ORF AP24520

From Metagenes

Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092963177978
Annotathon code: ORF_AP24520
Sample :
  • GPS :1°58'26s; 95°0'53w
  • Eastern Tropical Pacific: Equatorial Pacific TAO Buoy - International
  • Open Ocean (-1.8m, 28°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2008
Username : nogio
Annotated on : 2008-05-22 08:10:28
  • EZ-ZAHER Nora
  • KOURJIAN Georgio

Contents

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1092963177978 ORF_AP24520 genomic DNA
GAGTCCAGCACCGATAGCGGCAGCAATAGGTTCCTCAATTAATTGAACTCTTCTTGCTCCTGCTGCTAAAGCACTATCTTGAATAGCTTTTCTTTCAACT
GGAGTTGAACCAGTTGGCACACAAATTAAAATTCTTGGGTTAGCAAATGTACTTCCTTTATGAACTTTTTTTATAAAGTGTTTAATCATTTCTTCTGTGA
CTATAAAATCAGCAATTACTCCATCCCTCAAAGGTCTAATAGCGCTTATATTACCCGGTGTTCTTCCAAGCATAGTTTTTGCTTCATCTCCAACAGCTAA
TACATTTTTTTTTCCTCCTTGATCAACAATGGCAACAACTGAAGGCTCATTGAGAACCACTCCATGACCTTTTAAAACCACAAGAGTATTTGCAGTTCCA
AGATCAATAGCCATATCTTGGCTCCATATTTTTTTTACGCTATCAAATAATCCCATTTAAACCCCTCCTTTTACCTTTTGATGTTCAATATTTTCAGAAA
GAGATTTTTTCTCTCTTTTAATAAGCATTTTATTTAATGCATTTAAATAAGCTTTTGCAGAAGCTACTAAAGTATCTGTATCTGCAGATTGGCCAACTGT
TGTGCGATCATTCTCTTCAATTTTTACACTCACAGTTGCTTGTGCATCTGTACCTTCAGTAACAGCATGAACTTGATACAGTGATAACTTAACATCGTGT
TCATAAAGTTCTCTAATACATTTAAAAATTGCATCGACTGGACCATCACCTGTTTGTGTAGTTTGTTTAATATCCCCAAAAACATCTAGAGTCATTTCGG
CTCTTTGAGGTTCACCGGTACCAGCATAAACTTTTAATGATTTTAAATTAATAGCATTTATTTTATTA

Translation

[413 - 868/868]   indirect strand
>ORF_AP24520 Translation [413-868   indirect strand]
MGLFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHK
GSTFANPRILICVPTGSTPVERKAIQDSALAAGARRVQLIEEPIAAAIGAGL
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

 Neighbor-joining method   
 groupe exterieur : DehaloSP

         +-----ChromoVio  [b-proteobacteria] 
     +---7 
     !   +-----AzoarSP    [b-proteobacteria] 
     ! 
     !             +------GeobacSul   [d-proteobacteria]
     !          +-10  
     !          !  +--------PlesiPaci  [d-proteobacteria]
     !       +-13  
     !       !  !        +-------SulfDenit  [e-proteobacteria] 
  +--9       !  +--------2 
  !  !       !           +-----------ArcoButz  [e-proteobacteria] 
  !  !    +-14  
  !  !    !  !     +---------AlkaliMeta    [firmicutes] 
  !  !    !  !  +-11  
  !  !    !  !  !  +----------ClosTeta      [firmicutes] 
  !  !    !  +-12  
  !  !    !     !      +-----AcidoCellu   [high GC Gram+]   
  !  +---15     +------1 
  !       !            +-----SterpCoel    [high GC Gram+]   
  !       !  
  !       !          +------CandiPela    [a-proteobacteria]
  !       !  +-------3 
  !       !  !       +ORF_AP2452
  !       +-16  
  !          !  +--------------OrienTsu   [a-proteobacteria]
  !          +-17  
  !             !  +----ParviLavam   [a-proteobacteria]
  !             +-18  
  !                !  +---RhodosRub    [a-proteobacteria]
  !                +-19  
  !                   +------GluconOxy    [a-proteobacteria]
  ! 
  !      +ShewaBent  [g-proteobacteria]
  !   +--4 
  !   !  +ShewaSP    [g-proteobacteria]
  8---6 
  !   ! +-PhotoLumi   [enterobacteria] 
  !   +-5 
  !     +---CandBlochP  [enterobacteria] 
  ! 
  +-------DehaloSP    [GNS bacteria] 





parsimonious tree found:




  +-----------------------------------------------------------DehaloSP   [GNS bacteria] 
  !  
  !                                                        +--CandBlochP   [enterobacteria] 
  !                                                  +----11  
  !                                                  !     +--PhotoLumi     [enterobacteria] 
 12  +----------------------------------------------10  
  !  !                                               !     +--ShewaSP     [g-proteobacteria]
  !  !                                               +-----9  
  !  !                                                     +--ShewaBent   [g-proteobacteria]
  !  !  
  !  !                                                     +--AzoarSP    [b-proteobacteria] 
  +--8           +----------------------------------------14  
     !           !                                         +--ChromoVio   [b-proteobacteria] 
     !           !  
     !           !                                   +--------OrienTsu  [a-proteobacteria]
     !           !                                   !  
     !           !                             +-----7     +--GluconOxy  [a-proteobacteria]
     !           !                             !     !  +--6  
     +----------13                             !     +--5  +--RhodosRub  [a-proteobacteria]
                 !     +-----------------------4        !  
                 !     !                       !        +-----ParviLavam  [a-proteobacteria]
                 !     !                       !  
                 !     !                       !           +--CandiPela   [a-proteobacteria]
                 !     !                       +-----------3  
                 !     !                                   +--ORF_AP2452
                 !     !  
                 +-----2                                   +--ArcoButz    [e-proteobacteria] 
                       !                       +----------20  
                       !                       !           +--SulfDenit   [e-proteobacteria] 
                       !                       !  
                       !                 +----19           +--AcidoCellu    [high GC Gram+]   
                       !                 !     !     +----18  
                       !                 !     !     !     +--SterpCoel    [high GC Gram+]   
                       !                 !     +----17  
                       +----------------15           !     +--ClosTeta    [firmicutes] 
                                         !           +----16  
                                         !                 +--AlkaliMeta   [firmicutes] 
                                         !  
                                         !                 +--GeobacSul   [d-proteobacteria]
                                         +-----------------1  
                                                           +--PlesiPaci    [d-proteobacteria]

Annotator commentaries

1- Recherche d’ORF :

La recherche des ORF a été faite à l’aide du programme ORF Finder(SMS). Cette recherche a été faite pour les deux brins en sens direct et indirect (dans les 6 sens de lecture possibles), ne sachant pas si notre séquence (ORF) contient tout ou une partie de la séquence d'origine, nous avons pris l’option d’une recherche d’ORF commençant par n’importe quel codon (Any codon), utilisant un code génétique standard et en éliminant les ORF possibles inférieurs à 60 codons. ORFinder a trouvé au total 2 ORF putatifs uniquement dans le sens « indirect » dont le plus long, sélectionné, fait 456 paires de bases ce qui correspond à 152 codons, on remarque que dans l'ORF selecionné commence par une Methionine et ne contient pas de codont STOP . On peut supposer que notre séquence qui commence par une MET du coté 5' est interrompu du coté 3 ' du fait de l'absence du codon stop, donc notre ORF est incomplet. Puisque notre ORF est incomplet (pas de codon STOP), alors on ne peut pas calculez la masse moléculaire théorique de notre ORF.


2- BLAST.

Nous avons utilisé BLAST pour rechercher s'il existe d'éventuels homologues de notre ORF dans les banques de séquence. En premier lieu l’analyse a été faite avec un blastp contre la banque nR, les résultats obtenus présentent des homologues potentiels, on obtient 1000 hits (pas de résultats avec 5000 hits) avec des scores allant de 278 à 39,3 et des E-values de 8e-74 à 0.078. on remarque une grande similitude entre l'ORF et notre meilleur hit : identités _

91% et similarité _
93% . 

En second lieu l’analyse a été faite avec un blastP contre SWISSPROT, on remarque que les scores des hits sont inférieurs à ceux du Blast contre la banque nR (193 à 28,5) ainsi que le meilleur hit qui présente une identité de 62% et similarité de 79% est inférieur aux résultats de nR . Dans les paramètres de BLAST on a choisi d'afficher 1000 hits, cependant on n'a pas pu déterminer le score seuil car à aucun moment on observe une chute de score ou de E-value et même dans les derniers hits on observe des protéines homologues. Ces homologues potentiels qui appartiennent à la famille protéique MreB ont une fonction importante dans la détermination de la structure cellulaire . A partir de ces séquences, sera faite l’analyse d’alignement multiple et des arbres phylogénétiques. Notre ORF qui fait 456 paires de bases ce qui correspond à 152 codons est incomplet, le nombre d’AA manquant du coté C terminal est environ 200 (calculé d’après l’alignement multiple) .


3- Recherche des domaines protéiques.

Une recherche d’homologies de domaines protéiques a été réalisée à l’aide des programmes interpro et Pfam pour voir si on trouve sur notre ORF des domaines protéiques déjà identifiés sur d’autres protéines. Dans ce cas on aurait une homologie et on pourrait probablement avoir une idée sur la fonction de notre ORF. Une fois cette analyse réalisée à partir du programme Inter pro, on trouve que la traduction de notre ORF présente un domaine protéique conservé. Ce domaine appartenant à la famille MreB a une fonction importante dans la détermination de la structure cellulaire. Nos résultats dans INTERPRO présentent une seule séquence protéique ayant le même domaine fonctionnel, dont le code est IPR004753


4- Analyse phylogénétique.

L'objectif est de réaliser des alignements multiples qui permettent tout d’abord de vérifier que l'ORF en question s'intègre correctement dans la famille de ses orthologues présumés. L'alignement multiple servira pour réaliser un arbre phylogénétique des orthologues et trouver ainsi les homologues présumés. D’après le linear report du rapport taxonomique on peut observer que notre meilleur hit se situ parmi les Alphaproteobacteria, Proteobacteria, Bacteria. En comparant les informations du taxonomie report avec celles du taxonomiques obtenues avec interpro on peut dire que e domaine protéique de code IPR004753 est bien d’origine bactérienne. Nous avons choisi à partir du blastp différentes séquences homologues (qui ont de bons scores et E-values) à notre ORF que nous appelons « groupe d’étude » : on choisi les Proteobacteria, ainsi qu’un « groupe extérieur » qui lui contient des séquences homologues mais plus éloignées que celle du groupe d’étude. On définie le « groupe d’étude » de telle sorte qu’il représente une lignée taxonomique réelle. Ce doit être un groupe monophylétique, alors le choix des séquences parmi l’ensemble de ces lignées est fait de telle sorte que l’ensemble des lignées soit représenté. On définie le « groupe extérieur » afin qu’il soit constitué de l’ensemble des lignées de même niveau taxonomique que le groupe d’étude, alors le choix des séquences parmi l’ensemble de ces lignées est réalisé de telle sorte que l’ensemble des lignées soit représentées. Ceci pourra nous aider à déterminer les liaisons de parentés entre notre séquence d’étude et les séquences homologues trouvées. Ainsi nous pourrons suivre le chemin évolutif de la séquence d’étude et probablement identifier le groupe taxonomique d’où elle provient. L’ensemble de ces séquences et leurs abréviations seront présentées dans le tableau qui suit :

- Séquences du groupe d’étude: PlesiPaci [d-proteobacteria] GeobacSul [d-proteobacteria] CandiPela [a-proteobacteria] ParviLavam [a-proteobacteria] RhodosRub [a-proteobacteria] GluconOxy [a-proteobacteria] OrienTsu [a-proteobacteria] ShewaBent [g-proteobacteria] ShewaSP [g-proteobacteria] PhotoLumi [enterobacteria] CandBlochP [enterobacteria] ChromoVio [b-proteobacteria] AzoarSP [b-proteobacteria] SulfDenit [e-proteobacteria] ArcoButz [e-proteobacteria]

- Séquences du groupe exterrieur: DehaloSP [GNS bacteria] AlkaliMeta [firmicutes] SterpCoel [high GC Gram+] AcidoCellu [high GC Gram+] ClosTeta [firmicutes]

- Analyse des alignements : On observe beaucoup d'homologie et de similarité sur la moitié N terminal entre nos séquences (partie très conservée) cependant au niveau de la moitié C terminale on voie beaucoup d'homologie et de similarité entre le groupe d'études et le groupe extérieur avec absence de l'ORF à ce niveau là, se qui nous permet de vérifier hypothèse que notre ORF est incomplet (coté 3'),



- Analyse des arbres: Une première analyse a été réalisée par la méthode de Parcimonie qui permet d’identifier le plus petit nombre de changements évolutifs entre les séquences étudiées. Une deuxième analyse à été réalisée par la méthodes du neighbor-joining qui permet de déterminer les distances évolutives entre chaque séquence. Les arbres ont été racinés au niveau de «DehaloSP» et nous avons donc obtenu un arbres par la méthode de Parcimonie, ainsi qu’un arbre obtenu par la méthode des distances ou « Neighbor-Joining » , on remarque que ces deux arbres sont comparables en se qui concerne le positionnements des séquences. On choisi alors de travailler avec l’arbre par « N.J », etant donné que celui-ci nous renseigne sur les distances évolutives c’est à dire le taux de changements évolutifs entre deux séquences (nombre de substitutions, de remplacement d’acides amines). On remarque que notre ORF se trouve parmi le groupe d’études choisi qui est formé de séquences provenant de « Proteobacteria » par contre il se situe exactement parmi les « Alphaproteobacteria »et nos séquences du groupe extérieur se regroupent aux extremitées . A partir du noeud 16 (qui regroupe 3-17-18-19) on peut voir que notre ORF se situe entre les séquences des bactéries appartenant au groupe taxonomique Alphaproteobacteria, ceci nous permet de dire que notre séquence appartient probablement au groupe taxonomique Alphaproteobacteria .


5-Discussion. Suite au travail effectué on peut conclure que notre séquence nucléotidique contient probablement un cadre de lecture ouvert qui code pour une protéine. Ce fragment est incomplet (coté 3’_

pas de STOP). Cette affirmation est confirmée par le bastp, la recherche des domaines protéiques et l’alignement multiple.  

Le blastp donne des séquences avec de fortes similarités (très bons scores et E-values) la majorité de ces séquences sont d’origines bactériennes, le groupe de Alphaproteobacteria est celui qui représente les meilleures similitudes, en plus toutes les séquences trouvées présentent une seule fonction : rôle dans la détermination de la structure cellulaire (famille MreB) chez les séquences similaires obtenues. Pour confirmer les résultats du blastp, une recherche de domaine protéiques homologues a été réalisée, on trouve aussi sur notre ORF un domaine protéique de la famille MreB. Une analyse phylogénétique a été faite, on a réalisé deux groupes, un groupe d’études avec les séquences les plus proches de notre ORF et un groupe extérieur avec des séquences toujours homologues mais plus éloigné de notre ORF (et n'appartenant pas au groupe d'étude) . A partir des alignements un arbre a été construit à l’aide de la méthode du Neighbor-Joining, ceci nous permet probablement de déterminer a quel groupe taxonomique appartient notre séquence d’étude. Aussi, en se basant sur le rapport taxonomique (meilleur hit : alphaproteobacterie), et sur les informations taxonomiques obtenues avec interpro on peut dire que notre ORF appartient au groupe de Alphaproteobacteria. Cette hypothèse est vérifiée car notre séquence sort parmi les séquences provenant des Alphaproteobacteria.


Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


PlesiPaci        ---------------------MLFDWVYGLFSNDMAIDLGTATTLTYVKGKGIVAHEPSV
GeobacSul        -------------------MLKIFDSLFGLFSNDLAIDLGTANTLVYLKGKGIVVREPSV
ORF_AP24520      --------------------MGLFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSV
CandiPela        -------------------MANWFKNLSSIWSQDMAIDLGTANTLVVLKGQGVVLNEPSV
ParviLavam       ----------------------MLSGLLGMFSADMAIDLGTANTLVYVKGRGIVLNEPSV
RhodosRub        --------------------------MTGLLSADMAIDLGTANTLVYVKGRGIVLNEPSV
GluconOxy        ----------------------MFSRLLGLMSADMAIDLGTANTLVYVKGRGIVLDEPSV
OrienTsu         -------------MVLKKYIKQAKEKILSFYSSNMAIDLGTANTLVYVQGKGIVLNEPSV
ShewaBent        ----------------------MFKKLRGIFSNDLSIDLGTANTLIYVRDEGIVLNEPSV
ShewaSP          ----------------------MFKKLRGIFSNDLSIDLGTANTLIYVRDEGIVLNEPSV
PhotoLumi        --MVGRVDGFRSVPSLQDYPFAMFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSV
CandBlochP       ----------------------MFKKFRGIFSSDLSIDLGTANTLIYLKGQGIVLNEPSV
DehaloSP         ----------------------MFKKFRGMFSNDLSIDLGTANTLIYVRGQGIVLNEPSV
ChromoVio        ----------------------MFRSLTGYFSNDLAIDLGTANTLIYMRSKGIVLDEPSV
AzoarSP          ----------------------MFGFLRSYFSNDLAIDLGTANTLIYVRGKGIVLDEPSV
AlkaliMeta       ------------------------MGMFNFFSRDMGIDLGTANTLVYVRGKGIVLREPSV
ClosTeta         -------------------------MGLFGMSRDMGIDLGTANTLIYVKGKGVVLREPSV
SterpCoel        -----------------------MGNSMSFIGRDMAVDLGTANTLVYVRGRGIVLNEPSV
AcidoCellu       MGAEPLFPAAVDGGTCPMLNERRASMPTSIFGRDMAVDLGTANTLVYVRGRGIVLNEPSV
SulfDenit        ---------------------MIFNKLIGLFSNDLSIDLGTANTIVIAKGRGIIINEPSV
ArcoButz         ---------------------MILDKIIGLFSNDMAIDLGTANTIVSIKGKGIIINEPSV
                                                . ::.:*****.*:   :..*::  ****

PlesiPaci        VAVQKQGG--VVKRVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTEAMMRHFINR
GeobacSul        VAVQKTNM--GQQKVLAVGMEAKKMLGRTPGNITAIRPMKDGVIADFDITEEMLRYFIHK
ORF_AP24520      VAIVDQGG---KKNVLAVGDEAKTMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKK
CandiPela        VAIADNNG---KKTVLAVGDEAKTMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKK
ParviLavam       VAIIEKGG---KKQVLAVGEEAKMMLGRTPGNIQAIRPMRDGVIADFEIAEEMIKHFIRK
RhodosRub        VAIADVKG---KKQVLAVGDEAKQMLGRTPGNIQAIRPLRDGVIADFEVAEEMIKHFIRK
GluconOxy        VAIAEVRG---KKQVLAVGNEAKQMVGRTPGNITAIRPLRDGVIADFEVAEEMIKHFIRK
OrienTsu         VALIREGG---SYKPYAFGHEAKMMLGKTPSDIEAKRPLKDGVIADFKSAEEMIKHFIHS
ShewaBent        VAIRTERGNGGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQ
ShewaSP          VAIRGERSSSGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQ
PhotoLumi        VAIRQDRA-GSSKSVAAVGQEAKQMLGRTPGNIAAIRPMKDGVIADFYVTEKMLQHFIKQ
CandBlochP       VAIRQDRG-GMPKSVAAVGYAAKQMLGRTPGNIAAIRPMKDGVIADFFITEKMLQHFIKQ
DehaloSP         VAVRQDRMIGGNRTVAAVGGEAKQMLGRTPGHITTIRPMKDGVIADFTYTEEMLKHFIRK
ChromoVio        VAIHN-DAPTNKKSILAVGLEAKRMLGRTPGSIQAIRPMKDGVIADFTVTEQMLKQFIKK
AzoarSP          VAIRTEGGPNAKRTIQAVGHAAKQMLGKTPGNITAIRPMKDGVIADFVVTEQMIKQFIKK
AlkaliMeta       VAIQSDTK-----TVLAVGEEAKRMIGRTPGNIVAIRPMRDGVIADFDVTQSMLKYFIKK
ClosTeta         VAINSDTK-----RVLAVGDEAKQMIGRTPGNIIAIRPLKDGVIADFDVTQAMLKKFIEK
SterpCoel        VAINTNTG-----GILAVGAEAKKMIGRTPGNIVAVRPLKDGVIADFEITERMLRYFILK
AcidoCellu       VAINTNTG-----GILAVGIEAKRMIGRTPGNIVAVRPLKDGVIADFDTTERMLRYFIQK
SulfDenit        VAVKTGKF--GHQRVLAVGHEAKEMVGKTPGNIKAIRPMRDGVIADFDMTEKMIRKFIEK
ArcoButz         VAVQTDRQ--GKDRILAVGQEAKRMIGKTPLNIQAVRPMQDGVIADFEMTERMIRYFIEK
                 **:             *.*  ** *:*:**  * : **::*******  :: *:: **  

PlesiPaci        AHNRQTLVK-PRIIICVPSGITEVEKRAVRDSALAAGAREVFLIEEPMAAAIGAGLPITE
GeobacSul        VHNRKTLVR-PRIVICVPSGITQVEKRAVKESAESAGAREVYLIEEPMAAAIGAGLPITE
ORF_AP24520      VHKGSTFAN-PRILICVPTGSTPVERKAIQDSALAAGARRVQLIEEPIAAAIGAGL----
CandiPela        VHKNKTFAN-PRILICVPTGSTPVERKAIQDSALAAGARRVQLIEEPIAAAIGAGLPISE
ParviLavam       VHNRRSFAN-PQIIVCVPSGSTAVERRAIQESALSAGARRVYLIEEPMAAAIGAGLPVTE
RhodosRub        VHNRRSFAS-PMVIICVPSGSTAVERRAIQESAEAAGARRVFLIEEPMAAAIGAGLPVTE
GluconOxy        VHNRRAFAS-PQIIICVPSGATAVERRAIQESAESAGARKVMLIEEPMAAAIGAGLPVTE
OrienTsu         VHNRRSFAG-PVIIICVPSGSTPVERRAIQEAAESAGGREVFLIEEPMAAAIGAGLPVTS
ShewaBent        VHKNSFFRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSE
ShewaSP          VHNNSFFRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSE
PhotoLumi        VHSNSFMRPSPRVLVCVPVGATQVERRAIRESALSAGAREVFLIEEPMAAAIGAGLPVSE
CandBlochP       VHSNSFLKPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSE
DehaloSP         VHKSRFLRPSPRVLVCVPCGSTQVERRAIKESAEEAGAREVYLIEEPMAAAIGAGMPVTE
ChromoVio        VNPNRFFAASPRIVICVPCGSTQVERKAIRDSALAAGARRVELIEEPMAAAIGAGLPVEE
AzoarSP          VHDSRMFSPSPRIIVCVPCGSTQVERRAIRDAALAAGASQVYLIEEPMAAAIGAGLPVSD
AlkaliMeta       AYPRKTLVQ-PRVVVCVPSGVTEVEKRAVEEAALQAGAREAYLIEEPMAAAIGAGLPVEE
ClosTeta         VSPKSAFTS-PRIVVCFPSGVTEVERRAIDEATKSAGAREVLLMEEPMAAAIGAGLPVNE
SterpCoel        IHKRRYLAR-PRVVVCVPSGITGVERRAVIEASSQAGARQVHIIEEPMAAAIGSGLPVHE
AcidoCellu       VHRNRHLARGPRLVVCVPSGCTAVEQRAVKDAGYAAGARRVYIIEEPMAAAIGAGLPVHE
SulfDenit        AHGRSSLIS-PRIIICVPYGLTQVERKAVRESALSAGAREVFLIEEPMAAAIGAGIDIRE
ArcoButz         AHSRKSFVR-PRVIICIPYGITQVEKKAVEESAMSAGAREVFLVEEPMAAAIGAGIPVSD
                       :   * :::*.* * * **::*: ::   **. .. ::***:*****:*:    

PlesiPaci        PGGNMVVDIGGGTAEVAVISLAGIVACKSVRVGGDKMDEAIVQHIKRKYNLLIGERTAEQ
GeobacSul        ASGNMIVDIGGGTTEVAVISLAGIVLTKSVRVGGDKMDEAIVQYIKRKYNLLIGDRMAEI
ORF_AP24520      ------------------------------------------------------------
CandiPela        ATGSMVVDIGGGTTEIAVMSLGGLVYSRSLRVAGDAMDTALVNYMRKEYNLMIGDSTAEK
ParviLavam       PTGSMVVDIGGGTTEVAVLSLGGIVYARSVRVGGDKMDEAIIAYIRRHHNLLVGEASAER
RhodosRub        PTGSMVVDIGGGTTEVAVLSLGGIVYARSVRVGGDKMDEAIIAYIRRNHNLLVGEGSAER
GluconOxy        PSGSMIVDIGGGTTEVAVISLGGIVYARSARVGGDKMDEAIISYIRKTYNLLVGESSAER
OrienTsu         PTGSMIVEIGGGTTQVAVLSLGGVVYSKSVRVGGDKMDEAISSYIRRYHNLLIGDPTAER
ShewaBent        ATGSMVVDIGGGTTEVAIISLNGVVYASSVRIGGDKFDDAIINYVRRNYGSLIGEATAER
ShewaSP          ATGSMVVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAER
PhotoLumi        ATGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAER
CandBlochP       ATGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIISYVRRHYGSLIGEVTSER
DehaloSP         ARGSMVVDVGGGTTEVAVIALNGIVYSASVRIGGDRFDESIINYVRRTYGTLIGEATAER
ChromoVio        PTGSMVVDIGGGTTEVGVISLGGVVYSNSVRVGGDKFDEAIINYIRRNYGMLIGETTAEE
AzoarSP          ATGSMVVDIGGGTTEVGVISLGGMVYAGSVRVGGDKFDDSIVNYIRRNYGMLIGDTTAEN
AlkaliMeta       PTGSMVVDMGGGTTEVAIISLGGIVTAKSIRVGGDELDEAIAQYIKREYNLMIGERTAEE
ClosTeta         PTGSMVVDIGGGTTEVAIISLGGIVTSKSLRVAGDELDQAIINYIKKQYNLMIGERTAEN
SterpCoel        ATGNMVVDIGGGTTEVAVISLGGIVTAQSIRVAGDELDNAIIQHVKKEYSLLLGERTAEQ
AcidoCellu       PTGNMVVDIGGGTTEVAVISLGGIVTSQSIRVGGDELDNAIINYVKKEYSLMLGERTAEE
SulfDenit        PQGNLVVDIGGGTTEIGVVSLGGLVLSKSIRTAGDKIDQAIVNYVRRKYNLLIGERIAEE
ArcoButz         PAGYVVVDIGGGTTEIGVTSLGGLVLCKSIKVAGDKIDRSIVEYVRQNYNLFIGERAAET
                                                                             

PlesiPaci        VKIEIGTAAPTDVVM-----TMEVKGRDLVAGIPKTVLIDSDEIRGALSEPVSAIVDAVR
GeobacSul        IKIEIGEAYAAGEMR-----TMEVKGRDLVSGIPKTTEINSDEIREALSEPVNAIVDAVK
ORF_AP24520      ------------------------------------------------------------
CandiPela        IKKEIGTAIPSNS------NTYAVKGRDLRSGTPKEVNITEEDTAEALNDILKEMVNGIK
ParviLavam       IKKEVGSAAIPSD---GDGMTIEIKGRDLMNGVPKEIAIGQRQIAESLAEPVGAIVEAVK
RhodosRub        IKKEIGCACPPED---GSNRTIEIKGRDLMNGVPKELVISEAQIAESLAEPVSAIIEAVK
GluconOxy        IKIELGSAMMPDDPANPDGPLTEIKGRDLINGVPREVIVSQAQIAESLAEPVMQIVDAVT
OrienTsu         IKKEIATAYVSTN---TEAKTIQIRGRDLINGVPKGITISEQQIAESLVEPVNQIIETIK
ShewaBent        IKHTIGTAYPGDE-----VLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVM
ShewaSP          IKHTIGTAYPGDE-----VLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVM
PhotoLumi        IKHTIGSAYPGDE-----MLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVM
CandBlochP       IKHTIGSAYLDDE-----LREIKVRGRNLAEGIPRSFVLNNNEILEALQEPLTGIVSAVM
DehaloSP         IKLEIGCAYPQER-----ASTVEISGRNLAEGVPKMVTINSNEVLEALREPLSGIVSAIK
ChromoVio        IKKTIGSAFPGAE-----VREMEVKGRNLAEGIPRAFTVSSNEILEALTEPLNQIVSAVK
AzoarSP          IKKGIGSAFPGSE-----VREMEVKGRNLAEGIPRSFTISSNEILEALTEPLNQIVSAVK
AlkaliMeta       VKITIGSAFEKIKEE-----KMLVRGRDLVSGLPKTLEITSTEIMDALREPVSQVVEAIK
ClosTeta         VKIELGSAYESEEEEK----IMEIRGRDLITGLPKVINIRENEVREALQEPISAIIDAIK
SterpCoel        IKITIGSAYDLDSDE-----HTEIRGRDLVSGLPKTVVISAAEVRKAIEEPVNAIVDAVK
AcidoCellu       IKMAIGSAFPVPDEP-----HAEIRGRDLVSGLPKTIVVSAAEIRKAIDEPVNAIIDAVK
SulfDenit        IKINIGTAVTLDEEL-----KMVITGRDQVEGLLSSVELTSEDAREAMKEPLKEVAEALR
ArcoButz         IKIEIGTAVKLDTEL-----KMKVKGRD-HSGFLSTIELGSEGVRIAIKEPLKEIASAIR
                                                                             

PlesiPaci        VVLERAPPELCADIVDKGIVLTGGAAQLRNLDVLLSEETGLPVFLCDEPDFAVVLGSGAA
GeobacSul        ICLERTPPELAADIVDRGIFLAGGGALLRNLDMLLREETGLPVFIADDPLSCVVLGSGKV
ORF_AP24520      ------------------------------------------------------------
CandiPela        DALENTPPELSADLVDMGLTLTGGGALLKNIDKRFSKETGLPVFIADDPLACVAIGTGKA
ParviLavam       VALEATPPELAADIVDKGIVLTGGGALLANLDQVLRDETGLPVSIADDPLSCVALGTGKA
RhodosRub        VALEHTAPELAADIVDKGIVLTGGGALLTNLDYVLRASTGLPVSIADDPLSCVAMGTGRA
GluconOxy        TALENTPPELAADIVDKGIVLSGGGALLYRLDEVLRLYTGLPVTVAENALSCVALGTGRA
OrienTsu         ATLECTPPELSADIADKGIVLSGGGSLIKNLDLLIKETTQLPVFIAENPLFCVALGSGEI
ShewaBent        AALEQSPPELASDIAERGMVLTGGGALIRDLDRLLMQETGIPVMVADDPLTCVARGGGKA
ShewaSP          VALEQSPPELASDISERGMVLTGGGALLRDLDRLLMQETGIPVMVADDPLTCVARGGGKA
PhotoLumi        VALEQCPPELASDISERGMILTGGGALLRNLDRLLIEETGIPVIVAEDPLTCVARGGGKA
CandBlochP       AALEQCPPELASDISEYGMVLTGGGALLRNIDRLLIKETSIPVVIAEDPLTCVARGGGKA
DehaloSP         LALEQTPPELCADVAERGIVLTGGGALLRDLDRLISEETGLHVQVADDPLTCVARGGGRA
ChromoVio        IALEQTPPELGADIAEKGMVLTGGGALLKDIDRLLAEETGLPVFVAEEPLTCVVRGSGKA
AzoarSP          IALEQTPPELGADIADRGMVLTGGGALLRDLDRLLMEETGLPVIVADEPLTCVARGCGMA
AlkaliMeta       YTLEKTPPELAADIMEIGIMLTGGGALLDGLDKLVRRETGMPVQIAEEPLDCVALGTGKT
ClosTeta         STLEKTPPELASDIIDKGIMLTGGGAMLKGIDLLINEETHMPVNIAETAIDCVAIGAGKA
SterpCoel        TTLDKCPPELSGDIMDRGIVLTGGGALLRGLDERLRRETGMPIHIAEDPLDSVALGSGKC
AcidoCellu       VTLDKCPPELAGDIMDRGIVLTGGGALLKGLDERLRHETGMPIHITERPLDSVALGAGKC
SulfDenit        DVLEQMPPDLAGDIVNHGIILTGGGALIRQLDKYLSDIIKIPVYVADEPLLAVARGTGRA
ArcoButz         SVLENMPPDLAGDIVDNGIIITGGGALIRGIDTYLAEIVKIPVKIADEPLLSVAYGTSQV
                                                                             

PlesiPaci        LDELDILREVAVE-----
GeobacSul        LDELNLLRRVAVSS----
ORF_AP24520      ------------------
CandiPela        LEQEETFSTMLSEY----
ParviLavam       LEHIRTMKHVLSSVY---
RhodosRub        LEEMKRLRNVLTTMY---
GluconOxy        LEEMRRLRSVLSSMY---
OrienTsu         LEDFDRLKHVLFKQH---
ShewaBent        LEMIDMHGGDLFSEET--
ShewaSP          LEMIDMHGGDLFSEET--
PhotoLumi        LEMIDMHGGELFSEE---
CandBlochP       LDMIDVHGRDLFSEE---
DehaloSP         LELVDMHGNEFFAPE---
ChromoVio        LEKMDKIGTIFTNVP---
AzoarSP          LEKMDKLGSIFASE----
AlkaliMeta       IEEIDTLKRVLMTPRKLR
ClosTeta         LDTLDKLMENKKR-----
SterpCoel        VEEFEALQQVLDASPRR-
AcidoCellu       VEDFDTLQPVLISEPRSR
SulfDenit        LEEIDLLQELFENE----
ArcoButz         LDEPELLKVINDMKNSQ-

