiolase [Bacillus weihensteph...  35.0    4.8  
gi|47565904|ref|ZP_00236943.1|  3-ketoacyl-CoA thiolase [Bacil...  35.0    4.8  
gi|118568206|gb|ABL02957.1|  beta-ketoacyl CoA thiolase FadA3 [My  34.7    4.9  
gi|30022110|ref|NP_833741.1|  acetyl-CoA acetyltransferase [Ba...  34.7    4.9   
gi|114556421|ref|XP_001163499.1|  PREDICTED: SCL/TAL1 interrup...  34.7    5.0   
gi|30264098|ref|NP_846475.1|  acetyl-CoA acetyltransferase [Ba...  34.7    5.0   
gi|114556425|ref|XP_524698.2|  PREDICTED: hypothetical protein is  34.7    5.0   
gi|114556427|ref|XP_001163613.1|  PREDICTED: SCL/TAL1 interrup...  34.7    5.0   
gi|56695913|ref|YP_166265.1|  acetyl-CoA acetyltransferase [Si...  34.7    5.1   
gi|76802357|ref|YP_327365.1|  acetyl-CoA C-acyltransferase 4 [...  34.7    5.4   
gi|55960522|emb|CAI13463.1|  TAL1 (SCL) interrupting locus [Ho...  34.7    5.6   
gi|73996803|ref|XP_543684.2|  PREDICTED: similar to Myeloid/ly...  34.7    6.2   
gi|15807721|ref|NP_285376.1|  acetyl-CoA acetyltransferase [De...  34.7    6.3   
gi|108881876|gb|EAT46101.1|  sterol carrier protein-2, putative [  34.7    6.3  
gi|109899230|ref|YP_662485.1|  acetyl-CoA acetyltransferases [...  34.7    6.3   
gi|33642241|gb|AAQ24505.1|  sterol carrier protein-X [Aedes aegyp  34.3    6.5   
gi|56420193|ref|YP_147511.1|  acetyl-CoA C-acetyltransferase [...  34.3    6.8   
gi|88856897|ref|ZP_01131549.1|  acetyl-coA acetyltransferase [...  34.3    7.8  
gi|90591632|ref|ZP_01247273.1|  Acetyl-CoA C-acetyltransferase...  34.3    7.9  
gi|73668096|ref|YP_304111.1|  acetyl-CoA acetyltransferase [Me...  34.3    7.9   
gi|56808838|ref|ZP_00366550.1|  COG0183: Acetyl-CoA acetyltran...  34.3    8.0  
gi|19745311|ref|NP_606447.1|  putative acetyl-CoA acetyltransf...  34.3    8.2   
gi|15674351|ref|NP_268525.1|  putative acetyl-CoA acetyltransf...  34.3    8.2   
gi|21909644|ref|NP_663912.1|  putative acetyl-CoA acetyltransf...  34.3    8.2   
gi|118040083|ref|ZP_01511480.1|  Thiolase [Burkholderia phytof...  33.9    8.4  
gi|108762905|ref|YP_633289.1|  acetyl-CoA acetyltransferase fa...  33.9    8.5   
gi|66521630|ref|XP_393870.2|  PREDICTED: similar to Protein su...  33.9    9.6   
gi|118368061|ref|XP_001017240.1|  Thiolase, N-terminal domain ...  33.9    9.8   
gi|111066381|gb|EAT87501.1|  hypothetical protein SNOG_05110 [Pha  33.9    9.9  

>gi|16126210|ref|NP_420774.1|  acetyl-CoA acetyltransferase [Caulobacter crescentus CB15]
 gi|13423430|gb|AAK23942.1|  conserved hypothetical protein [Caulobacter crescentus CB15]
Length=512

 Score =  272 bits (696),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 126/294 (42%), Positives = 191/294 (64%), Gaps = 1/294 (0%)

Query  5    TNMPRTLGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDTFVS  64
            ++ P +L  ++       +YT TGGNSPQ  +N +C RI +GE + AL+ G E L + + 
Sbjct  76   SDPPASLARAVSASPRWSVYTETGGNSPQQAVNVVCERIAQGESDLALVTGAEFLGSLMK  135

Query  65   RLKLGLEVN-WGDEPGGEPESIGSLRDLGSECEKKHGIFDPSSVYPLFANSIRGDKGQTA  123
            R+K GL    WGD+    P+ IG  R   +  E  HG+  P + YPLF N++R   G++ 
Sbjct  136  RMKGGLGFEGWGDDITTAPQRIGDPRPGVTRQEAAHGLGYPVNTYPLFENALRARDGRSQ  195

Query  124  LEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSIIRVN  183
             EH +++G  F+ F+ +A  N  +WF V R+ +E++ VT +NRM+G+PY KY+N+I+ V+
Sbjct  196  EEHQKQLGAFFAPFTKVAAANPHAWFPVERTAEELVTVTDRNRMVGYPYPKYLNAIMEVD  255

Query  184  QSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEAVFSK  243
            QS+A++I S +KARELG+PE  W+FL+  A+  D+W   ER++ +SSPA+R   +  F  
Sbjct  256  QSAAVLIASVRKARELGVPEDKWVFLHGCADACDLWYPLERQDYHSSPAMRLTGQRAFEM  315

Query  244  TNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTGGLPYYGGAGSAY  297
               S++D+   DLYSCFPSAV+I   EIG++ +D R LT+TGGLPY+GG G+ Y
Sbjct  316  AGISVDDLDVIDLYSCFPSAVRIGAEEIGLALDDPRGLTITGGLPYFGGPGNNY  369


>gi|118054381|ref|ZP_01522911.1|  acetyl-CoA acetyltransferase [Comamonas testosteroni KF-1]
 gi|117998360|gb|EAV12534.1|  acetyl-CoA acetyltransferase [Comamonas testosteroni KF-1]
Length=517

 Score =  238 bits (608),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 115/299 (38%), Positives = 184/299 (61%), Gaps = 1/299 (0%)

Query  1    FWGYTNMPRTLGNSLGIKVPNEIYTT-TGGNSPQLLLNEICNRIKEGELNCALLAGGEAL  59
            F    N P ++   +G     ++     GG+SP ++L   C RI +GE   AL+ GGEAL
Sbjct  76   FGKLANAPWSIAQRVGAANATDLVCPPQGGDSPVVMLARACERIAQGESQAALVVGGEAL  135

Query  60   DTFVSRLKLGLEVNWGDEPGGEPESIGSLRDLGSECEKKHGIFDPSSVYPLFANSIRGDK  119
             T ++  + GL++ WG++    P  +  ++D+ ++ E+KHG+    ++Y L   ++R   
Sbjct  136  RTELAAKRAGLQLQWGEDAPTTPNQLTGVKDMYTKAEEKHGMRSAIAMYALIGQALRHAA  195

Query  120  GQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSI  179
            GQT  ++ E   ++F+RF+ +A +N  +  +   S ++I EV  +N  +GFPYTK M + 
Sbjct  196  GQTVDQYREASAKLFARFAAVARDNPLATRRKGYSAEQIAEVNAENPFVGFPYTKLMTAS  255

Query  180  IRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEA  239
              V+QS+A ++ S  +A ELGIP+   ++L+  A+ +D W +++RE L  SPA+R  S A
Sbjct  256  AFVDQSAAFIVVSEARADELGIPQDKRVYLHGEAHAHDTWFVSDRERLDQSPAMRLTSRA  315

Query  240  VFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTGGLPYYGGAGSAYV  298
              ++   ++ DV  FD+YSCFPSAVQIA +E+GIS +D R LTVTGGLPY+GG G+ YV
Sbjct  316  ALAQAGKTIADVDVFDIYSCFPSAVQIACKELGISPDDKRGLTVTGGLPYFGGPGNNYV  374


>gi|118054324|ref|ZP_01522862.1|  acetyl-CoA acetyltransferase [Comamonas testosteroni KF-1]
 gi|117998416|gb|EAV12582.1|  acetyl-CoA acetyltransferase [Comamonas testosteroni KF-1]
Length=517

 Score =  229 bits (583),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 111/299 (37%), Positives = 180/299 (60%), Gaps = 1/299 (0%)

Query  1    FWGYTNMPRTLGNSLGIKVPNE-IYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEAL  59
            F    N P ++   +G    ++ +Y   GG++PQ+LL  +C RI +GE   AL+ GGEAL
Sbjct  76   FGKLANPPWSVARRVGANAASDLVYPPQGGDTPQVLLARVCERIAQGESQSALIVGGEAL  135

Query  60   DTFVSRLKLGLEVNWGDEPGGEPESIGSLRDLGSECEKKHGIFDPSSVYPLFANSIRGDK  119
             + ++  + GL + WG++   +P ++  ++D+ +  E+ HG+    ++Y L   S+R   
Sbjct  136  RSELAAKRAGLSLQWGEDAPTQPNTLDGVKDMYTAEEEAHGMRSAIAMYGLIGQSLRQSA  195

Query  120  GQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSI  179
            GQ+  E+ E    +FS  + +A  N  +  +   S + I EVTP N  +GFP+TK M + 
Sbjct  196  GQSVDEYREASARLFSGLAAVAKANPLATRRAGYSAEAIAEVTPDNPYVGFPFTKLMTAS  255

Query  180  IRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEA  239
              ++QS+A ++ S  KA ELGIP    ++L+ +A  +D W ++ER  L  SPA+R  +  
Sbjct  256  AFIDQSAAFIVVSEAKADELGIPVDKRVYLHGSAAAHDQWFVSERPQLDESPAMRLSARH  315

Query  240  VFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTGGLPYYGGAGSAYV  298
              ++   +++ V+F D+YSCFPSAVQIA +E+GI  +D R L+VTGGLPY+GG G+ YV
Sbjct  316  ALAQAGRTMDQVEFLDIYSCFPSAVQIACKELGIRPDDPRQLSVTGGLPYFGGPGNNYV  374


>gi|92907510|ref|ZP_01276290.1|  conserved hypothetical protein [Mycobacterium sp. JLS]
 gi|92435810|gb|EAS95141.1|  conserved hypothetical protein [Mycobacterium sp. JLS]
Length=492

 Score =  209 bits (533),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 115/300 (38%), Positives = 167/300 (55%), Gaps = 3/300 (1%)

Query  2    WGYTNMPRTLGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDT  61
            W Y +    L   +G       YT  GGN PQ L+N+ C  I+ G  N  L+AG E   T
Sbjct  58   WRYRDPGLLLAQRIGADKAATRYTGIGGNVPQSLVNQACLDIQSGRHNVVLIAGAETWRT  117

Query  62   FVSRLKLGLEVNWGDEPGGEPESIGSLRD--LGSECEKKHGIFDPSSVYPLFANSIRGDK  119
                   G   NW  +    P + G+  +  +  + E +  +  PS VYP+F  ++R   
Sbjct  118  RTRLRAKGERPNWTRQDESVPIADGADENVPMAGDAENRILLDRPSYVYPMFEQAVRIAA  177