BLAST

BlastP contre banque nr (non redundant), max target sequences : 1000
on n'obtient pas de resultat avec "max target = 5000"


                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01264837.1|  rod shape-determining protein MreB [Candid...   278    8e-74
ref|YP_266780.1|  rod shape-determining protein MreB [Candidat...   278    8e-74 
ref|YP_001413745.1|  cell shape determining protein, MreB/Mrl ...   232    5e-60 
ref|YP_425562.1|  Cell shape determining protein MreB/Mrl [Rho...   224    9e-58 
gb|AAL57491.1|AF438483_1  cell-shape determining protein MreB ...   222    7e-57
ref|YP_745291.1|  rod shape-determining protein mreB [Granulib...   221    1e-56 
ref|YP_422876.1|  Actin-like ATPase involved in cell morphogen...   221    1e-56 
emb|CAM76495.1|  Rod shape-determining protein [Magnetospirill...   219    3e-56
ref|ZP_02187329.1|  Actin-like ATPase involved in cell morphog...   219    3e-56
ref|YP_192132.1|  Rod shape-determining protein MreB [Gluconob...   219    4e-56 
ref|ZP_00055538.2|  COG1077: Actin-like ATPase involved in cel...   219    5e-56
ref|YP_001602581.1|  putative rod shape-determining protein mr...   216    3e-55 
ref|YP_681544.1|  rod shape-determining protein, putative [Ros...   215    7e-55 
ref|YP_001234443.1|  cell shape determining protein, MreB/Mrl ...   214    1e-54 
ref|YP_165683.1|  rod shape-determining protein MreB [Siliciba...   212    5e-54 
ref|ZP_00956813.1|  rod shape-determining protein MreB [Sulfit...   212    7e-54
ref|ZP_02152042.1|  rod shape-determining protein, putative [O...   210    2e-53
ref|YP_612468.1|  cell shape determining protein, MreB/Mrl fam...   209    4e-53 
ref|ZP_02144277.1|  cell shape determining protein, MreB/Mrl f...   209    5e-53
ref|ZP_01447921.1|  rod shape-determining protein MreB [alpha ...   207    1e-52
ref|ZP_01753204.1|  rod shape-determining protein MreB [Roseob...   207    1e-52
ref|ZP_01016071.1|  rod shape-determining protein MreB [Parvul...   207    1e-52
ref|YP_001531942.1|  cell shape determining protein, MreB/Mrl ...   207    2e-52 
ref|YP_436431.1|  Actin-like ATPase involved in cell morphogen...   207    2e-52 
ref|ZP_01902200.1|  rod shape-determining protein, putative [R...   206    3e-52
ref|ZP_00952393.1|  rod shape-determining protein MreB [Oceani...   206    3e-52
ref|ZP_02157672.1|  rod shape-determining protein MreB [Shewan...   206    5e-52
ref|YP_352384.1|  Cell shape determining protein MreB/Mrl [Rho...   205    9e-52 
ref|YP_001167798.1|  cell shape determining protein, MreB/Mrl ...   205    9e-52 
ref|ZP_01740620.1|  rod shape-determining protein MreB [Rhodob...   204    1e-51
ref|YP_001052162.1|  cell shape determining protein, MreB/Mrl ...   204    1e-51 
ref|YP_001092534.1|  cell shape determining protein, MreB/Mrl ...   204    1e-51 
ref|ZP_00958711.1|  rod shape-determining protein MreB [Roseov...   204    2e-51
ref|YP_001472298.1|  cell shape determining protein, MreB/Mrl ...   204    2e-51 
ref|NP_420354.1|  rod shape-determining protein MreB [Caulobac...   204    2e-51 
ref|ZP_01749449.1|  cell shape determining protein, MreB/Mrl f...   204    2e-51
ref|YP_761615.1|  rod shape-determining protein MreB [Hyphomon...   204    2e-51 
ref|NP_904027.1|  rod shape-determining protein mreB [Chromoba...   204    2e-51 
ref|ZP_01001712.1|  rod shape-determining protein MreB [Loktan...   204    2e-51
ref|ZP_00997997.1|  rod shape-determining protein MreB [Oceani...   203    2e-51
ref|YP_001683117.1|  cell shape determining protein, MreB/Mrl ...   203    3e-51 
ref|YP_865329.1|  cell shape determining protein, MreB/Mrl fam...   203    4e-51 
ref|ZP_01444025.1|  rod shape-determining protein MreB [Roseov...   202    4e-51
ref|YP_926347.1|  rod shape-determining protein MreB [Shewanel...   202    5e-51 
ref|NP_719628.1|  rod shape-determining protein MreB [Shewanel...   202    7e-51 
ref|YP_001762749.1|  cell shape determining protein, MreB/Mrl ...   202    7e-51
ref|YP_964961.1|  cell shape determining protein, MreB/Mrl fam...   202    7e-51 
ref|YP_158736.1|  ROD shape-determining protein [Azoarcus sp. ...   202    7e-51 
ref|YP_001503600.1|  cell shape determining protein, MreB/Mrl ...   202    8e-51 
ref|YP_735595.1|  cell shape determining protein, MreB/Mrl fam...   202    8e-51 
ref|YP_001676038.1|  cell shape determining protein, MreB/Mrl ...   201    9e-51 
ref|YP_854929.1|  rod shape-determining protein MreB [Aeromona...   201    1e-50 
ref|NP_931263.1|  Rod shape-determining protein MreB [Photorha...   201    1e-50 
ref|YP_511587.1|  cell shape determining protein, MreB/Mrl fam...   201    1e-50 
ref|YP_757247.1|  cell shape determining protein, MreB/Mrl fam...   201    1e-50 
ref|ZP_01308312.1|  rod shape-determining protein MreB [Oceano...   201    1e-50
ref|ZP_01453455.1|  rod shape-determining protein MreB [Maripr...   201    1e-50
ref|YP_001356014.1|  cell shape-determining protein MreB [Nitr...   201    1e-50 
ref|ZP_01913301.1|  rod shape-determining protein MreB [Plesio...   201    1e-50
ref|ZP_02842819.1|  cell shape determining protein, MreB/Mrl f...   200    2e-50
ref|YP_752404.1|  cell shape determining protein, MreB/Mrl fam...   200    2e-50 
ref|ZP_00628623.1|  Cell shape determining protein MreB/Mrl [P...   200    2e-50 
ref|YP_356469.1|  rod shape-determining protein MreB [Pelobact...   200    2e-50 
ref|NP_953138.1|  rod shape-determining protein MreB [Geobacte...   200    2e-50 
ref|ZP_01740014.1|  Actin-like ATPase involved in cell morphog...   200    3e-50
ref|ZP_01814406.1|  rod shape-determining protein MreB [Vibrio...   199    3e-50
ref|YP_528661.1|  Twin-arginine translocation protein TatB [Sa...   199    4e-50 
ref|YP_931679.1|  rod shape-determining protein MreB [Azoarcus...   199    4e-50 
ref|ZP_01155933.1|  rod shape-determining protein MreB [Oceani...   199    4e-50
ref|ZP_01011290.1|  rod shape-determining protein MreB [Rhodob...   199    4e-50
ref|YP_659769.1|  cell shape determining protein, MreB/Mrl fam...   199    5e-50 
ref|YP_001186356.1|  cell shape determining protein, MreB/Mrl ...   199    5e-50 
ref|ZP_00992862.1|  rod shape-determining protein MreB [Vibrio...   199    5e-50
ref|ZP_01066145.1|  rod shape-determining protein MreB [Vibrio...   199    5e-50
ref|ZP_01867366.1|  rod shape-determining protein MreB [Vibrio...   199    6e-50
ref|YP_094846.1|  rod shape determining protein MreB [Legionel...   199    7e-50 
emb|CAM32665.1|  Actin-like ATPase involved in cell morphogene...   198    7e-50
ref|NP_799070.1|  rod shape-determining protein MreB [Vibrio p...   198    7e-50 
ref|NP_253171.1|  rod shape-determining protein MreB [Pseudomo...   198    7e-50 
ref|ZP_02196793.1|  rod shape-determining protein MreB [Vibrio...   198    9e-50
ref|ZP_01482840.1|  hypothetical protein VchoR_02001247 [Vibri...   198    9e-50
ref|ZP_02142690.1|  rod shape-determining protein, putative [R...   198    9e-50
ref|YP_001002583.1|  cell shape determining protein, MreB/Mrl ...   198    9e-50 
ref|ZP_02061675.1|  Rod shape-determining protein MreB [Ricket...   198    9e-50
ref|ZP_01680414.1|  rod shape-determining protein MreB [Vibrio...   198    9e-50
ref|XP_001617724.1|  hypothetical protein NEMVEDRAFT_v1g225844...   198    9e-50 
ref|ZP_01970925.1|  rod shape-determining protein MreB [Vibrio...   198    9e-50
ref|NP_230069.1|  rod shape-determining protein MreB [Vibrio c...   198    9e-50 
ref|NP_794226.1|  rod shape-determining protein MreB [Pseudomo...   198    1e-49 
ref|YP_277806.1|  rod shape-determining protein [Candidatus Bl...   198    1e-49 
ref|YP_001218684.1|  rod shape-determining protein MreB [Vibri...   198    1e-49 
ref|ZP_00417831.1|  Cell shape determining protein MreB/Mrl [A...   198    1e-49
ref|ZP_01617571.1|  Cell shape determining protein MreB/Mrl [m...   198    1e-49
emb|CAP08306.1|  putative cell-shape determining protein [Serr...   198    1e-49
ref|YP_001266318.1|  cell shape determining protein, MreB/Mrl ...   198    1e-49 
ref|YP_959990.1|  cell shape determining protein, MreB/Mrl fam...   197    1e-49 
ref|ZP_00822878.1|  COG1077: Actin-like ATPase involved in cel...   197    1e-49
ref|ZP_01746106.1|  rod shape-determining protein MreB [Sagitt...   197    1e-49
ref|YP_001439684.1|  hypothetical protein ESA_03638 [Enterobac...   197    1e-49 
ref|ZP_01613178.1|  cell wall structural complex MreBCD, actin...   197    1e-49
ref|YP_126203.1|  Rod shape-determining protein MreB [Legionel...   197    2e-49 
ref|ZP_01871846.1|  putative rod shape-determining protein [Ca...   197    2e-49
ref|NP_743094.1|  rod shape-determining protein MreB [Pseudomo...   197    2e-49 
ref|YP_606788.1|  rod shape-determining protein MreB [Pseudomo...   197    2e-49 
ref|YP_453836.1|  rod shape-determining protein MreB [Sodalis ...   197    2e-49 
ref|YP_341172.1|  Rod shape-determining protein [Pseudoalterom...   197    2e-49 
ref|YP_001480633.1|  cell shape determining protein, MreB/Mrl ...   197    2e-49 
ref|ZP_01899666.1|  rod shape-determining protein MreB [Morite...   197    2e-49
ref|YP_546597.1|  cell shape determining protein, MreB/Mrl fam...   197    2e-49 
ref|YP_411020.1|  cell shape determining protein, MreB/Mrl fam...   197    2e-49 
ref|YP_383885.1|  Cell shape determining protein MreB/Mrl [Geo...   197    2e-49 
ref|ZP_01057855.1|  rod shape-determining protein MreB [Roseob...   197    2e-49
ref|YP_001231612.1|  cell shape determining protein, MreB/Mrl ...   196    3e-49 
ref|ZP_00945662.1|  MreB [Ralstonia solanacearum UW551] >gb|EA...   196    3e-49
ref|ZP_02205132.1|  cell shape determining protein, MreB/Mrl f...   196    3e-49
ref|YP_001019280.1|  putative rod shape-determining protein [M...   196    3e-49 
ref|ZP_01101767.1|  rod shape-determining protein MreB [gamma ...   196    3e-49
ref|YP_001358421.1|  cell shape-determining protein MreB [Sulf...   196    3e-49 
ref|YP_203755.1|  rod shape-determining protein MreB [Vibrio f...   196    4e-49 
ref|YP_574290.1|  cell shape determining protein, MreB/Mrl fam...   196    4e-49 
ref|NP_935727.1|  rod shape-determining protein MreB [Vibrio v...   196    4e-49 
ref|YP_001340796.1|  cell shape determining protein, MreB/Mrl ...   196    4e-49 
ref|YP_692250.1|  rod shape-determining protein MreB [Alcanivo...   196    4e-49 
ref|NP_407121.1|  rod shape-determining protein MreB [Yersinia...   196    4e-49 
ref|YP_001171554.1|  rod shape-determining protein MreB [Pseud...   196    4e-49 
ref|NP_878590.1|  rod shape-determining protein MreB [Candidat...   196    5e-49 
ref|YP_525153.1|  cell shape determining protein, MreB/Mrl fam...   196    5e-49 
ref|YP_048394.1|  rod shape-determining protein [Erwinia carot...   196    5e-49 
ref|ZP_01133317.1|  Rod shape-determining protein [Pseudoalter...   195    6e-49
ref|ZP_01115299.1|  Cell shape determining protein MreB/Mrl [R...   195    6e-49
ref|YP_564333.1|  cell shape determining protein, MreB/Mrl fam...   195    7e-49 
ref|YP_001351886.1|  rod shape-determining protein MreB [Janth...   195    7e-49 
ref|ZP_01108617.1|  rod shape-determining protein MreB [Altero...   195    7e-49
ref|ZP_01627243.1|  Twin-arginine translocation protein TatB [...   195    7e-49
ref|YP_001337318.1|  regulator of ftsI, penicillin binding pro...   195    8e-49 
ref|ZP_01388082.1|  cell shape determining protein, MreB/Mrl f...   195    8e-49
ref|ZP_01035493.1|  rod shape-determining protein MreB [Roseov...   194    1e-48
ref|YP_001098532.1|  Rod shape-determining protein mreB [Hermi...   194    1e-48 
ref|YP_001248828.1|  rod shape-determining protein [Orientia t...   194    1e-48 
ref|ZP_00965423.1|  COG1077: Actin-like ATPase involved in cel...   194    1e-48
ref|YP_112639.1|  rod shape-determining protein MreB [Methyloc...   194    1e-48 
ref|YP_001320106.1|  cell shape determining protein, MreB/Mrl ...   194    1e-48 
ref|ZP_01877923.1|  rod shape-determining protein MreB [Roseov...   194    1e-48
ref|ZP_01076367.1|  rod shape-determining protein MreB [Marino...   194    1e-48
ref|NP_755872.1|  Rod shape-determining protein mreB [Escheric...   194    2e-48 
emb|CAJ50786.1|  rod shape-determining protein [Bordetella avi...   194    2e-48
ref|YP_241790.1|  rod shape-determining protein [Xanthomonas c...   194    2e-48 
ref|NP_289818.1|  regulator of ftsI, penicillin binding protei...   194    2e-48 
ref|NP_638816.1|  rod shape-determining protein [Xanthomonas c...   194    2e-48 
ref|NP_838753.1|  regulator of ftsI, penicillin binding protei...   194    2e-48 
ref|YP_283345.1|  Cell shape determining protein MreB/Mrl [Dec...   194    2e-48 
ref|YP_218299.1|  Rod shape-determining protein mreB [Salmonel...   194    2e-48 
ref|YP_106814.1|  putative rod shape-determining protein [Burk...   194    2e-48 
gb|EDK87433.1|  rod shape-determining protein MreB [Burkholder...   194    2e-48
ref|YP_001406901.1|  rod shape-determining protein MreB [Campy...   194    2e-48 
ref|YP_001629030.1|  rod shape-determining protein MreB [Borde...   194    2e-48 
ref|YP_314018.1|  Cell shape determining protein MreB/Mrl [Thi...   194    2e-48 
ref|ZP_01645443.1|  cell shape determining protein, MreB/Mrl f...   193    2e-48
ref|YP_202609.1|  rod shape-determining protein [Xanthomonas o...   193    2e-48 
ref|NP_879246.1|  rod shape-determining protein [Bordetella pe...   193    3e-48 
ref|NP_457750.1|  rod shape-determining protein [Salmonella en...   193    3e-48 
ref|YP_154773.1|  Actin-like ATPase [Idiomarina loihiensis L2T...   193    3e-48 
ref|YP_001251749.1|  hypothetical protein LPC_2484 [Legionella...   193    3e-48 
ref|ZP_02669983.1|  Rod shape-determining protein mreB [Salmon...   193    3e-48
ref|YP_942558.1|  cell shape determining protein, MreB/Mrl fam...   193    3e-48 