Query  120  GQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSI  179
            G+T  EH   IGE++++FS +A +N  +W + A +   I + +P+NRMI FPY K MNS 
Sbjct  178  GETPDEHRRRIGELWAQFSAVAADNPHAWRRDALAADAIWQPSPENRMISFPYPKLMNSN  237

Query  180  IRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEA  239
              V+Q + L++TS + AR+L IP   WIF YA  + +D + I ER   + SPAIR   + 
Sbjct  238  NMVDQGAVLILTSVETARQLKIPSERWIFPYAGTDSHDTYAIGERAEFHRSPAIRIAGQR  297

Query  240  VFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDED-SRDLTVTGGLPYYGGAGSAYV  298
            V    + ++EDV+  D+YSCFPSAVQ+A  E+G+   D +R LTVTGGL + GG  + YV
Sbjct  298  VLELADTAIEDVELIDVYSCFPSAVQVAATELGLPVGDPARPLTVTGGLTFAGGPWNNYV  357


>gi|92912755|ref|ZP_01281385.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108799758|ref|YP_639955.1|  acetyl-CoA acetyltransferase [Mycobacterium sp. MCS]
 gi|92443301|gb|EAT01138.1|  conserved hypothetical protein [Mycobacterium sp. KMS]
 gi|108770177|gb|ABG08899.1|  acetyl-CoA acetyltransferase [Mycobacterium sp. MCS]
Length=492

 Score =  208 bits (530),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 114/300 (38%), Positives = 167/300 (55%), Gaps = 3/300 (1%)

Query  2    WGYTNMPRTLGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDT  61
            W Y +    L   +G       YT  GGN PQ L+N+ C  I+ G  N  L+AG E   T
Sbjct  58   WRYRDPGLLLAQRIGADKAATRYTGIGGNVPQSLVNQACLDIQSGRHNVVLIAGAETWRT  117

Query  62   FVSRLKLGLEVNWGDEPGGEPESIGSLRD--LGSECEKKHGIFDPSSVYPLFANSIRGDK  119
                   G   NW  +    P + G+  +  +  + E +  +  PS VYP+F  ++R   
Sbjct  118  RTRLRAKGERPNWTRQDESVPIADGADENVPMAGDAENRIQLDRPSYVYPMFEQAVRIAA  177

Query  120  GQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSI  179
            G+T  EH   IGE++++FS +A +N  +W + A +   I + +P+NRMI +PY K MNS 
Sbjct  178  GETPDEHRRRIGELWAQFSAVAADNPHAWRRDALAADAIWQPSPENRMISWPYPKLMNSN  237

Query  180  IRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEA  239
              V+Q + L++TS + AR+L IP   WIF YA  + +D + I ER   + SPAIR   + 
Sbjct  238  NMVDQGAVLILTSVETARQLKIPSERWIFPYAGTDSHDTYAIGERAEFHRSPAIRIAGQR  297

Query  240  VFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDED-SRDLTVTGGLPYYGGAGSAYV  298
            V    + ++EDV+  D+YSCFPSAVQ+A  E+G+   D +R LTVTGGL + GG  + YV
Sbjct  298  VLELADTAIEDVELIDVYSCFPSAVQVAATELGLPVGDPARPLTVTGGLTFAGGPWNNYV  357


>gi|88705016|ref|ZP_01102728.1|  conserved hypothetical protein [gamma proteobacterium KT 71]
 gi|88700711|gb|EAQ97818.1|  conserved hypothetical protein [Congregibacter litoralis KT71]
Length=507

 Score =  205 bits (521),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 106/288 (36%), Positives = 163/288 (56%), Gaps = 2/288 (0%)

Query  11   LGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDTFVSRLKLGL  70
            L   LGI    +  +  GGN PQ LLNE   R+ +G+ +  LL G E L TF+  ++ G 
Sbjct  78   LAERLGISAA-QFTSDVGGNLPQQLLNEFARRLSQGDGDVVLLCGVELLATFLGAVRGGD  136

Query  71   EV-NWGDEPGGEPESIGSLRDLGSECEKKHGIFDPSSVYPLFANSIRGDKGQTALEHMEE  129
               +W          +G    + +  E+ HG+++P + YPLF ++    +G +  EH   
Sbjct  137  GFPDWATGQEDTALQVGETPVMTAPTEQAHGLYEPINAYPLFESAQAHARGLSVDEHQAL  196

Query  130  IGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSIIRVNQSSALV  189
            +G++ S  SH+A EN  +W   A S   ++     NRMI  PYTK MN+++ V+Q++A+V
Sbjct  197  LGKLVSDMSHVAAENPYAWKNQALSADAVLSTDGGNRMISHPYTKVMNAVLAVDQAAAVV  256

Query  190  ITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEAVFSKTNCSLE  249
            +T+  KAREL I    WI+L  AA+ +D W + +R  L  SPA++   +   S++   +E
Sbjct  257  LTTVGKARELNIDPERWIYLRGAASAHDSWYLGQRMKLSESPALKAACDGALSQSGLDVE  316

Query  250  DVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTGGLPYYGGAGSAY  297
            ++  FDLYSCFP+AVQ     +GI  +D R +TVTGGL  +GG G+ Y
Sbjct  317  ELTHFDLYSCFPAAVQAGCDALGIQPDDPRGVTVTGGLSLFGGPGNNY  364


>gi|89340999|ref|ZP_01193245.1|  conserved hypothetical protein [Mycobacterium flavescens PYR-GCK]
 gi|89319122|gb|EAS10615.1|  conserved hypothetical protein [Mycobacterium flavescens PYR-GCK]
Length=521

 Score =  203 bits (517),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 114/301 (37%), Positives = 168/301 (55%), Gaps = 5/301 (1%)

Query  2    WGYTNMPRTLGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDT  61
            W Y +    L   +G       YT  GGN PQ L+N  C  I++G  +  L+AG E   +
Sbjct  88   WRYRDPGLLLAERIGAAKAATRYTGIGGNVPQTLVNLACLDIQQGRNDVVLIAGAETWRS  147

Query  62   FVSRLKLGLEVNWGDEPGGEPESIGSLRDL--GSECEKKHGIFDPSSVYPLFANSIRGDK  119
                   G ++    +    P + GS  ++      + K G+  P+ VYP+F  ++R   
Sbjct  148  RTRTRAAGNKMQGTRQDESVPMAPGSDENMPMAGPGDLKIGLDRPAYVYPMFETAVRIAA  207

Query  120  GQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSI  179
            G+T  EH   IGE++++FS +A  N  +W + AR+ +EI E +P+NRM+ +PYTK MNS 
Sbjct  208  GETPDEHRRRIGELWAQFSAVAAGNPHAWSQEARTAEEIYEPSPKNRMVSWPYTKLMNSN  267

Query  180  IRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEA  239
              V+Q + L++TS +KA+ L IP   W+F YA A+ +D + I ER   ++SPAIR     
Sbjct  268  NMVDQGAVLILTSVEKAQHLQIPSERWVFPYAGADAHDTYAIGERAEFHASPAIRIAGTR  327

Query  240  VFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIG--ISDEDSRDLTVTGGLPYYGGAGSAY  297
                    ++D+   D+YSCFPSAVQ+A RE+G  I D D R LTVTGGL + GG  + Y
Sbjct  328  ALELAGAGVDDMDLIDVYSCFPSAVQVAARELGLPIGDPD-RPLTVTGGLTFAGGPWNNY  386

Query  298  V  298
            V
Sbjct  387  V  387


>gi|118466577|ref|YP_882037.1|  acetyl-CoA acetyltransferase [Mycobacterium avium 104]
 gi|118167864|gb|ABK68761.1|  acetyl-CoA acetyltransferase [Mycobacterium avium 104]
Length=494

 Score =  201 bits (510),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 162/291 (55%), Gaps = 3/291 (1%)

Query  11   LGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDTFVSRLKLGL  70
            LG  +G +    +YT  GGN PQ L+N+ C  I+ G  N  LLAG E   T       G 
Sbjct  71   LGQRIGARDFGTLYTPVGGNVPQSLVNQACLDIQRGRANVVLLAGAETWRTRRGLRAKGG  130

Query  71   EVNWGDEPGGEPESIGSLRD--LGSECEKKHGIFDPSSVYPLFANSIRGDKGQTALEHME  128
            ++ W ++    P +  S  D  +  E E +  +  P+ VYPLF  ++R   G++  +H+ 
Sbjct  131  KLVWTEQDRSVPMAEVSGEDVAMAGEAEIRISLDRPAYVYPLFEQALRVSTGESVEDHLT  190

Query  129  EIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSIIRVNQSSAL  188
             IG +++RF+ +A +N  +W +   S  +I    P NRMI +PYTK MNS   V+Q +AL
Sbjct  191  RIGRLWARFNAVAVDNPHAWIRTPHSADDICRAGPHNRMISWPYTKLMNSNNMVDQGAAL  250

Query  189  VITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEAVFSKTNCSL  248
            V+TS ++AR L +P   W++  A  + +D  +I ER  L+ S AIR             +
Sbjct  251  VLTSVEQARRLKVPPERWVYPLAGTDAHDTASIAERHELHRSAAIRIAGARALQLAGLGI  310

Query  249  EDVKFFDLYSCFPSAVQIAKREIGIS-DEDSRDLTVTGGLPYYGGAGSAYV  298
            +DV   DLYSCFPSAVQ+A  E+G+  D+ +R LTVTGGL + GG  S YV
Sbjct  311  DDVDHVDLYSCFPSAVQVAAAELGLGLDDPARPLTVTGGLTFAGGPWSNYV  361


>gi|41407675|ref|NP_960511.1|  acetyl-CoA acetyltransferase [Mycobacterium avium subsp. paratuberculosis 
K-10]
 gi|41396028|gb|AAS03894.1|  hypothetical protein MAP_1577 [Mycobacterium avium subsp. paratuberculosis 
K-10]
Length=494

 Score =  200 bits (509),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 162/291 (55%), Gaps = 3/291 (1%)

Query  11   LGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDTFVSRLKLGL  70
            LG  +G +    +YT  GGN PQ L+N+ C  I+ G  N  LLAG E   T       G 
Sbjct  71   LGQRIGARDFGTLYTPVGGNVPQSLVNQACLDIQRGRANVVLLAGAETWRTRRGLRAKGG  130

Query  71   EVNWGDEPGGEPESIGSLRD--LGSECEKKHGIFDPSSVYPLFANSIRGDKGQTALEHME  128
            ++ W ++    P +  S  D  +  E E +  +  P+ VYPLF  ++R   G++  +H+ 
Sbjct  131  KLVWTEQDRSVPMAEVSGEDVAMAGEAEIRISLDRPAYVYPLFEQALRVATGESVEDHLT  190