ref|YP_362448.1|  Rod shape-determining protein [Xanthomonas c...   193    3e-48 
ref|YP_001156796.1|  cell shape determining protein, MreB/Mrl ...   193    4e-48 
ref|YP_741014.1|  rod shape-determining protein MreB [Alkalili...   192    4e-48 
ref|YP_547085.1|  cell shape determining protein, MreB/Mrl fam...   192    5e-48 
ref|ZP_01125831.1|  penicillin binding protein 3 [Nitrococcus ...   192    5e-48
ref|NP_906326.1|  PUTATIVE ROD SHAPE-DETERMINING PROTEIN [Woli...   192    5e-48 
ref|ZP_00651172.1|  Cell shape determining protein MreB/Mrl [X...   192    6e-48
ref|ZP_01914188.1|  rod shape-determining protein MreB [Limnob...   192    6e-48
ref|NP_778781.1|  rod shape-determining protein [Xylella fasti...   192    6e-48 
ref|NP_871604.1|  hypothetical protein WGLp601 [Wigglesworthia...   192    6e-48 
ref|YP_452777.1|  rod shape-determining protein [Xanthomonas o...   192    6e-48 
ref|NP_760362.1|  Actin-like ATPase involved in cell morphogen...   192    6e-48 
ref|YP_994081.1|  rod shape-determining protein MreB [Burkhold...   192    7e-48 
ref|ZP_01449346.1|  rod shape-determining protein MreB [alpha ...   192    7e-48
ref|YP_393977.1|  Cell shape determining protein MreB/Mrl [Sul...   191    9e-48 
ref|YP_010010.1|  rod shape-determining protein MreB [Desulfov...   191    9e-48 
ref|NP_298598.1|  rod shape-determining protein [Xylella fasti...   191    9e-48 
gb|AAA83891.1|  unknown protein                                     191    9e-48
ref|YP_087782.1|  MreB protein [Mannheimia succiniciproducens ...   191    1e-47 
ref|ZP_02209738.1|  cell shape determining protein, MreB/Mrl f...   191    1e-47
ref|NP_518180.1|  PROBABLE ROD SHAPE-DETERMINING PROTEIN [Rals...   191    1e-47 
ref|YP_582206.1|  cell shape determining protein, MreB/Mrl fam...   191    1e-47 
ref|ZP_01223670.1|  rod shape-determining protein MreB [marine...   191    1e-47
ref|YP_001491096.1|  rod shape-determining protein MreB [Arcob...   191    1e-47 
ref|ZP_01317641.1|  hypothetical protein Bpse1_03002984 [Burkh...   191    1e-47
ref|ZP_01339138.1|  hypothetical protein Bmal2_03003096 [Burkh...   191    1e-47
ref|YP_294302.1|  Cell shape determining protein MreB/Mrl [Ral...   191    1e-47 
ref|ZP_01661259.1|  putative rod shape-determining protein [Ra...   191    2e-47
ref|ZP_01235982.1|  putative MreB, Actin-like ATPase involved ...   191    2e-47
ref|ZP_01220982.1|  putative MreB, Actin-like ATPase involved ...   191    2e-47
ref|ZP_01161708.1|  putative MreB, Actin-like ATPase involved ...   190    2e-47
ref|YP_131378.1|  putative MreB, Actin-like ATPase involved in...   190    2e-47 
ref|ZP_02563384.1|  Rod shape-determining protein mreB [Salmon...   190    2e-47
ref|NP_842080.1|  Heat shock protein hsp70:Cell shape determin...   190    2e-47 
ref|ZP_01776154.1|  cell shape determining protein, MreB/Mrl f...   190    3e-47
ref|ZP_01314111.1|  cell shape determining protein, MreB/Mrl f...   190    3e-47
ref|ZP_01291023.1|  Cell shape determining protein MreB/Mrl [d...   189    3e-47
ref|YP_001628793.1|  rod shape-determining protein MreB [Borde...   189    3e-47 
ref|ZP_01069699.1|  cell shape-determining protein MreB [Campy...   189    4e-47
ref|YP_178345.1|  cell shape-determining protein MreB [Campylo...   189    4e-47 
ref|ZP_01067795.1|  cell shape-determining protein MreB [Campy...   189    4e-47
ref|YP_588527.1|  Rod shape-determining protein mreB [Baumanni...   189    4e-47 
ref|ZP_00371462.1|  rod shape-determining protein (mreB) [Camp...   189    4e-47
ref|YP_001398675.1|  cell shape-determining protein MreB [Camp...   189    4e-47 
ref|YP_719339.1|  rod shape-determining protein [Haemophilus s...   189    5e-47 
ref|YP_594769.1|  Actin-like ATPase involved in cell morphogen...   189    6e-47 
gb|AAF22467.1|AF063934_1  rod shape determining protein MreB [...   189    6e-47
ref|YP_001260998.1|  cell shape determining protein, MreB/Mrl ...   189    6e-47 
ref|YP_001561385.1|  cell shape determining protein, MreB/Mrl ...   189    6e-47 
ref|ZP_00367530.1|  rod shape-determining protein (mreB) [Camp...   189    7e-47
ref|YP_747801.1|  cell shape determining protein, MreB/Mrl fam...   188    7e-47 
ref|YP_387492.1|  cell shape determining protein, MreB/Mrl fam...   188    1e-46 
ref|YP_001613047.1|  rod shape-determining protein MreB [Soran...   188    1e-46 
ref|YP_553938.1|  Cell shape determining protein MreB/Mrl [Bur...   187    1e-46 
ref|ZP_01215934.1|  rod shape-determining protein MreB [Psychr...   187    1e-46
ref|ZP_02477366.1|  rod shape-determining protein MreB [Haemop...   187    1e-46
ref|YP_903243.1|  cell shape determining protein, MreB/Mrl fam...   187    1e-46 
ref|ZP_01551642.1|  cell wall structural complex MreBCD, actin...   187    2e-46
ref|YP_616673.1|  cell shape determining protein, MreB/Mrl fam...   187    2e-46 
ref|YP_001345196.1|  cell shape determining protein, MreB/Mrl ...   187    2e-46 
ref|ZP_01506531.1|  cell shape determining protein, MreB/Mrl f...   187    2e-46
ref|ZP_00134716.1|  COG1077: Actin-like ATPase involved in cel...   187    2e-46
ref|YP_001407542.1|  Rod shape-determining protein MreB [Campy...   187    2e-46 
ref|YP_458047.1|  ATPase [Erythrobacter litoralis HTCC2594] >g...   187    2e-46 
ref|NP_782636.1|  rod shape-determining protein mreB [Clostrid...   187    3e-46 
ref|NP_281470.1|  homolog of E. coli rod shape-determining pro...   187    3e-46 
ref|YP_064816.1|  rod shape-determining protein (MreB) [Desulf...   187    3e-46 
ref|NP_967220.1|  rod shape-determining protein mreB [Bdellovi...   187    3e-46 
ref|YP_634906.1|  rod shape-determining protein MreB [Myxococc...   187    3e-46 
ref|YP_001467558.1|  cell shape determining protein, MreB/Mrl ...   186    3e-46 
ref|ZP_00369353.1|  cell shape determining protein, MreB/Mrl f...   186    3e-46
ref|NP_246894.1|  MreB [Pasteurella multocida subsp. multocida...   186    3e-46 
ref|ZP_01190047.1|  Cell shape determining protein MreB/Mrl [H...   186    3e-46
ref|YP_001528479.1|  cell shape determining protein, MreB/Mrl ...   186    3e-46 
ref|NP_347874.1|  mreB [Clostridium acetobutylicum ATCC 824] >...   186    3e-46 
emb|CAO85719.1|  putative rod shape-determining protein mreB [...   186    3e-46
ref|ZP_02250999.1|  cell shape determining protein, MreB/Mrl f...   186    3e-46
gb|ABF22353.1|  MreB [Vibrio splendidus]                            186    4e-46
gb|ABK58922.1|  rod shaping protein MreB [Vibrio mediterranei]      186    4e-46
gb|ABK58913.1|  rod shaping protein MreB [Vibrio parahaemolyti...   186    5e-46
gb|ABK58919.1|  rod shaping protein MreB [Vibrio rumoiensis]        186    5e-46
ref|ZP_01302913.1|  ATPase [Sphingomonas sp. SKA58] >gb|EAT091...   186    6e-46
ref|NP_820454.1|  rod shape-determining protein MreB [Coxiella...   186    6e-46 
gb|EDN74180.1|  rod shape-determining protein MreB [Mannheimia...   186    6e-46
ref|NP_860715.1|  rod shape-determining protein MreB [Helicoba...   186    6e-46 
ref|YP_891519.1|  rod shape-determining protein MreB [Campylob...   185    7e-46 
ref|YP_460669.1|  rod shape-determining protein [Syntrophus ac...   185    7e-46 
gb|ABK58903.1|  rod shaping protein MreB [Vibrio mimicus]           185    7e-46
gb|AAC21715.1|  rod shape-determining protein (mreB) [Haemophi...   185    7e-46 
ref|YP_247700.1|  rod shape-determining protein MreB [Haemophi...   185    8e-46 
gb|ABK58924.1|  rod shaping protein MreB [Vibrio tapetis]           185    8e-46
gb|ABK58886.1|  rod shaping protein MreB [Vibrio diazotrophicus]    185    8e-46
ref|ZP_01784904.1|  rod shape-determining protein MreB [Haemop...   185    9e-46
ref|YP_463326.1|  rod shape-determining protein MreB [Anaeromy...   185    9e-46 
ref|NP_438210.2|  rod shape-determining protein [Haemophilus i...   185    1e-45 
ref|ZP_02172283.1|  cell shape determining protein, MreB/Mrl f...   185    1e-45
ref|ZP_01795277.1|  rod shape-determining protein MreB [Haemop...   185    1e-45
ref|ZP_00157544.2|  COG1077: Actin-like ATPase involved in cel...   184    1e-45
ref|YP_505349.1|  rod shape-determining protein MreB [Anaplasm...   184    1e-45 
gb|ABK58900.1|  rod shaping protein MreB [Vibrio logei]             184    1e-45
gb|ABK58875.1|  rod shaping protein MreB [Vibrio aestuarianus]      184    1e-45
ref|YP_872507.1|  rod shape-determining protein MreB [Acidothe...   184    1e-45 
ref|ZP_01044088.1|  Actin-like ATPase [Idiomarina baltica OS14...   184    1e-45
ref|YP_001513301.1|  cell shape determining protein, MreB/Mrl ...   184    2e-45 
gb|ABK58885.1|  rod shaping protein MreB [Vibrio coralliilyticus]   184    2e-45
ref|YP_162090.1|  ATPase [Zymomonas mobilis subsp. mobilis ZM4...   184    2e-45 
gb|ABK58912.1|  rod shaping protein MreB [Vibrio orientalis]        184    2e-45
gb|ABF22345.1|  MreB [Vibrio cyclitrophicus]                        184    2e-45
ref|YP_877767.1|  rod shape-determining protein mreB [Clostrid...   184    2e-45 
gb|ABF22349.1|  MreB [Vibrio kanaloae]                              184    2e-45
gb|ABK58929.1|  rod shaping protein MreB [Vibrio xuii]              184    2e-45
gb|ABF22352.1|  MreB [Vibrio pomeroyi]                              184    2e-45
gb|ABF22343.1|  MreB [Vibrio chagasii] >gb|ABK58890.1| rod sha...   183    2e-45
ref|YP_153802.1|  rod shape-determining protein [Anaplasma mar...   183    2e-45 
ref|ZP_01166879.1|  rod shape-determining protein MreB [Oceano...   183    3e-45
gb|ABK58896.1|  rod shaping protein MreB [Vibrio harveyi] >gb|...   183    3e-45
ref|ZP_02622208.1|  Rod shape-determining protein MreB [Clostr...   183    3e-45
ref|YP_271209.1|  rod shape-determining protein MreB [Colwelli...   182    4e-45 
gb|ABK58911.1|  rod shaping protein MreB [Vibrio ordalii]           182    4e-45
gb|ABK58906.1|  rod shaping protein MreB [Vibrio navarrensis]       182    4e-45
ref|ZP_02323849.1|  cell shape determining protein, MreB/Mrl f...   182    4e-45
ref|ZP_01810656.1|  rod shape-determining protein [Campylobact...   182    5e-45
ref|NP_208164.1|  rod shape-determining protein (mreB) [Helico...   182    5e-45 
gb|AAC04558.1|  rod shape-determining protein [Helicobacter py...   182    5e-45
ref|YP_473850.1|  rod shape-determining protein [Synechococcus...   182    5e-45 
ref|YP_628059.1|  rod shape-determining protein [Helicobacter ...   182    6e-45 
ref|NP_224005.1|  ROD SHAPE-DETERMINING PROTEIN [Helicobacter ...   182    6e-45 
ref|ZP_01039641.1|  ATPase [Erythrobacter sp. NAP1] >gb|EAQ301...   182    6e-45
ref|YP_846705.1|  cell shape determining protein, MreB/Mrl fam...   182    6e-45 
gb|ABF22351.1|  MreB [Vibrio lentus]                                182    6e-45
gb|ABK58889.1|  rod shaping protein MreB [Vibrio fluvialis]         182    7e-45
gb|ABF22347.1|  MreB [Vibrio cyclitrophicus] >gb|ABF22348.1| M...   182    7e-45
ref|YP_001509533.1|  cell shape determining protein, MreB/Mrl ...   182    7e-45 
gb|ABF22350.1|  MreB [Vibrio kanaloae]                              182    7e-45
gb|ABK58915.1|  rod shaping protein MreB [Listonella pelagia]       182    7e-45
ref|YP_480318.1|  cell shape determining protein, MreB/Mrl fam...   182    8e-45 
ref|NP_873725.1|  rod shape-determining protein MreB [Haemophi...   182    8e-45 
gb|ABK58876.1|  rod shaping protein MreB [Vibrio agarivorans]       182    8e-45
gb|ABK58878.1|  rod shaping protein MreB [Vibrio alginolyticus]     181    9e-45
gb|ABZ92970.1|  Actin-like ATPase involved in cell morphogenes...   181    9e-45
gb|ABK58908.1|  rod shaping protein MreB [Vibrio neptunius]         181    1e-44
gb|ABK58925.1|  rod shaping protein MreB [Vibrio harveyi]           181    1e-44
ref|YP_478688.1|  rod shape-determining protein [Synechococcus...   181    1e-44 
ref|ZP_01862793.1|  ATPase [Erythrobacter sp. SD-21] >gb|EDL50...   181    1e-44
gb|ABK58904.1|  rod shaping protein MreB [Vibrio mytili]            181    1e-44
gb|ABK58882.1|  rod shaping protein MreB [Vibrio cholerae]          181    1e-44
ref|YP_321979.1|  Cell shape determining protein MreB/Mrl [Ana...   181    1e-44 
ref|YP_798323.1|  Actin-like ATPase involved in cell morphogen...   181    1e-44 
ref|NP_712940.1|  rod shape-determining protein mreB [Leptospi...   181    1e-44 
ref|YP_497401.1|  cell shape determining protein, MreB/Mrl fam...   181    1e-44 
gb|ABK58883.1|  rod shaping protein MreB [Vibrio cholerae]          181    1e-44
gb|ABK58902.1|  rod shaping protein MreB [Vibrio metschnikovii]     181    1e-44
gb|ABK58884.1|  rod shaping protein MreB [Vibrio cincinnatiensis]   181    1e-44
gb|ABK58888.1|  rod shaping protein MreB [Vibrio fischeri]          181    1e-44
ref|YP_001180642.1|  cell shape determining protein, MreB/Mrl ...   181    2e-44 
gb|ABK58879.1|  rod shaping protein MreB [Listonella anguillarum]   181    2e-44
ref|NP_826632.1|  rod shape-determining protein [Streptomyces ...   181    2e-44 
gb|ABK58891.1|  rod shaping protein MreB [Vibrio furnissii]         180    2e-44
ref|YP_996386.1|  cell shape determining protein, MreB/Mrl fam...   180    2e-44 
ref|YP_001717604.1|  cell shape determining protein, MreB/Mrl ...   180    2e-44 
ref|YP_924652.1|  cell shape determining protein, MreB/Mrl fam...   180    2e-44 
ref|YP_699419.1|  rod shape-determining protein MreB [Clostrid...   180    3e-44 
ref|YP_197987.1|  Actin-like ATPase involved in cell morphogen...   180    3e-44 
gb|ABL09821.1|  MreB [Vibrio gigantis]                              180    3e-44
ref|NP_484131.1|  rod shape-determining protein [Nostoc sp. PC...   180    3e-44 
gb|ABK58901.1|  rod shaping protein MreB [Vibrio mediterranei]      180    3e-44
ref|NP_626848.1|  rod shape-determining protein [Streptomyces ...   180    3e-44 
ref|YP_537301.1|  Rod shape-determining protein MreB [Ricketts...   180    3e-44 