Query  129  EIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNSIIRVNQSSAL  188
             IG +++RF+ +A +N  +W +   S  +I    P NRMI +PYTK MNS   V+Q +AL
Sbjct  191  RIGRLWARFNAVAVDNPHAWIRTPHSADDICRAGPHNRMISWPYTKLMNSNNMVDQGAAL  250

Query  189  VITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSEAVFSKTNCSL  248
            V+TS ++AR L +P   W++  A  + +D  +I ER  L+ S AIR             +
Sbjct  251  VLTSVEQARRLKVPPERWVYPLAGTDAHDTASIAERHELHRSAAIRIAGARALQLAGLGI  310

Query  249  EDVKFFDLYSCFPSAVQIAKREIGIS-DEDSRDLTVTGGLPYYGGAGSAYV  298
            +DV   DLYSCFPSAVQ+A  E+G+  D+ +R LTVTGGL + GG  S YV
Sbjct  311  DDVDHVDLYSCFPSAVQVAAAELGLGLDDPARPLTVTGGLTFAGGPWSNYV  361


>gi|118473382|ref|YP_887911.1|  acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 
155]
 gi|118174669|gb|ABK75565.1|  acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 
155]
Length=488

 Score =  199 bits (507),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 111/301 (36%), Positives = 167/301 (55%), Gaps = 5/301 (1%)

Query  2    WGYTNMPRTLGNSLGIKVPNEIYTTTGGNSPQLLLNEICNRIKEGELNCALLAGGEALDT  61
            W Y +    L   +G       YT  GGN PQ L+N  C  ++ G     L+AG E   T
Sbjct  55   WRYRDPGLLLAGRIGAAGARTRYTGIGGNVPQTLVNHACLDLQAGRAEVVLIAGAETWRT  114

Query  62   FVSRLKL-GLEVNWGDEPGGEPESIGSLRD--LGSECEKKHGIFDPSSVYPLFANSIRGD  118
              SRL+  G+  +W  +    P + G   +  +  + E +  +  P+ VYP+F  ++R  
Sbjct  115  -RSRLRARGVRPDWTRQDDTVPVAPGGDDNVPMAGDAENRIKLDRPAFVYPMFEQALRIA  173

Query  119  KGQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIGFPYTKYMNS  178
             G+T  EH + IG ++SRFS +A  N  +W + A + ++I +V P NRMI +PY K MNS
Sbjct  174  AGETPDEHRDRIGALWSRFSAVAARNPHAWNRDAVTAQQITQVGPDNRMISWPYPKLMNS  233

Query  179  IIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKCSE  238
               V+Q + L++T+ + A  L IP   W+F YA  + +D + I ER+ L+ SPAIR    
Sbjct  234  NNMVDQGAVLILTTVQMATYLQIPMDRWVFPYAGTDSHDTYAIGERDELHRSPAIRIAGR  293

Query  239  AVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGI-SDEDSRDLTVTGGLPYYGGAGSAY  297
             V       ++ + F D+YSCFPSAVQ+A  E+G+ +D+ +R LTVTGGL + GG  + Y
Sbjct  294  RVLELAGADIDAIDFVDVYSCFPSAVQVAAAELGLPTDDPARPLTVTGGLTFAGGPWNNY  353

Query  298  V  298
            V
Sbjct  354  V  354
_______________________________________________________________________________
_______________________________________________________________________________
Blastp contre swissprot :

Database: Non-redundant SwissProt sequences
           221,344 sequences; 83,514,441 total letters
 If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports

Query=  ORF_BC18020 traduction [2-895 sens direct]
Length=298

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|38258709|sp|Q58944|Y1549_METJA  Hypothetical protein MJ1549     41.6    0.004
gi|32130432|sp|P32020|NLTP_MOUSE  Nonspecific lipid-transfer p...  39.3    0.015 
gi|128391|sp|P11915|NLTP_RAT  Nonspecific lipid-transfer prote...  38.5    0.030 
gi|54036166|sp|O62742|NLTP_RABIT  Nonspecific lipid-transfer p...  35.4    0.27 
gi|26401125|sp|Q10988|UVE1_SCHPO  UV-damage endonuclease (UVDE)    33.9    0.77 
gi|81600098|sp|Q5QXN5|FADI_IDILO  3-ketoacyl-CoA thiolase (Fat...  32.7    1.5  
gi|465854|sp|P34390|YLS5_CAEEL  Hypothetical protein F09G8.5       32.3    2.0   
gi|81593965|sp|Q8ZD46|FADI_YERPE  3-ketoacyl-CoA thiolase (Fat...  31.6    3.5  
gi|82000312|sp|Q5UQX1|MCE_MIMIV  Probable mRNA capping enzyme ...  31.6    3.9   
gi|37999860|sp|O14686|MLL2_HUMAN  Myeloid/lymphoid or mixed-li...  31.2    5.2   
gi|464882|sp|P33291|THIKB_CANTR  3-ketoacyl-CoA thiolase B, pe...  30.8    5.3  
gi|464881|sp|P33290|THIKA_CANTR  3-ketoacyl-CoA thiolase A, pe...  30.8    5.4  
gi|75501444|sp|Q4ZRA1|FADA_PSEU2  3-ketoacyl-CoA thiolase (Fat...  30.4    7.5   
gi|83288140|sp|Q5E8X7|FADA_VIBF1  3-ketoacyl-CoA thiolase (Fat...  30.4    8.4  
gi|81730423|sp|Q87ZB3|FADA_PSESM  3-ketoacyl-CoA thiolase (Fat...  30.4    8.5  