ref|ZP_02614156.1|  rod shape-determining protein MreB [Clostr...   180    3e-44
gb|ABK58897.1|  rod shaping protein MreB [Vibrio hepatarius]        179    3e-44
ref|YP_001255494.1|  rod shape-determining protein [Clostridiu...   179    3e-44 
gb|ABF22354.1|  MreB [Vibrio tasmaniensis]                          179    3e-44
gb|EAY58166.1|  Actin-like ATPase involved in cell morphogenes...   179    4e-44
gb|ABK58899.1|  rod shaping protein MreB [Vibrio ichthyoenteri...   179    4e-44
ref|ZP_02616351.1|  rod shape-determining protein MreB [Clostr...   179    4e-44
ref|YP_001290435.1|  rod shape-determining protein MreB [Haemo...   179    4e-44 
gb|ABK58905.1|  rod shaping protein MreB [Vibrio natriegens]        179    4e-44
ref|NP_563059.1|  rod shape-determining protein [Clostridium p...   179    4e-44 
ref|NP_966969.1|  rod shape-determining protein MreB [Wolbachi...   179    4e-44 
ref|YP_663926.1|  rod shape-determining protein MreB [Helicoba...   179    4e-44 
ref|YP_001377319.1|  cell shape determining protein, MreB/Mrl ...   179    5e-44 
gb|ABK58914.1|  rod shaping protein MreB [Vibrio pectenicida]       179    5e-44
ref|YP_980419.1|  cell shape determining protein, MreB/Mrl fam...   179    6e-44 
ref|YP_984569.1|  cell shape determining protein, MreB/Mrl fam...   179    6e-44 
ref|NP_221120.1|  ROD SHAPE-DETERMINING PROTEIN MREB (mreB) [R...   179    6e-44 
ref|ZP_01520517.1|  cell shape determining protein, MreB/Mrl f...   179    7e-44
ref|ZP_02533420.1|  rod shape-determining protein MreB [Endori...   178    8e-44
ref|YP_712148.1|  Rod shape-determining protein [Frankia alni ...   178    8e-44 
ref|ZP_02851859.1|  cell shape determining protein, MreB/Mrl f...   178    8e-44
ref|ZP_02079789.1|  hypothetical protein CLOLEP_01234 [Clostri...   178    8e-44
ref|ZP_02172284.1|  cell shape determining protein, MreB/Mrl f...   178    9e-44
ref|YP_463327.1|  rod shape-determining protein MreB [Anaeromy...   178    9e-44 
ref|YP_001113883.1|  cell shape determining protein, MreB/Mrl ...   178    9e-44 
ref|YP_720985.1|  cell shape determining protein, MreB/Mrl fam...   178    1e-43 
ref|YP_001492688.1|  Rod shape-determining protein MreB [Ricke...   178    1e-43 
ref|YP_067694.1|  rod shape-determining protein [Rickettsia ty...   178    1e-43 
ref|YP_247248.1|  Rod shape-determining protein MreB [Ricketts...   178    1e-43 
dbj|BAG13594.1|  rod shape-determining protein MreB [unculture...   178    1e-43
ref|NP_681728.1|  rod shape-determining protein [Thermosynecho...   178    1e-43 
ref|YP_968675.1|  cell shape determining protein, MreB/Mrl fam...   177    2e-43 
gb|ABK58917.1|  rod shaping protein MreB [Vibrio proteolyticus]     177    2e-43
gb|ABK58881.1|  rod shaping protein MreB [Vibrio campbellii]        177    2e-43
ref|YP_001039012.1|  cell shape determining protein, MreB/Mrl ...   177    2e-43 
gb|ABK58927.1|  rod shaping protein MreB [Vibrio vulnificus]        177    2e-43
gb|AAX14410.1|  rod shape-determining protein MreB [Wolbachia ...   177    2e-43
gb|ABK58877.1|  rod shaping protein MreB [Vibrio cholerae]          177    2e-43
ref|ZP_02134291.1|  cell shape determining protein, MreB/Mrl f...   177    2e-43
ref|ZP_02337017.1|  rod shape-determining protein [Rickettsia ...   177    3e-43
ref|NP_360835.1|  rod shape-determining protein mreB [Ricketts...   177    3e-43 
ref|YP_001499743.1|  Rod shape-determining protein MreB [Ricke...   177    3e-43 
ref|ZP_00142688.1|  rod shape-determining protein mreB [Ricket...   177    3e-43
ref|YP_001712666.1|  rod shape-determining protein [Acinetobac...   176    3e-43 
ref|YP_045549.1|  rod shape-determining protein [Acinetobacter...   176    4e-43 
ref|YP_001127359.1|  MreB-like protein [Geobacillus thermodeni...   176    5e-43 
ref|ZP_02211881.1|  hypothetical protein CLOBAR_01497 [Clostri...   176    5e-43
ref|YP_149186.1|  cell shape determining protein (MreB-like pr...   176    5e-43 
ref|YP_001519470.1|  cell shape determining protein, MreB/Mrl ...   176    6e-43 
ref|YP_001493941.1|  Rod shape-determining protein MreB [Ricke...   176    6e-43 
ref|ZP_02692814.1|  cell shape determining protein, MreB/Mrl f...   175    7e-43
ref|YP_001394265.1|  MreB-like protein [Clostridium kluyveri D...   175    7e-43 
ref|YP_519412.1|  hypothetical protein DSY3179 [Desulfitobacte...   175    7e-43 
ref|ZP_00734465.1|  COG1077: Actin-like ATPase involved in cel...   175    8e-43
ref|YP_001036522.1|  cell shape determining protein, MreB/Mrl ...   175    9e-43 
ref|YP_391896.1|  cell shape determining protein, MreB/Mrl fam...   175    9e-43 
gb|ABK58874.1|  rod shaping protein MreB [Vibrio aerogenes]         175    1e-42
ref|ZP_01575843.1|  cell shape determining protein, MreB/Mrl f...   175    1e-42
gb|ABL09822.1|  MreB [Vibrio gigantis]                              175    1e-42
ref|YP_001087637.1|  rod shape-determining protein [Clostridiu...   174    1e-42 
ref|NP_927345.1|  rod shape-determining protein [Gloeobacter v...   174    1e-42 
ref|YP_001706284.1|  rod shape-determining protein [Acinetobac...   174    2e-42 
ref|ZP_01665917.1|  cell shape determining protein, MreB/Mrl f...   174    2e-42
ref|ZP_01666753.1|  cell shape determining protein, MreB/Mrl f...   174    2e-42
ref|YP_388485.1|  cell shape determining protein, MreB/Mrl fam...   173    3e-42 
gb|ABK58867.1|  rod shaping protein MreB [Photobacterium phosp...   173    3e-42
ref|ZP_01725530.1|  cell shape determining protein [Bacillus s...   173    4e-42
gb|ABK58892.1|  rod shaping protein MreB [Vibrio gallicus]          172    4e-42
gb|ABK58910.1|  rod shaping protein MreB [Vibrio nigripulchrit...   172    4e-42
ref|NP_349461.1|  Shape-determining protein envB (HSP70 family...   172    5e-42 
ref|YP_878989.1|  cell shape determining protein, MreB/Mrl fam...   172    5e-42 
ref|ZP_01620320.1|  rod shape-determining protein [Lyngbya sp....   172    8e-42
ref|ZP_01573996.1|  cell shape determining protein, MreB/Mrl f...   172    8e-42
ref|ZP_02328248.1|  MreB-like protein (mbl protein); possible ...   172    9e-42
ref|YP_754311.1|  cell shape determining protein, MreB/Mrl fam...   172    9e-42 
gb|ABK58895.1|  rod shaping protein MreB [Vibrio harveyi]           171    1e-41
emb|CAB05381.1|  MreB like protein [Bacillus subtilis]              171    1e-41
ref|ZP_02620574.2|  Rod shape-determining protein MreB [Clostr...   171    1e-41
ref|YP_001422921.1|  Mbl [Bacillus amyloliquefaciens FZB42] >g...   171    1e-41 
ref|NP_391522.2|  MreB-like protein [Bacillus subtilis subsp. ...   171    1e-41 
ref|YP_617054.1|  cell shape determining protein, MreB/Mrl fam...   171    1e-41 
ref|ZP_01995754.1|  hypothetical protein DORLON_01749 [Dorea l...   171    1e-41
ref|YP_001376983.1|  cell shape determining protein, MreB/Mrl ...   171    1e-41 
ref|YP_080954.1|  MreB-like protein [Bacillus licheniformis AT...   171    2e-41 
ref|YP_001307635.1|  cell shape determining protein, MreB/Mrl ...   171    2e-41 
ref|YP_001734772.1|  cell shape determining protein, MreB/Mrl ...   171    2e-41 
ref|YP_001679471.1|  cell shape determining protein, mreb/mrl ...   170    2e-41 
ref|ZP_02745076.1|  rod shape-determining protein [Clostridium...   170    2e-41
ref|NP_924413.1|  cell-shape determining protein MreB homolog ...   170    2e-41 
ref|ZP_02624025.1|  cell shape determining protein, MreB/Mrl f...   170    3e-41
gb|ABV28354.1|  Mbl [Bacillus mycoides]                             170    3e-41
ref|ZP_02432139.1|  hypothetical protein CLOSCI_02384 [Clostri...   170    3e-41
ref|YP_001661767.1|  cell shape determining protein, MreB/Mrl ...   170    3e-41 
ref|YP_001213349.1|  actin-like ATPase [Pelotomaculum thermopr...   170    3e-41 
ref|YP_001647851.1|  cell shape determining protein, MreB/Mrl ...   170    3e-41 
gb|ABK58909.1|  rod shaping protein MreB [Vibrio nereis]            169    3e-41
ref|ZP_01967329.1|  hypothetical protein RUMTOR_00876 [Ruminoc...   169    3e-41
ref|NP_621868.1|  HSP70 class molecular chaperones involved in...   169    4e-41 
ref|ZP_02525824.1|  mbl protein [Bacillus cereus AH1134] >ref|...   169    4e-41
gb|ABK58858.1|  rod shaping protein MreB [Photobacterium angus...   169    4e-41
ref|ZP_02012523.1|  cell shape determining protein, MreB/Mrl f...   169    4e-41
ref|ZP_02233367.1|  hypothetical protein DORFOR_00199 [Dorea f...   169    4e-41
ref|YP_001179410.1|  cell shape determining protein, MreB/Mrl ...   169    4e-41 
ref|ZP_02597580.1|  mbl protein [Bacillus cereus H3081.97]          169    4e-41
ref|YP_897474.1|  rod shape-determining protein MreB [Bacillus...   169    4e-41 
ref|YP_001318254.1|  cell shape determining protein, MreB/Mrl ...   169    5e-41 
ref|ZP_02042739.1|  hypothetical protein RUMGNA_03543 [Ruminoc...   169    5e-41
ref|YP_001264506.1|  cell shape determining protein, MreB/Mrl ...   169    5e-41 
ref|ZP_02394668.1|  mbl protein [Bacillus anthracis str. A0442...   169    5e-41
ref|YP_039271.1|  MreB-like protein (mbl protein); possible ro...   169    5e-41 
ref|NP_847679.1|  mbl protein [Bacillus anthracis str. Ames] >...   169    5e-41 
ref|ZP_01168557.1|  MreB-like protein [Bacillus sp. NRRL B-149...   169    5e-41
ref|NP_981696.1|  mbl protein [Bacillus cereus ATCC 10987] >re...   169    5e-41 
ref|ZP_00240064.1|  rod shape-determining protein MreB [Bacill...   169    5e-41
ref|ZP_02089269.1|  hypothetical protein CLOBOL_06838 [Clostri...   169    6e-41
gb|ABV28353.1|  Mbl [Bacillus mycoides]                             169    6e-41
ref|YP_644303.1|  cell shape determining protein, MreB/Mrl fam...   169    6e-41 
ref|YP_001086596.1|  rod shape-determining protein [Clostridiu...   169    7e-41 
ref|YP_074201.1|  cell shape determining protein [Symbiobacter...   168    9e-41 
ref|YP_001488503.1|  rod shape-determining protein Mbl [Bacill...   168    1e-40 
ref|ZP_01861852.1|  Mbl [Bacillus sp. SG-1] >gb|EDL63081.1| Mb...   168    1e-40
ref|ZP_02115311.1|  cell shape determining protein, MreB/Mrl f...   168    1e-40
ref|NP_834944.1|  Rod shape-determining protein mreB [Bacillus...   168    1e-40 
ref|NP_693880.1|  cell shape determining protein [Oceanobacill...   168    1e-40 
ref|ZP_01188588.1|  Cell shape determining protein MreB/Mrl [H...   168    1e-40
ref|YP_001666053.1|  cell shape determining protein, MreB/Mrl ...   167    1e-40 
ref|NP_244606.1|  cell shape determining protein (MreB-like pr...   167    2e-40 
gb|ABO38661.1|  rod shaping protein MreB [Vibrio ruber]             167    2e-40
ref|YP_001252710.1|  rod shape-determining protein [Clostridiu...   167    2e-40 
ref|YP_171922.1|  rod shape-determining protein MreB [Synechoc...   167    2e-40 
ref|ZP_00107797.2|  COG1077: Actin-like ATPase involved in cel...   167    3e-40
ref|YP_073933.1|  cell shape determining protein [Symbiobacter...   166    3e-40 
ref|YP_001514078.1|  cell shape determining protein, MreB/Mrl ...   166    4e-40 
ref|ZP_02091212.1|  hypothetical protein FAEPRAM212_01483 [Fae...   166    4e-40
ref|ZP_02444531.1|  hypothetical protein ANACOL_03856 [Anaerot...   166    4e-40
ref|YP_010899.1|  rod shape-determining protein MreB [Desulfov...   166    4e-40 
gb|ABK58861.1|  rod shaping protein MreB [Photobacterium damse...   166    4e-40
ref|ZP_02037909.1|  hypothetical protein BACCAP_03528 [Bactero...   166    4e-40
ref|ZP_01696887.1|  cell shape determining protein, MreB/Mrl f...   166    5e-40
gb|ABK58859.1|  rod shaping protein MreB [Photobacterium damse...   166    5e-40
ref|YP_755034.1|  cell shape determining protein, MreB/Mrl fam...   166    5e-40 
gb|ABK58866.1|  rod shaping protein MreB [Photobacterium phosp...   166    5e-40
ref|ZP_02026629.1|  hypothetical protein EUBVEN_01892 [Eubacte...   166    6e-40
ref|YP_001389526.1|  mbl protein [Clostridium botulinum F str....   165    7e-40 
ref|YP_001307569.1|  cell shape determining protein, MreB/Mrl ...   165    7e-40 
ref|ZP_02616891.1|  mbl protein [Clostridium botulinum Bf]          165    8e-40
ref|YP_579745.1|  cell shape determining protein, MreB/Mrl fam...   165    1e-39 
ref|ZP_02848386.1|  cell shape determining protein, MreB/Mrl f...   164    1e-39
ref|ZP_02625026.1|  cell shape determining protein, MreB/Mrl f...   164    1e-39
emb|CAO86632.1|  mreB [Microcystis aeruginosa PCC 7806] >emb|C...   164    1e-39
ref|YP_825066.1|  cell shape determining protein, MreB/Mrl fam...   164    1e-39 
ref|ZP_00993376.1|  rod shape-determining protein [Janibacter ...   164    1e-39
ref|YP_431196.1|  cell shape determining protein, MreB/Mrl fam...   164    1e-39 
ref|YP_001223895.1|  Rod shape-determining protein MreB [Synec...   164    2e-39 
ref|ZP_01471659.1|  Rod shape determining protein [Synechococc...   164    2e-39
ref|ZP_01123730.1|  cell shape determining protein, MreB/Mrl f...   164    2e-39
ref|YP_001209856.1|  rod shape-determining protein MreB [Diche...   164    2e-39 
ref|YP_001012125.1|  Rod shape determining protein [Prochloroc...   164    2e-39 
ref|YP_903987.1|  cell shape determining protein, MreB/Mrl fam...   164    2e-39 
ref|ZP_02169429.1|  ATP synthase F1, alpha subunit [Bacillus s...   164    2e-39
ref|YP_001397037.1|  MreB/Mbl protein [Clostridium kluyveri DS...   164    2e-39 
emb|CAA74597.1|  merB [Streptomyces coelicolor A3(2)]               164    2e-39
ref|YP_729348.1|  Rod shape determining protein [Synechococcus...   163    3e-39 
ref|NP_893739.1|  Rod shape determining protein [Prochlorococc...   163    3e-39 
ref|ZP_02206247.1|  hypothetical protein COPEUT_01009 [Coproco...   163    3e-39
ref|YP_001485095.1|  Rod shape determining protein [Prochloroc...   163    3e-39 
ref|ZP_01079077.1|  Rod shape determining protein [Synechococc...   163    3e-39
ref|YP_590537.1|  rod shape-determining protein MreB [Acidobac...   163    3e-39 
ref|ZP_02074503.1|  hypothetical protein CLOL250_01273 [Clostr...   163    4e-39
ref|YP_001226365.1|  Rod shape-determining protein MreB [Synec...   163    4e-39 
ref|YP_001010222.1|  Rod shape determining protein [Prochloroc...   163    4e-39 
ref|YP_398212.1|  cell shape determining protein, MreB/Mrl fam...   163    4e-39 
ref|ZP_01873883.1|  rod shape-determining protein MreB [Lentis...   163    4e-39
ref|ZP_01084531.1|  Rod shape determining protein [Synechococc...   163    4e-39
ref|YP_001092038.1|  Rod shape determining protein [Prochloroc...   163    4e-39 
ref|YP_263780.1|  putative rod shape-determining protein MreB ...   163    4e-39 
ref|NP_781022.1|  rod shape-determining protein mreB [Clostrid...   162    4e-39 
ref|NP_622550.1|  HSP70 class molecular chaperones involved in...   162    4e-39 
ref|YP_001718252.1|  cell shape determining protein, MreB/Mrl ...   162    5e-39 
ref|YP_001665438.1|  cell shape determining protein, MreB/Mrl ...   162    6e-39 
ref|YP_846037.1|  cell shape determining protein, MreB/Mrl fam...   162    6e-39 
ref|YP_220272.1|  putative rod shape-determining protein [Chla...   162    6e-39 
ref|NP_829778.1|  cell shape-determining protein MreB [Chlamyd...   162    6e-39 
ref|YP_001551633.1|  Rod shape determining protein [Prochloroc...   162    7e-39 
ref|ZP_01468956.1|  Cell shape determining protein MreB/Mrl [S...   162    7e-39
ref|YP_376167.1|  Cell shape determining protein MreB/Mrl [Syn...   162    7e-39 
ref|NP_876174.1|  Actin-like ATPase [Prochlorococcus marinus s...   162    7e-39 
ref|YP_001557368.1|  cell shape determining protein, MreB/Mrl ...   162    8e-39 
gb|ABK58864.1|  rod shaping protein MreB [Photobacterium leiog...   162    8e-39
ref|ZP_02180152.1|  rod shape determining protein MreB [Hydrog...   162    9e-39
ref|YP_515014.1|  HSP70 class molecular chaperones [Chlamydoph...   162    9e-39 
ref|YP_361326.1|  Mbl protein [Carboxydothermus hydrogenoforma...   161    1e-38 
ref|YP_380436.1|  cell shape determining protein, MreB/Mrl fam...   161    1e-38 
ref|ZP_01290569.1|  Cell shape determining protein MreB/Mrl [d...   161    1e-38
ref|YP_001658921.1|  rod shape-determining protein [Microcysti...   161    1e-38 
ref|ZP_02440293.1|  hypothetical protein CLOSS21_02796 [Clostr...   161    1e-38
ref|NP_896217.1|  Rod shape determining protein [Synechococcus...   161    1e-38 
ref|NP_893975.1|  Rod shape determining protein [Prochlorococc...   161    1e-38 
ref|YP_001211367.1|  actin-like ATPase [Pelotomaculum thermopr...   161    1e-38 
ref|ZP_01773113.1|  Hypothetical protein COLAER_02144 [Collins...   161    2e-38
ref|NP_225045.1|  Rod Shape Protein-Sugar Kinase [Chlamydophil...   161    2e-38 
ref|YP_001483241.1|  Actin-like ATPase involved in cell morpho...   160    2e-38 
ref|ZP_02420393.1|  hypothetical protein ANACAC_03010 [Anaeros...   160    2e-38
ref|YP_359205.1|  cell shape-determining protein MreB [Carboxy...   160    2e-38 
ref|YP_001219556.1|  rod shape-determining protein MreB [Candi...   160    3e-38 
ref|ZP_01628705.1|  rod shape-determining protein [Nodularia s...   160    3e-38
ref|YP_001279325.1|  cell shape determining protein, MreB/Mrl ...   160    3e-38 
ref|NP_220228.1|  Rod Shape Protein-Sugar Kinase [Chlamydia tr...   160    3e-38 
ref|ZP_02848159.1|  cell shape determining protein, MreB/Mrl f...   160    3e-38
ref|NP_296466.1|  cell shape-determining protein MreB [Chlamyd...   160    3e-38 
ref|NP_471998.1|  mbl [Listeria innocua Clip11262] >emb|CAC978...   160    4e-38 
ref|ZP_02866519.1|  hypothetical protein CLOSPI_00318 [Clostri...   159    5e-38
ref|ZP_02427432.1|  hypothetical protein CLORAM_00818 [Clostri...   159    6e-38
ref|ZP_02421999.1|  hypothetical protein EUBSIR_00840 [Eubacte...   159    6e-38
ref|YP_292392.1|  Cell shape determining protein MreB/Mrl [Pro...   159    6e-38 
ref|ZP_01173550.1|  MreBH [Bacillus sp. NRRL B-14911] >gb|EAR6...   159    6e-38
ref|ZP_02277308.1|  cell shape determining protein MreB [Liste...   158    9e-38
ref|NP_470919.1|  mreB [Listeria innocua Clip11262] >emb|CAC96...   158    9e-38 
ref|NP_466048.1|  hypothetical protein lmo2525 [Listeria monoc...   158    9e-38 
ref|ZP_02279980.1|  cell shape-determining protein MreB [Liste...   158    1e-37
ref|NP_465073.1|  hypothetical protein lmo1548 [Listeria monoc...   158    1e-37 
ref|ZP_00230860.1|  cell shape determining protein MreB [Liste...   158    1e-37
ref|YP_014165.1|  cell shape determining protein MreB [Listeri...   158    1e-37 
ref|ZP_02688722.1|  mbl protein [Listeria monocytogenes FSL J2...   158    1e-37
ref|YP_148470.1|  cell-shape determining protein [Geobacillus ...   158    1e-37 
ref|NP_603655.1|  Rod shape-determining protein mreB [Fusobact...   158    1e-37 
ref|NP_834158.1|  Rod shape-determining protein mreB [Bacillus...   157    1e-37 
ref|ZP_00144117.1|  Rod shape-determining protein mreB [Fusoba...   157    1e-37
ref|NP_846898.1|  rod shape-determining protein MreB [Bacillus...   157    1e-37 
ref|YP_001376385.1|  cell shape determining protein, MreB/Mrl ...   157    1e-37 
gb|EDK89224.1|  rod shape-determining protein [Fusobacterium n...   157    2e-37
ref|ZP_02273041.1|  Rod shape-determining protein mreB [Fusoba...   157    2e-37
emb|CAO81639.1|  cell wall structural complex MreBCD, actin-li...   157    2e-37
ref|ZP_01732105.1|  rod shape-determining protein [Cyanothece ...   157    2e-37
ref|YP_001633759.1|  cell shape determining protein, MreB/Mrl ...   157    2e-37 
ref|ZP_01923282.1|  cell shape determining protein, MreB/Mrl f...   157    2e-37
ref|YP_177333.1|  cell shape determining protein [Bacillus cla...   157    2e-37 
ref|ZP_01516273.1|  cell shape determining protein, MreB/Mrl f...   157    2e-37
ref|YP_850670.1|  MreB/Mbl protein [Listeria welshimeri serova...   157    2e-37 
ref|YP_806399.1|  Actin-like ATPase for cell morphogenesis [La...   157    2e-37 
ref|ZP_02211147.1|  hypothetical protein CLOBAR_00745 [Clostri...   157    3e-37
ref|YP_535496.1|  Rod shape-determining protein [Lactobacillus...   157    3e-37 
ref|ZP_01859655.1|  MreBH [Bacillus sp. SG-1] >gb|EDL65206.1| ...   156    3e-37
ref|YP_001647085.1|  cell shape determining protein, MreB/Mrl ...   156    3e-37 
ref|NP_563096.1|  cell shape determining protein [Clostridium ...   156    4e-37 
ref|YP_699455.1|  mbl protein [Clostridium perfringens SM101] ...   156    4e-37 
ref|YP_001126637.1|  Rod shape-determining protein MreB [Geoba...   156    4e-37 
ref|ZP_02171337.1|  lysine 2,3-aminomutase YodO family protein...   156    4e-37
ref|ZP_02854205.1|  cell shape determining protein, MreB/Mrl f...   156    4e-37
ref|YP_008371.1|  probable rod shape-determining protein mreB ...   156    5e-37 
ref|ZP_02177980.1|  rod shape determining protein MreB [Hydrog...   156    5e-37
ref|ZP_02078365.1|  hypothetical protein EUBDOL_02185 [Eubacte...   155    5e-37
ref|NP_241709.1|  cell-shape determining protein [Bacillus hal...   155    6e-37 
ref|YP_696859.1|  mbl protein [Clostridium perfringens ATCC 13...   155    6e-37 
emb|CAJ72643.1|  strongly similar to cell shape-determining pr...   155    8e-37
pdb|1JCF|A  Chain A, Mreb From Thermotoga Maritima, Trigonal >...   155    9e-37 
ref|YP_001421015.1|  MreBH [Bacillus amyloliquefaciens FZB42] ...   155    1e-36 
ref|YP_176110.1|  rod shape-determining protein MreB [Bacillus...   155    1e-36 
ref|NP_228398.1|  rod shape-determining protein MreB [Thermoto...   155    1e-36 
ref|ZP_02183883.1|  cell shape determining protein [Carnobacte...   154    1e-36
ref|YP_078839.1|  cell-shape determining protein [Bacillus lic...   154    1e-36 
ref|NP_213574.1|  rod shape determining protein MreB [Aquifex ...   154    1e-36 
ref|YP_001681271.1|  cell shape determining protein, mreb/mrl ...   154    1e-36 
ref|ZP_00539289.1|  Cell shape determining protein MreB/Mrl [E...   154    2e-36
ref|YP_001431780.1|  cell shape determining protein, MreB/Mrl ...   154    2e-36 
ref|ZP_02330984.1|  cell-shape determining protein [Paenibacil...   154    2e-36
ref|YP_080076.1|  cell-shape determining protein [Bacillus lic...   154    2e-36 
ref|YP_429410.1|  cell shape determining protein, MreB/Mrl fam...   154    2e-36 
ref|NP_964817.1|  rod shape-determining protein MreB [Lactobac...   154    2e-36 
ref|YP_815022.1|  Actin-like ATPase for cell morphogenesis [La...   154    2e-36 
ref|ZP_01860286.1|  cell-shape determining protein [Bacillus s...   153    3e-36
ref|YP_001275637.1|  cell shape determining protein, MreB/Mrl ...   153    3e-36 
ref|NP_389330.1|  cell-shape determining protein [Bacillus sub...   153    4e-36 
ref|YP_001486586.1|  cell shape determining protein [Bacillus ...   153    4e-36 
ref|YP_001469953.1|  cell shape determining protein, MreB/Mrl ...   153    4e-36 
ref|NP_602393.1|  Rod shape-determining protein mreB [Fusobact...   153    4e-36 
ref|ZP_01171849.1|  cell-shape determining protein [Bacillus s...   152    5e-36
ref|YP_193694.1|  rod shape-determining protein [Lactobacillus...   152    5e-36 
ref|ZP_00143389.1|  Rod shape-determining protein mreB [Fusoba...   152    6e-36
ref|YP_806481.1|  Actin-like ATPase for cell morphogenesis [La...   152    6e-36 
ref|ZP_02272059.1|  Rod shape-determining protein mreB [Fusoba...   152    6e-36
ref|ZP_01725625.1|  cell-shape determining protein [Bacillus s...   152    7e-36
ref|NP_785826.1|  cell shape determining protein MreB [Lactoba...   152    7e-36 
ref|YP_001699555.1|  Rod shape-determining protein [Lysinibaci...   152    7e-36 
ref|NP_691787.1|  cell-shape determining protein [Oceanobacill...   152    8e-36 
ref|YP_395463.1|  Cell shape determining protein MreB, actin-l...   152    9e-36 
ref|NP_243897.1|  cell-shape determining protein [Bacillus hal...   152    9e-36 
ref|YP_817760.1|  Actin-like ATPase for cell morphogenesis [Le...   151    1e-35 
ref|ZP_02060086.1|  cell shape determining protein, MreB/Mrl f...   151    1e-35
ref|YP_001727485.1|  Actin-like ATPase involved in cell morpho...   151    1e-35 
gb|ABS00957.1|  MreB [Thermus aquaticus]                            151    1e-35
ref|ZP_00372716.1|  rod shape-determining protein MreB [Wolbac...   151    2e-35
ref|NP_390681.1|  cell-shape determining protein [Bacillus sub...   151    2e-35 
gb|AAA22605.1|  putative                                            150    2e-35
ref|YP_001422099.1|  MreB [Bacillus amyloliquefaciens FZB42] >...   150    2e-35 
ref|YP_521119.1|  hypothetical protein DSY4886 [Desulfitobacte...   150    2e-35 
ref|YP_001547536.1|  cell shape determining protein, MreB/Mrl ...   150    2e-35 
ref|YP_001114471.1|  cell shape determining protein, MreB/Mrl ...   150    2e-35 
ref|YP_828792.1|  cell shape determining protein, MreB/Mrl fam...   150    2e-35 
gb|ABK58920.1|  rod shaping protein MreB [Vibrio salmonicida]       150    3e-35
ref|YP_815042.1|  Actin-like ATPase for cell morphogenesis [La...   150    3e-35 
ref|NP_964798.1|  MreB-like protein [Lactobacillus johnsonii N...   150    3e-35 
ref|YP_618795.1|  Cell-shape-determining protein MreB [Lactoba...   150    3e-35 
ref|YP_001487666.1|  cell-shape determining protein [Bacillus ...   150    3e-35 
ref|YP_001636627.1|  cell shape determining protein, MreB/Mrl ...   150    3e-35 
ref|ZP_01274444.1|  Cell division protein FtsA:Cell shape dete...   149    5e-35
ref|NP_971955.1|  rod shape-determining protein MreB [Treponem...   149    5e-35 
ref|YP_174771.1|  cell-shape determining protein [Bacillus cla...   148    9e-35 
ref|NP_212849.1|  rod shape-determining protein (mreB-1) [Borr...   148    9e-35 
ref|YP_710163.1|  rod shape-determining protein [Borrelia afze...   148    9e-35 
ref|ZP_02368575.1|  rod shape-determining protein [Borrelia va...   148    1e-34
ref|YP_073155.1|  rod shape-determining protein [Borrelia gari...   148    1e-34 
ref|ZP_01514666.1|  cell shape determining protein, MreB/Mrl f...   147    1e-34
pdb|1JCE|A  Chain A, Mreb From Thermotoga Maritima                  147    2e-34 
ref|YP_795411.1|  Actin-like ATPase for cell morphogenesis [La...   147    2e-34 
ref|YP_795386.1|  Actin-like ATPase for cell morphogenesis [La...   147    2e-34 
ref|NP_968612.1|  rod shape-determining protein [Bdellovibrio ...   147    2e-34 
ref|ZP_00538431.1|  Cell shape determining protein MreB/Mrl [E...   147    3e-34
ref|YP_001577233.1|  Cell shape determining protein [Lactobaci...   147    3e-34 
ref|YP_193677.1|  cell shape determining protein [Lactobacillu...   147    3e-34 
ref|NP_692974.1|  rod shape-determining protein [Oceanobacillu...   146    4e-34 
ref|ZP_01697148.1|  cell shape determining protein, MreB/Mrl f...   146    5e-34
ref|YP_001410998.1|  cell shape determining protein, MreB/Mrl ...   145    5e-34 
ref|NP_229344.1|  rod shape-determining protein MreB [Thermoto...   145    6e-34 
gb|ABK58873.1|  rod shaping protein MreB [Salinivibrio costico...   145    7e-34
ref|YP_618778.1|  Cell-shape-determining protein MreB [Lactoba...   145    7e-34 
ref|YP_395731.1|  Cell shape determining protein, MerB family ...   145    9e-34 
ref|YP_001568446.1|  cell shape determining protein, MreB/Mrl ...   145    1e-33 
ref|ZP_01997940.1|  MreB/Mbl protein [Beggiatoa sp. SS] >gb|ED...   145    1e-33
ref|NP_218938.1|  rod shape-determining protein (mreB) [Trepon...   144    1e-33 
ref|YP_818060.1|  Actin-like ATPase for cell morphogenesis [Le...   144    1e-33 
ref|YP_001728544.1|  Actin-like ATPase involved in cell morpho...   144    2e-33 
ref|NP_785793.1|  cell shape determining protein MreB [Lactoba...   144    2e-33 
gb|ABK58893.1|  rod shaping protein MreB [Vibrio gazogenes]         144    2e-33