>gi|38258709|sp|Q58944|Y1549_METJA  Hypothetical protein MJ1549
Length=392

 Score = 41.6 bits (96),  Expect = 0.004, Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 81/168 (48%), Gaps = 12/168 (7%)

Query  106  SVYPLFANSIRGDKGQTALEHMEEIGEMFSRFSHI-ATENQASWFKVARSPKEIIEVTPQ  164
            S+Y + A     + G T    +EE+  M+S   H  A++N+ + F    + ++++  +P 
Sbjct  143  SLYAMMAQRYMYEYGLT----LEEL-SMWSVIMHENASKNRYAQFPFKVTLEQVLNSSP-  196

Query  165  NRMIGFPYTKYMNSIIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITER  224
               +  P      S +  + ++AL++  A+KA+E  + + + I++ A+   +D   +  R
Sbjct  197  ---VAEPLRLLHCSPVS-DGAAALIVCEAEKAKEF-VNKDDIIYIKASVQASDTIALHSR  251

Query  225  ENLYSSPAIRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIG  272
            E++ S  A +  SE  +   N   +DV   +++ CF     I   E+G
Sbjct  252  ESITSLKAAKVASEKAYKMANIEPKDVDVAEVHDCFAINGLILMEELG  299


>gi|32130432|sp|P32020|NLTP_MOUSE  Nonspecific lipid-transfer protein (Propanoyl-CoA C-acyltransferase) 
(NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol 
carrier protein X) (SCP-X) (SCP-chi) (SCPX)
Length=547

 Score = 39.3 bits (90),  Expect = 0.015, Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 77/187 (41%), Gaps = 24/187 (12%)

Query  120  GQTALEHMEEIGEMFSRFSHI-------ATENQASWFKVARSPKEIIEVTPQNRMIGFPY  172
            G    EHME+ G     F+ I       +  N  S F+   S +E+++  P      F +
Sbjct  164  GYAGKEHMEKYGTKVEHFAKIGWKNHKHSVNNTYSQFQDEYSLEEVMKSKPV-----FDF  218

Query  173  TKYMNSIIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENL-----  227
               +      + ++A +++S +  ++ G+ +S  + + A   + D+ +  E +++     
Sbjct  219  LTILQCCPTSDGAAAAILSSEEFVQQYGL-QSKAVEIVAQEMMTDLPSTFEEKSIIKVVG  277

Query  228  --YSSPAIRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTG  285
               S  A R+C E    K+  +  DV   +L+ CF     I    +G+  E      V  
Sbjct  278  YDMSKEAARRCYE----KSGLTPNDVDVIELHDCFSVNELITYEALGLCPEGQGGTLVDR  333

Query  286  GLPYYGG  292
            G   YGG
Sbjct  334  GDNTYGG  340


>gi|128391|sp|P11915|NLTP_RAT  Nonspecific lipid-transfer protein (Propanoyl-CoA C-acyltransferase) 
(NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol 
carrier protein X) (SCP-X) (SCP-chi) (SCPX)
Length=547

 Score = 38.5 bits (88),  Expect = 0.030, Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 80/196 (40%), Gaps = 27/196 (13%)

Query  111  FANSIRGDKGQTALEHMEEIGEMFSRFSHIATENQA-------SWFKVARSPKEIIEVTP  163
            FA  + G  G+   EHME  G     F+ I  +N         S F+   S  EI++  P
Sbjct  158  FAPQLFGSAGK---EHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRP  214

Query  164  QNRMIGFPYTKYMNSIIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITE  223
                  F +   +      + ++A +++S +  ++ G+ +S  + + A   + D+ +  E
Sbjct  215  V-----FDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGL-QSKAVEIVAQEMVTDMPSTFE  268

Query  224  RENL-------YSSPAIRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDE  276
             +++        S  A RKC E    K+     DV   +L+ CF +   +    +G+  E
Sbjct  269  EKSVIKMVGYDMSKEAARKCYE----KSGLGPSDVDVIELHDCFSTNELLTYEALGLCPE  324

Query  277  DSRDLTVTGGLPYYGG  292
                  V  G   YGG
Sbjct  325  GQGGALVDRGDNTYGG  340


>gi|54036166|sp|O62742|NLTP_RABIT  Nonspecific lipid-transfer protein (Propanoyl-CoA C-acyltransferase) 
(NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol 
carrier protein X) (SCP-X) (SCP-chi) (SCPX)
Length=547

 Score = 35.4 bits (80),  Expect = 0.27, Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 73/187 (39%), Gaps = 24/187 (12%)

Query  120  GQTALEHMEEIGEMFSRFSHIATENQA-------SWFKVARSPKEIIEVTPQNRMIGFPY  172
            G    EHME+ G     F+ I  +N         S F+   S  E++   P      F +
Sbjct  164  GSAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQKEYSLDEVMSSRPI-----FDF  218

Query  173  TKYMNSIIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENL-----  227
               +      + ++A ++ S +  ++ G+ +S  + + A   + D  +  E +++     
Sbjct  219  LTVLQCCPTSDGAAAAILASEEFVKKYGL-QSKAVEILAQEMVTDFPSSFEEKSIIKMVG  277

Query  228  --YSSPAIRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRDLTVTG  285
               S  A R+C E    K+     D+   +L+ CF +   +    +G+  E      V  
Sbjct  278  FDMSKEAARRCYE----KSGLRPSDIDVIELHDCFSANELLTYEALGLCPEGKGGALVDR  333