gb|ABK58868.1|  rod shaping protein MreB [Photobacterium rosen...   144    2e-33
ref|ZP_02406038.1|  cell shape determining protein, MreB/Mrl f...   143    3e-33
gb|ABK58865.1|  rod shaping protein MreB [Photobacterium lipol...   143    3e-33
ref|ZP_02073312.1|  hypothetical protein CLOL250_00051 [Clostr...   143    3e-33
ref|NP_471160.1|  hypothetical protein lin1825 [Listeria innoc...   143    3e-33 
ref|ZP_02484830.1|  cell shape determining protein, MreB/Mrl f...   143    3e-33
ref|YP_337345.1|  cell shape determining protein, MreB/Mrl fam...   143    3e-33 
ref|YP_105528.1|  putative rod shape-determining protein MreB ...   143    3e-33 
gb|ABK58860.1|  rod shaping protein MreB [Photobacterium frigi...   143    3e-33
gb|ABK58863.1|  rod shaping protein MreB [Photobacterium indicum]   143    3e-33
ref|ZP_01691720.1|  rod shape-determining protein MreB [Micros...   143    4e-33
ref|ZP_02309444.1|  cell shape-determining protein [Listeria m...   143    4e-33
ref|YP_679890.1|  rod shape-determining protein [Cytophaga hut...   143    4e-33 
ref|YP_001518536.1|  cell shape determining protein, MreB/Mrl ...   142    5e-33 
ref|YP_445760.1|  regulator of ftsI, penicillin binding protei...   142    5e-33 
ref|ZP_02465890.1|  cell shape determining protein, MreB/Mrl f...   142    5e-33
ref|YP_849930.1|  MreB/Mbl family protein [Listeria welshimeri...   142    5e-33 
ref|ZP_01274634.1|  Cell division protein FtsA:Cell shape dete...   142    5e-33
gb|ABK58862.1|  rod shaping protein MreB [Photobacterium iliop...   142    6e-33
ref|NP_465238.1|  hypothetical protein lmo1713 [Listeria monoc...   142    6e-33 
ref|YP_014334.1|  cell shape-determining protein [Listeria mon...   142    6e-33 
ref|YP_439974.1|  rod shape-determining protein MreB [Burkhold...   142    1e-32 
ref|ZP_02371387.1|  rod shape-determining protein MreB [Burkho...   141    1e-32
ref|ZP_01857375.1|  cell shape determining protein, MreB/Mrl f...   141    1e-32
ref|YP_535959.1|  Rod shape-determining protein [Lactobacillus...   141    1e-32 
ref|ZP_02365304.1|  cell shape determining protein, MreB/Mrl f...   141    1e-32
ref|YP_001305716.1|  cell shape determining protein, MreB/Mrl ...   141    1e-32 
ref|ZP_01895768.1|  Actin-like ATPase involved in cell morphog...   141    2e-32
ref|ZP_01965841.1|  hypothetical protein RUMOBE_03589 [Ruminoc...   141    2e-32
ref|YP_001410427.1|  cell shape determining protein, MreB/Mrl ...   140    2e-32 
ref|ZP_02421984.1|  hypothetical protein EUBSIR_00825 [Eubacte...   140    4e-32
ref|ZP_02693431.1|  cell shape determining protein, MreB/Mrl f...   140    4e-32
ref|YP_001470004.1|  cell shape determining protein, MreB/Mrl ...   140    4e-32 
ref|YP_005433.1|  rod shape-determining protein mreB [Thermus ...   139    5e-32 
ref|ZP_02360945.1|  rod shape-determining protein MreB [Burkho...   138    1e-31
ref|ZP_01117655.1|  putative rod-shape determining protein [Po...   138    1e-31
ref|YP_595510.1|  Actin-like ATPase involved in cell morphogen...   137    2e-31 
ref|ZP_02206502.1|  hypothetical protein COPEUT_01277 [Coproco...   137    2e-31
ref|YP_001692536.1|  cell-shape determining protein [Finegoldi...   137    2e-31 
ref|ZP_02425154.1|  hypothetical protein ALIPUT_01291 [Alistip...   137    2e-31
ref|ZP_01719743.1|  rod shape-determining protein MreB [Algori...   137    2e-31
ref|ZP_02881447.1|  cell shape determining protein, MreB/Mrl f...   137    2e-31
gb|ABD75769.1|  putative rod shape-determining protein [uncult...   137    3e-31
ref|ZP_02076696.1|  hypothetical protein EUBDOL_00486 [Eubacte...   136    4e-31
ref|ZP_01506790.1|  cell shape determining protein, MreB/Mrl f...   136    4e-31
ref|ZP_01053845.1|  rod shape-determining protein MreB [Tenaci...   136    5e-31
ref|ZP_01886726.1|  rod shape-determining protein [Pedobacter ...   134    2e-30
ref|NP_925175.1|  cell-shape determining protein [Gloeobacter ...   134    2e-30 
ref|YP_001299120.1|  rod shape-determining protein [Bacteroide...   134    2e-30 
ref|YP_001431378.1|  cell shape determining protein, MreB/Mrl ...   134    3e-30 
ref|YP_379594.1|  Cell shape determining protein MreB/Mrl [Chl...   133    4e-30 
ref|ZP_02070976.1|  hypothetical protein BACUNI_02407 [Bactero...   133    4e-30
ref|YP_848161.1|  cell shape determining protein, MreB/Mrl fam...   133    4e-30 
ref|ZP_00532880.1|  Cell shape determining protein MreB/Mrl [C...   133    4e-30
ref|YP_001274884.1|  cell shape determining protein, MreB/Mrl ...   132    5e-30 
ref|YP_001567400.1|  cell shape determining protein, MreB/Mrl ...   132    6e-30 
ref|ZP_02066658.1|  hypothetical protein BACOVA_03658 [Bactero...   132    7e-30
ref|ZP_01385651.1|  cell shape determining protein, MreB/Mrl f...   132    8e-30
ref|ZP_01961709.1|  hypothetical protein BACCAC_03345 [Bactero...   132    9e-30
ref|NP_812724.1|  rod shape-determining protein MreB [Bacteroi...   132    9e-30 
ref|YP_001306516.1|  cell shape determining protein, MreB/Mrl ...   131    1e-29 
ref|YP_001577259.1|  Rod shape determining protein [Lactobacil...   131    1e-29 
ref|ZP_01386243.1|  cell shape determining protein, MreB/Mrl f...   131    1e-29
ref|ZP_02433883.1|  hypothetical protein BACSTE_00094 [Bactero...   131    1e-29
ref|YP_374480.1|  Cell shape determining protein MreB/Mrl [Pel...   131    1e-29 
ref|ZP_01251907.1|  putative rod-shape determining protein [Ps...   130    2e-29
ref|YP_101376.1|  rod shape-determining protein MreB [Bacteroi...   130    2e-29 
ref|ZP_00589729.1|  Cell shape determining protein MreB/Mrl [P...   130    3e-29
ref|ZP_01201644.1|  Actin-like ATPase involved in cell morphog...   130    4e-29
ref|ZP_00530741.1|  Cell shape determining protein MreB/Mrl [C...   128    1e-28
ref|YP_623300.1|  cell shape determining protein, MreB/Mrl fam...   128    1e-28 
ref|ZP_00977585.1|  COG1077: Actin-like ATPase involved in cel...   127    2e-28
ref|YP_911275.1|  cell shape determining protein, MreB/Mrl fam...   127    2e-28 
ref|ZP_01733439.1|  rod shape-determining protein [Flavobacter...   127    2e-28
ref|YP_001130119.1|  cell shape determining protein, MreB/Mrl ...   127    2e-28 
ref|ZP_02080087.1|  hypothetical protein CLOLEP_01539 [Clostri...   127    3e-28
ref|ZP_00513211.1|  Cell shape determining protein MreB/Mrl [C...   127    3e-28
ref|YP_371514.1|  Cell shape determining protein MreB/Mrl [Bur...   126    4e-28 
ref|NP_661447.1|  rod shape-determining protein MreB [Chlorobi...   125    6e-28 
gb|EAY70890.1|  Cell shape determining protein MreB/Mrl [Burkh...   125    8e-28
ref|ZP_00949063.1|  putative rod-shape determining protein [Cr...   125    8e-28
ref|ZP_02441981.1|  hypothetical protein ANACOL_01269 [Anaerot...   125    1e-27
ref|ZP_02182080.1|  hypothetical protein FBALC1_03802 [Flavoba...   124    1e-27
ref|ZP_00592620.1|  Cell shape determining protein MreB/Mrl [P...   124    2e-27
ref|ZP_01543989.1|  cell shape determining protein, MreB-like ...   123    3e-27
ref|ZP_01050150.1|  putative rod-shape determining protein [Ce...   123    3e-27
gb|ABB02609.1|  actin-like ATPase [Lactobacillus reuteri]           123    4e-27
ref|YP_810270.1|  Actin-like ATPase for cell morphogenesis [Oe...   123    4e-27 
ref|ZP_02091385.1|  hypothetical protein FAEPRAM212_01662 [Fae...   123    4e-27
ref|YP_001297272.1|  Rod shape-determining protein MreB [Flavo...   123    4e-27 
ref|NP_905557.1|  cell shape-determining protein MreB [Porphyr...   123    4e-27 
ref|YP_001303241.1|  rod shape-determining protein MreB [Parab...   122    6e-27 
ref|ZP_01107478.1|  cell shape-determining protein MreB [Flavo...   122    6e-27
ref|YP_001691666.1|  cell-shape determining protein [Finegoldi...   122    6e-27 
ref|ZP_01120488.1|  cell shape-determining protein MreB [Robig...   122    6e-27
emb|CAB53158.1|  putative rod shape-determining protein [Wolin...   122    7e-27
ref|ZP_00592847.1|  Cell shape determining protein MreB/Mrl [P...   122    7e-27
ref|ZP_01889835.1|  rod shape-determining protein [unidentifie...   122    9e-27
ref|NP_907174.1|  PUTATIVE ROD SHAPE-DETERMINING PROTEIN (FRAG...   122    1e-26 
ref|ZP_02033870.1|  hypothetical protein PARMER_03909 [Parabac...   121    1e-26
ref|ZP_01460615.1|  rod shape-determining protein MreB [Stigma...   121    1e-26
ref|ZP_01501296.1|  cell shape determining protein, MreB/Mrl f...   121    1e-26
ref|ZP_02160304.1|  rod shape-determining protein [Kordia algi...   120    2e-26
ref|YP_001085795.1|  rod shape-determining protein [Acinetobac...   120    3e-26 
ref|YP_001546834.1|  cell shape determining protein, MreB/Mrl ...   120    3e-26 
ref|YP_001115770.1|  cell shape determining protein, MreB/Mrl ...   119    5e-26 
ref|YP_862972.1|  rod shape-determining protein MreB [Gramella...   119    5e-26 
ref|YP_001193809.1|  cell shape determining protein, MreB/Mrl ...   119    8e-26 
ref|ZP_01062242.1|  putative rod-shape determining protein [Fl...   118    9e-26
ref|ZP_00591034.1|  Cell shape determining protein MreB/Mrl [P...   118    1e-25
ref|YP_810917.1|  Actin-like ATPase for cell morphogenesis [Oe...   117    2e-25 
ref|ZP_01544058.1|  cell shape determining protein [Oenococcus...   117    2e-25
ref|ZP_01507529.1|  cell shape determining protein, MreB/Mrl f...   114    2e-24
ref|ZP_02871134.1|  Rod shape-determining protein mreB [candid...   114    3e-24
ref|ZP_00590024.1|  Cell shape determining protein MreB/Mrl [P...   113    4e-24
ref|YP_700241.1|  rod shaping protein, MreB [Rhodococcus sp. R...   112    1e-23 
ref|YP_554174.1|  Cell shape determining protein MreB/Mrl [Bur...   112    1e-23 
ref|ZP_02094276.1|  hypothetical protein PEPMIC_01041 [Peptost...   111    1e-23
ref|ZP_02750297.1|  Rod shape-determining protein mreB [Escher...   110    2e-23
ref|YP_001583661.1|  cell shape determining protein, MreB/Mrl ...   110    3e-23 
ref|ZP_01805040.1|  hypothetical protein CdifQ_04000141 [Clost...   110    3e-23
ref|YP_001521948.1|  cell shape determining protein, MreB/Mrl ...   109    5e-23 
ref|ZP_00513104.1|  Cell shape determining protein MreB/Mrl [C...   109    6e-23
ref|ZP_02894077.1|  cell shape determining protein, MreB/Mrl f...   108    1e-22
ref|ZP_01557078.1|  cell shape determining protein, MreB/Mrl f...   108    1e-22
ref|YP_776252.1|  cell shape determining protein, MreB/Mrl fam...   108    1e-22 
ref|YP_146252.1|  cell-shape determining protein [Geobacillus ...   107    3e-22 
ref|YP_001124500.1|  Cell-shape determining protein [Geobacill...   106    4e-22 
ref|ZP_02376971.1|  cell shape determining protein, MreB/Mrl f...   106    4e-22
ref|ZP_00984155.1|  COG1077: Actin-like ATPase involved in cel...   106    5e-22
ref|ZP_02003824.1|  Cell shape determining protein MreB/Mrl [B...   105    6e-22
ref|ZP_02094630.1|  hypothetical protein PEPMIC_01397 [Peptost...   102    5e-21
gb|AAL51060.1|AF455359_4  MreB5 [Spiroplasma citri] >emb|CAK98...   101    1e-20
ref|NP_626694.1|  rod shape-determining protein [Streptomyces ...  99.8    5e-20 
ref|ZP_00231944.1|  cell shape-determining protein [Listeria m...  99.0    1e-19
ref|NP_662355.1|  rod shape-determining protein MreB [Chlorobi...  96.7    5e-19 
gb|AAL49988.1|  cell shape-determining protein [Spiroplasma ci...  96.3    6e-19
ref|NP_826897.1|  rod shape-determining protein [Streptomyces ...  95.9    8e-19 
emb|CAK98230.1|  cell shape determining protein mreb [Spiropla...  95.9    8e-19
ref|NP_951790.1|  cell shape-determining protein MreB/Mrl fami...  94.4    2e-18 
gb|AAL51059.1|AF455359_3  MreB4 [Spiroplasma citri]                94.4    2e-18
gb|AAL51057.1|AF455359_1  MreB2 [Spiroplasma citri] >emb|CAK98...  93.6    4e-18
gb|AAL51058.1|AF455359_2  MreB3 [Spiroplasma citri] >emb|CAK98...  91.3    2e-17
ref|ZP_01088728.1|  HSP70 class molecular chaperones involved ...  91.3    2e-17
ref|NP_276159.1|  rod shape-determining protein [Methanothermo...  90.9    2e-17 
ref|YP_001559475.1|  cell shape determining protein MreB/Mrl [...  90.1    3e-17 
ref|YP_001273553.1|  rod shape-determining protein, MreB/Mrl f...  89.7    5e-17 
ref|ZP_00232105.1|  mbl protein [Listeria monocytogenes str. 4...  85.9    7e-16
ref|ZP_02331535.1|  rod shape-determining protein MreB [Yersin...  81.6    2e-14
ref|YP_001260195.1|  cell shape determining protein MreB/Mrl [...  81.3    2e-14 
ref|ZP_02280143.1|  cell shape-determining protein [Listeria m...  79.0    1e-13
ref|ZP_02025978.1|  hypothetical protein EUBVEN_01234 [Eubacte...  78.2    2e-13
ref|ZP_02290478.1|  mbl protein [Listeria monocytogenes FSL J1...  77.0    3e-13
ref|ZP_02234665.1|  hypothetical protein DORFOR_01537 [Dorea f...  76.6    5e-13
ref|ZP_02430308.1|  hypothetical protein CLOSCI_00519 [Clostri...  76.3    5e-13
ref|NP_613455.1|  HSP70 class molecular chaperones involved in...  75.5    1e-12 
ref|ZP_01994567.1|  hypothetical protein DORLON_00552 [Dorea l...  72.4    9e-12
ref|ZP_02750298.1|  Rod shape-determining protein mreB [Escher...  70.1    4e-11
ref|ZP_01967549.1|  hypothetical protein RUMTOR_01096 [Ruminoc...  70.1    4e-11
ref|ZP_02041125.1|  hypothetical protein RUMGNA_01891 [Ruminoc...  68.2    1e-10
ref|ZP_00740020.1|  Rod shape-determining protein mreB [Bacill...  65.1    1e-09
ref|ZP_02437598.1|  hypothetical protein CLOSS21_00028 [Clostr...  63.5    5e-09
ref|ZP_01805041.1|  hypothetical protein CdifQ_04000142 [Clost...  61.2    2e-08
ref|ZP_02417753.1|  hypothetical protein ANACAC_00318 [Anaeros...  60.5    3e-08
ref|ZP_00390212.1|  COG1077: Actin-like ATPase involved in cel...  57.8    2e-07
ref|YP_001520664.1|  rod shape-determining protein MreB, putat...  54.7    2e-06 
ref|YP_001521453.1|  rod shape-determining-related protein [Ac...  53.9    3e-06 
ref|YP_869497.1|  rod shape-determining-related protein [Shewa...  53.9    3e-06 