Query  286  GLPYYGG  292
            G   YGG
Sbjct  334  GDNTYGG  340


>gi|26401125|sp|Q10988|UVE1_SCHPO  UV-damage endonuclease (UVDE)
Length=599

 Score = 33.9 bits (76),  Expect = 0.77, Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query  105  SSVYPLFANSIRGDKGQTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEII  159
            S ++P  +++  G   + A  H+EE+G++ ++++H  T +   + ++A SP+E++
Sbjct  315  SDLFPFASHAKYGYTLEFAQSHLEEVGKLANKYNHRLTMHPGQYTQIA-SPREVV  368


>gi|81600098|sp|Q5QXN5|FADI_IDILO  3-ketoacyl-CoA thiolase (Fatty acid oxidation complex subunit 
beta) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Acyl-CoA 
ligase) (ACSs)
Length=436

 Score = 32.7 bits (73),  Expect = 1.5, Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 55/133 (41%), Gaps = 30/133 (22%)

Query  177  NSIIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENL----YSSPA  232
            NS    + +SA+++ +  +A+ELG+P   ++  YA A L       E + L    YS+P 
Sbjct  271  NSTPLTDGASAVMMMTESRAKELGLPVLGYLRSYAFAALQ-----VEEDMLMGPSYSTP-  324

Query  233  IRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAV----------QIAKREIG----ISDEDS  278
                      +   SL D+   D++  F +            + A+ ++G    I + D 
Sbjct  325  ------VALDRAGMSLNDLDLIDMHEAFAAQTLANMKMFASDKFAQEKLGRDKAIGEIDM  378

Query  279  RDLTVTGGLPYYG  291
                V GG   YG
Sbjct  379  DKFNVLGGSIAYG  391


>gi|465854|sp|P34390|YLS5_CAEEL  Hypothetical protein F09G8.5
Length=484

 Score = 32.3 bits (72),  Expect = 2.0, Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  226  NLYSSPAIRKCSEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKR  269
            +L  +  ++    AV+ +T CSLE+VK  +L+ C    +Q+ ++
Sbjct  95   SLRDTTMVKLTESAVYIRTKCSLENVKKLNLWGCGIDDIQVCEK  138


>gi|81593965|sp|Q8ZD46|FADI_YERPE  3-ketoacyl-CoA thiolase (Fatty acid oxidation complex subunit 
beta) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Acyl-CoA 
ligase) (ACSs)
 gi|81639009|sp|Q668V0|FADI_YERPS  3-ketoacyl-CoA thiolase (Fatty acid oxidation complex subunit 
beta) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Acyl-CoA 
ligase) (ACSs)
Length=436

 Score = 31.6 bits (70),  Expect = 3.5, Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query  177  NSIIRVNQSSALVITSAKKARELGIPESNWIFLYAAANLNDIWNITERENLYSSPAIRKC  236
            NS    + ++A+++ S  KA+ LG+P   ++  +A + + D+W        Y++P     
Sbjct  271  NSTPLTDGAAAVLMMSESKAKALGLPPLGYLRSFAFSAI-DVWQDMLLGPSYATP-----  324

Query  237  SEAVFSKTNCSLEDVKFFDLYSCFPSAVQIAKREIGISDEDSRD  280
                  +   +L D+   D++  F +A  +A  ++  SD  +R+
Sbjct  325  --LALDRAGITLADLTLIDMHEAF-AAQTLANLKMFASDTFARE  365


>gi|82000312|sp|Q5UQX1|MCE_MIMIV  Probable mRNA capping enzyme [Includes: Polynucleotide 5'-triphosphatase 
(mRNA 5'-triphosphatase) (TPase); mRNA guanylyltransferase 
(GTP--RNA guanylyltransferase) (GTase); mRNA (guanine-N(7)-)-methyltransferase 
]
Length=1170

 Score = 31.6 bits (70),  Expect = 3.9, Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query  121  QTALEHMEEIGEMFSRFSHIATENQASWFKVARSPKEIIEVTPQNRMIG  169
            + +L + E+IGE  ++FS  A+ N  S + V+  P + IE+  +NR  G
Sbjct  85   RVSLFNQEQIGEFITKFSK-ASSNDISRYIVSLDPSDDIEIVYKNRGSG  132


>gi|37999860|sp|O14686|MLL2_HUMAN  Myeloid/lymphoid or mixed-lineage leukemia protein 2 (ALL1-related 
protein)
Length=5262

 Score = 31.2 bits (69),  Expect = 5.2, Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 0/78 (0%)

Query  46   GELNCALLAGGEALDTFVSRLKLGLEVNWGDEPGGEPESIGSLRDLGSECEKKHGIFDPS  105
            G+L+C   +   ALD F    +    ++  D PG +PE   +   L SE +    + DP 
Sbjct  824  GDLSCPAPSPAPALDDFSGLGEDTAPLDGIDAPGSQPEPGQTPGSLASELKGSPVLLDPE  883

Query  106  SVYPLFANSIRGDKGQTA  123
             + P+    +  +  QTA
Sbjct  884  ELAPVTPMEVYPECKQTA  901


ORF finding

any codon brin direct

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 895.
TTCTGGGGCTACACCAATATGCCTAGAACTCTAGGAAATAGTCTAGGCATCAAAGTTCCG
AATGAAATTTATACGACTACTGGAGGAAATTCTCCTCAATTACTACTTAATGAGATTTGT
AACAGAATAAAAGAAGGAGAATTAAACTGTGCTCTGCTTGCTGGAGGAGAAGCTTTGGAT
ACATTTGTTTCTAGACTTAAATTAGGACTAGAAGTAAATTGGGGAGATGAACCAGGTGGA
GAACCTGAATCCATAGGGAGCTTACGAGACCTAGGAAGTGAATGCGAAAAAAAACACGGT
ATTTTTGATCCCTCTTCTGTTTATCCTCTTTTTGCAAATAGCATAAGAGGCGATAAAGGC
CAAACTGCACTAGAACATATGGAAGAAATTGGAGAAATGTTCAGTAGGTTTTCACACATA
GCTACAGAGAATCAAGCCTCTTGGTTTAAGGTTGCTAGAAGTCCAAAAGAAATCATTGAA
GTAACTCCTCAAAATAGAATGATTGGCTTTCCTTATACTAAATATATGAACTCTATAATT
AGAGTTAATCAATCCTCTGCTCTAGTAATAACTTCAGCTAAAAAGGCCAGAGAATTGGGC
ATTCCTGAATCTAATTGGATATTTTTATATGCAGCTGCAAACCTAAATGATATTTGGAAT
ATAACTGAAAGAGAAAACCTATACTCTTCTCCAGCAATAAGAAAATGTAGCGAGGCAGTT
TTTAGTAAAACAAACTGTTCTCTTGAAGATGTTAAATTTTTTGATCTTTATTCATGTTTC
CCTAGTGCAGTACAAATTGCAAAAAGAGAAATTGGTATATCAGATGAAGATTCAAGAGAC
CTAACAGTCACTGGAGGGTTGCCCTATTATGGAGGTGCAGGAAGTGCATATGTG

No ORFs were found in reading frame 3.
--------------------------------------------------------------------------------
any codon brin indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 496 to base 699.
ACATTTCTCCAATTTCTTCCATATGTTCTAGTGCAGTTTGGCCTTTATCGCCTCTTATGC
TATTTGCAAAAAGAGGATAAACAGAAGAGGGATCAAAAATACCGTGTTTTTTTTCGCATT
CACTTCCTAGGTCTCGTAAGCTCCCTATGGATTCAGGTTCTCCACCTGGTTCATCTCCCC
AATTTACTTCTAGTCCTAATTTAA

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 129 to base 347.
AGATCAAAAAATTTAACATCTTCAAGAGAACAGTTTGTTTTACTAAAAACTGCCTCGCTA
CATTTTCTTATTGCTGGAGAAGAGTATAGGTTTTCTCTTTCAGTTATATTCCAAATATCA
TTTAGGTTTGCAGCTGCATATAAAAATATCCAATTAGATTCAGGAATGCCCAATTCTCTG
GCCTTTTTAGCTGAAGTTATTACTAGAGCAGAGGATTGA

>ORF number 2 in reading frame 3 on the reverse strand extends from base 576 to base 800.
ACAGAAGAGGGATCAAAAATACCGTGTTTTTTTTCGCATTCACTTCCTAGGTCTCGTAAG
CTCCCTATGGATTCAGGTTCTCCACCTGGTTCATCTCCCCAATTTACTTCTAGTCCTAAT
TTAAGTCTAGAAACAAATGTATCCAAAGCTTCTCCTCCAGCAAGCAGAGCACAGTTTAAT
TCTCCTTCTTTTATTCTGTTACAAATCTCATTAAGTAGTAATTGA
______________________________________________________________________________________________

ATG brin direct:

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 20 to base 895.
ATGCCTAGAACTCTAGGAAATAGTCTAGGCATCAAAGTTCCGAATGAAATTTATACGACT
ACTGGAGGAAATTCTCCTCAATTACTACTTAATGAGATTTGTAACAGAATAAAAGAAGGA
GAATTAAACTGTGCTCTGCTTGCTGGAGGAGAAGCTTTGGATACATTTGTTTCTAGACTT
AAATTAGGACTAGAAGTAAATTGGGGAGATGAACCAGGTGGAGAACCTGAATCCATAGGG
AGCTTACGAGACCTAGGAAGTGAATGCGAAAAAAAACACGGTATTTTTGATCCCTCTTCT
GTTTATCCTCTTTTTGCAAATAGCATAAGAGGCGATAAAGGCCAAACTGCACTAGAACAT
ATGGAAGAAATTGGAGAAATGTTCAGTAGGTTTTCACACATAGCTACAGAGAATCAAGCC
TCTTGGTTTAAGGTTGCTAGAAGTCCAAAAGAAATCATTGAAGTAACTCCTCAAAATAGA
ATGATTGGCTTTCCTTATACTAAATATATGAACTCTATAATTAGAGTTAATCAATCCTCT
GCTCTAGTAATAACTTCAGCTAAAAAGGCCAGAGAATTGGGCATTCCTGAATCTAATTGG
ATATTTTTATATGCAGCTGCAAACCTAAATGATATTTGGAATATAACTGAAAGAGAAAAC
CTATACTCTTCTCCAGCAATAAGAAAATGTAGCGAGGCAGTTTTTAGTAAAACAAACTGT
TCTCTTGAAGATGTTAAATTTTTTGATCTTTATTCATGTTTCCCTAGTGCAGTACAAATT
GCAAAAAGAGAAATTGGTATATCAGATGAAGATTCAAGAGACCTAACAGTCACTGGAGGG
TTGCCCTATTATGGAGGTGCAGGAAGTGCATATGTG

No ORFs were found in reading frame 3.

----------------------------------------------------------------------------------------------

ATG brin indirect:

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.