ref|ZP_01233902.1|  rod shape-determining-related protein [Vib...  51.6    2e-05
ref|ZP_01131754.1|  rod shape-determining-related protein [Pse...  50.4    3e-05
ref|ZP_01963979.1|  hypothetical protein RUMOBE_01703 [Ruminoc...  50.4    4e-05
ref|ZP_01592960.1|  Actin-like ATPase involved in cell morphog...  50.4    4e-05
ref|ZP_02289634.1|  cell shape determining protein MreB [Liste...  48.9    9e-05
ref|ZP_02194457.1|  rod shape-determining-related protein [Vib...  48.9    1e-04
ref|YP_001019574.1|  rod shape-determining-related protein [Me...  48.9    1e-04 
ref|ZP_02004443.1|  rod shape-determining protein MreB [Beggia...  48.9    1e-04
gb|AAR38248.1|  chaperone protein hscA [uncultured marine bact...  48.5    1e-04
ref|ZP_01776883.1|  Actin-like ATPase involved in cell morphog...  48.1    2e-04
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, e...  47.4    3e-04
ref|NP_900759.1|  chaperone protein HscA [Chromobacterium viol...  46.6    5e-04 
ref|ZP_01305994.1|  rod shape-determining-related protein [Oce...  46.6    6e-04
ref|YP_207951.1|  chaperone protein HscA [Neisseria gonorrhoea...  46.2    6e-04 
ref|ZP_01133134.1|  chaperone (Hsp70 family protein) [Pseudoal...  46.2    7e-04
ref|YP_550731.1|  rod shape-determining-related protein [Polar...  45.8    8e-04 
ref|ZP_02363398.1|  chaperone protein HscA [Burkholderia oklah...  44.7    0.002
ref|YP_501673.1|  Heat shock protein 70 [Methanospirillum hung...  44.7    0.002 
ref|ZP_02356270.1|  chaperone protein HscA [Burkholderia oklah...  44.7    0.002
ref|NP_274160.1|  chaperone protein HscA [Neisseria meningitid...  44.7    0.002 
ref|YP_975116.1|  chaperone protein HscA [Neisseria meningitid...  44.7    0.002 
ref|YP_001599186.1|  chaperone protein HscA [Neisseria meningi...  44.7    0.002 
ref|YP_174180.1|  molecular chaperone HscC [Bacillus clausii K...  44.3    0.002 
ref|NP_284086.1|  chaperone protein HscA [Neisseria meningitid...  44.3    0.002 
ref|YP_001713891.1|  heat shock protein (Hsp); chaperon involv...  44.3    0.003 
ref|NP_110122.1|  molecular chaperone DnaK [Mycoplasma pneumon...  44.3    0.003 
ref|YP_903795.1|  Fe-S protein assembly chaperone HscA [Candid...  43.9    0.003 
ref|YP_001564754.1|  rod shape-determining-related protein [De...  43.5    0.004 
ref|YP_153891.1|  heat shock protein [Anaplasma marginale str....  43.5    0.004 
ref|ZP_02869322.1|  Rod shape-determining protein mreB [candid...  43.5    0.004
ref|YP_001393915.1|  DnaK2 [Clostridium kluyveri DSM 555] >gb|...  43.5    0.005 
ref|ZP_02090934.1|  hypothetical protein FAEPRAM212_01197 [Fae...  43.1    0.005
ref|XP_001892999.1|  heat shock 70 kDa protein C precursor, pu...  43.1    0.005 
ref|ZP_01551929.1|  chaperone protein HscA [Methylophilales ba...  43.1    0.006
ref|YP_267879.1|  chaperone protein HscA [Colwellia psychreryt...  42.4    0.009 
ref|YP_278868.1|  molecular chaperone DnaK [Mycoplasma hyopneu...  42.4    0.010 
ref|ZP_02885894.1|  Fe-S protein assembly chaperone HscA [Burk...  42.4    0.011
ref|YP_115586.1|  molecular chaperone DnaK [Mycoplasma hyopneu...  42.0    0.011 
ref|NP_758332.1|  HSP70 family molecular chaperone DnaK [Mycop...  42.0    0.011 
sp|Q49539|DNAK_MYCH2  Chaperone protein dnaK (Heat shock prote...  42.0    0.012
gb|ABE73147.1|  P65 [Mycoplasma hyopneumoniae]                     42.0    0.012
ref|YP_088913.1|  chaperone protein HscA [Mannheimia succinici...  42.0    0.012 
gb|ABK58898.1|  rod shaping protein MreB [Vibrio hispanicus]       42.0    0.012
ref|XP_001664967.1|  hypothetical protein CBG13233 [Caenorhabd...  42.0    0.012 
ref|YP_287467.1|  molecular chaperone DnaK [Mycoplasma hyopneu...  42.0    0.013 
ref|ZP_00404942.1|  COG0443: Molecular chaperone [Mycoplasma g...  42.0    0.013
gb|ABJ97378.1|  heat shock protein 70 [Pinctada fucata]            42.0    0.014
ref|YP_108881.1|  chaperone protein HscA [Burkholderia pseudom...  42.0    0.014 
ref|YP_001551435.1|  putative DnaK-type molecular chaperone (H...  41.6    0.014 
gb|AAR17078.1|  heat shock protein 70-1 [Nicotiana tabacum]        41.6    0.015
ref|YP_103324.1|  chaperone protein HscA [Burkholderia mallei ...  41.6    0.015 
ref|YP_580921.1|  chaperone protein HscA [Psychrobacter cryoha...  41.6    0.015 
ref|ZP_01505553.1|  Fe-S protein assembly chaperone HscA [Burk...  41.6    0.015
ref|NP_615061.1|  DnaK protein [Methanosarcina acetivorans C2A...  41.6    0.015 
ref|ZP_00441746.1|  COG0443: Molecular chaperone [Burkholderia...  41.6    0.015
ref|ZP_01330327.1|  hypothetical protein BpseS_03001549 [Burkh...  41.6    0.015
ref|ZP_01335978.1|  hypothetical protein Bpse4_03001437 [Burkh...  41.6    0.015
ref|ZP_01316951.1|  hypothetical protein Bpse1_03003640 [Burkh...  41.6    0.015
ref|YP_001059621.1|  chaperone protein HscA [Burkholderia pseu...  41.6    0.016 
ref|NP_072972.1|  molecular chaperone DnaK [Mycoplasma genital...  41.6    0.016 
ref|ZP_00825191.1|  COG0443: Molecular chaperone [Yersinia mol...  41.6    0.016
ref|ZP_01544028.1|  heat-shock protein molecular chaperone, cl...  41.6    0.016
ref|YP_810846.1|  Molecular chaperone [Oenococcus oeni PSU-1] ...  41.6    0.016 
ref|YP_334114.1|  chaperone protein HscA [Burkholderia pseudom...  41.6    0.016 
gb|ABF22344.1|  MreB [Vibrio crassostreae]                         41.6    0.016
ref|ZP_02273224.1|  Chaperone protein dnaK [Fusobacterium nucl...  41.6    0.016
ref|ZP_02343193.1|  chaperone protein HscA [Salmonella enteric...  41.6    0.017
ref|ZP_00143765.1|  Chaperone protein dnaK [Fusobacterium nucl...  41.6    0.017
ref|ZP_02403585.1|  chaperone protein HscA [Burkholderia pseud...  41.6    0.017
ref|NP_853321.1|  molecular chaperone DnaK [Mycoplasma gallise...  41.6    0.017 
ref|XP_001684402.1|  glucose-regulated protein 78, putative [L...  41.6    0.018 
gb|ABK58894.1|  rod shaping protein MreB [Vibrio halioticoli] ...  41.6    0.018
gb|ABK58871.1|  rod shaping protein MreB [Grimontia hollisae]      41.6    0.018
ref|YP_523436.1|  chaperone protein HscA [Rhodoferax ferriredu...  41.6    0.018 
gb|ABK58869.1|  rod shaping protein MreB [Enterovibrio coralii]    41.6    0.018
ref|NP_457070.1|  chaperone protein HscA [Salmonella enterica ...  41.2    0.019 
ref|YP_149658.1|  chaperone protein HscA [Salmonella enterica ...  41.2    0.019 
gb|ABL59942.1|  molecular chaperone [uncultured bacterium]         41.2    0.019
ref|YP_001586662.1|  hypothetical protein SPAB_00394 [Salmonel...  41.2    0.019 
ref|ZP_02560789.1|  chaperone protein HscA [Salmonella enteric...  41.2    0.020
ref|ZP_01306687.1|  Molecular chaperone [Oceanobacter sp. RED6...  41.2    0.020
ref|ZP_02700559.1|  hypothetical protein Saentericaenterica_21...  41.2    0.020
ref|YP_001011293.1|  Molecular chaperone DnaK, heat shock prot...  41.2    0.020 
ref|XP_001470161.1|  glucose-regulated protein 78 [Leishmania ...  41.2    0.020 
ref|ZP_02679034.1|  chaperone protein HscA [Salmonella enteric...  41.2    0.021
ref|ZP_02651300.1|  chaperone protein HscA [Salmonella enteric...  41.2    0.021
ref|ZP_02350478.1|  chaperone protein HscA [Salmonella enteric...  41.2    0.021
ref|YP_276135.1|  chaperone protein HscC [Pseudomonas syringae...  41.2    0.023 
gb|ABK58923.1|  rod shaping protein MreB [Vibrio superstes]        41.2    0.024
gb|ABK58870.1|  rod shaping protein MreB [Enterovibrio norvegi...  40.8    0.025
gb|ABK58887.1|  rod shaping protein MreB [Vibrio ezurae]           40.8    0.025
ref|YP_001231570.1|  2-alkenal reductase [Geobacter uraniumred...  40.8    0.025 
ref|XP_001895017.1|  Heat shock 70 kDa protein C precursor, pu...  40.8    0.026 
ref|YP_718493.1|  chaperone protein HscA [Haemophilus somnus 1...  40.8    0.026 
ref|ZP_01513434.1|  Fe-S protein assembly chaperone HscA [Burk...  40.8    0.027
ref|ZP_01913179.1|  Heat shock protein Hsp70 [Plesiocystis pac...  40.8    0.027
ref|ZP_00545219.1|  Heat shock protein Hsp70 [Ehrlichia chaffe...  40.8    0.027
ref|YP_264763.1|  chaperone protein HscA [Psychrobacter arctic...  40.8    0.027 
emb|CAC83010.1|  heat shock protein 70 [Ostrea edulis]             40.8    0.028
ref|NP_977464.1|  dnak protein, truncation [Bacillus cereus AT...  40.8    0.029 
ref|NP_860194.1|  molecular chaperone DnaK [Helicobacter hepat...  40.8    0.030 
ref|NP_078173.1|  heat shock protein 70 (hsp70) [Ureaplasma pa...  40.8    0.030 
ref|ZP_02867788.1|  hypothetical protein CLOSPI_01624 [Clostri...  40.8    0.031
ref|YP_895638.1|  chaperone protein, hsp70 family [Bacillus th...  40.8    0.031 
ref|YP_559450.1|  chaperone protein HscA [Burkholderia xenovor...  40.8    0.031 
gb|AAO41703.1|  heat shock protein 70 [Crassostrea ariakensis]     40.8    0.031
ref|YP_001256289.1|  Chaperone protein dnaK [Mycoplasma agalac...  40.8    0.031 
ref|YP_001273682.1|  molecular chaperone DnaK [Methanobrevibac...  40.4    0.032 
ref|YP_180284.1|  chaperone protein HscA [Ehrlichia ruminantiu...  40.4    0.032 
ref|ZP_02703205.1|  chaperone protein HscA [Salmonella enteric...  40.4    0.032
ref|ZP_02599886.1|  chaperone protein, hsp70 family [Bacillus ...  40.4    0.032
ref|YP_084491.1|  chaperone protein, hsp70 family [Bacillus ce...  40.4    0.032 
ref|YP_196355.1|  Chaperone protein hscA homolog [Ehrlichia ru...  40.4    0.033 
ref|NP_845512.1|  chaperone protein hscC [Bacillus anthracis s...  40.4    0.033 
emb|CAK99714.1|  chaperone dnak protein [Spiroplasma citri]        40.4    0.036
ref|YP_001562462.1|  2-alkenal reductase [Delftia acidovorans ...  40.4    0.036 
ref|YP_303047.1|  Heat shock protein Hsp70 [Ehrlichia canis st...  40.4    0.037 
ref|YP_774049.1|  chaperone protein HscA [Burkholderia ambifar...  40.4    0.038 
ref|YP_001395723.1|  DnaK8 [Clostridium kluyveri DSM 555] >gb|...  40.4    0.038 
ref|YP_001783511.1|  Fe-S protein assembly chaperone HscA [Hae...  40.4    0.038
emb|CAG12424.1|  unnamed protein product [Tetraodon nigroviridis]  40.4    0.039
ref|YP_001091186.1|  Molecular chaperone DnaK, heat shock prot...  40.4    0.039 
ref|ZP_02892923.1|  Fe-S protein assembly chaperone HscA [Burk...  40.4    0.039
ref|NP_930503.1|  chaperone protein HscA [Photorhabdus lumines...  40.4    0.040 
ref|ZP_01557525.1|  Fe-S protein assembly chaperone HscA [Burk...  40.4    0.041
ref|YP_001550751.1|  Molecular chaperone DnaK, heat shock prot...  40.4    0.041 
ref|YP_001569418.1|  hypothetical protein SARI_00337 [Salmonel...  40.4    0.041 
gb|AAS45710.1|  heat shock protein 70 [Macrobrachium rosenbergii]  40.0    0.043
ref|YP_046087.1|  chaperone protein HscA [Acinetobacter sp. AD...  40.0    0.044 
gb|AAR17490.1|  70 kDa heat shock protein [Veillonella montpel...  40.0    0.044
ref|YP_001009355.1|  Molecular chaperone DnaK, heat shock prot...  40.0    0.046 
emb|CAC83009.1|  heat shock protein 70 [Crassostrea gigas]         40.0    0.046
ref|YP_001760877.1|  2-alkenal reductase [Shewanella woodyi AT...  40.0    0.048
gb|AAD31042.1|AF144646_1  heat shock protein 70 [Crassostrea g...  40.0    0.050
ref|NP_893015.1|  Molecular chaperone DnaK, heat shock protein...  40.0    0.050 
gb|ABK58872.1|  rod shaping protein MreB [Salinivibrio costico...  40.0    0.052
gb|AAB30291.1|  hsp70=heat shock protein [Theileria sergenti, ...  40.0    0.053
ref|YP_442409.1|  chaperone protein HscA [Burkholderia thailan...  39.7    0.054 
ref|YP_001438934.1|  hypothetical protein ESA_02869 [Enterobac...  39.7    0.055 
gb|AAC77522.1|  70 kDa heat shock protein; DnaK; Hsp70 [Flavob...  39.7    0.056
gb|ABE11456.1|  molecular chaperone DnaK, heat shock protein h...  39.7    0.057
dbj|BAF52617.1|  chaperone protein dnak [Campylobacter lari] >...  39.7    0.059
ref|ZP_02074253.1|  hypothetical protein CLOL250_01019 [Clostr...  39.7    0.059
ref|ZP_02644114.1|  hypothetical protein Senterenterica_00720 ...  39.7    0.060
ref|NP_603026.1|  Chaperone protein dnaK [Fusobacterium nuclea...  39.7    0.060 
ref|XP_001566161.1|  glucose-regulated protein 78, putative [L...  39.7    0.061 
ref|YP_986385.1|  chaperone protein HscA [Acidovorax sp. JS42]...  39.7    0.062 
gb|AAQ56218.1|  heat shock protein 70 [Pneumocystis carinii f....  39.7    0.062
ref|YP_001451855.1|  hypothetical protein CKO_00255 [Citrobact...  39.7    0.063 
ref|ZP_02683392.1|  chaperone protein HscA [Salmonella enteric...  39.7    0.063
ref|ZP_00368294.1|  chaperone and heat shock protein 70 (dnaK)...  39.7    0.064
ref|YP_001484196.1|  Molecular chaperone DnaK, heat shock prot...  39.7    0.065 
ref|NP_461474.1|  chaperone protein HscA [Salmonella typhimuri...  39.7    0.065 
ref|YP_848520.1|  chaperone HscA family protein, putative [Lis...  39.7    0.067 
emb|CAK22359.1|  heat shock protein A1 [Mycoplasma suis]           39.7    0.067
ref|NP_794050.1|  chaperone protein HscC [Pseudomonas syringae...  39.7    0.069 
ref|ZP_02368192.1|  heat shock protein 70 [Borrelia valaisiana...  39.7    0.070
ref|YP_001765422.1|  Fe-S protein assembly chaperone HscA [Bur...  39.7    0.070
gb|EAY68459.1|  Molecular chaperone [Burkholderia dolosa AUO158]   39.3    0.072
ref|YP_843161.1|  chaperone protein DnaK [Methanosaeta thermop...  39.3    0.072 
ref|YP_619178.1|  Chaperone protein DnaK (heat shock protein) ...  39.3    0.073 
emb|CAA62478.1|  Heat shock 70 protein [Guillardia theta]          39.3    0.075
ref|ZP_02464047.1|  chaperone protein HscA [Burkholderia thail...  39.3    0.076
ref|YP_001120038.1|  chaperone protein HscA [Burkholderia viet...  39.3    0.076 
ref|YP_350497.1|  Heat shock protein Hsp70 [Pseudomonas fluore...  39.3    0.078










>ref|ZP_01264837.1|  rod shape-determining protein MreB [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|EAS85324.1|  rod shape-determining protein MreB [Candidatus Pelagibacter ubique 
HTCC1002]
Length=345

 Score =  278 bits (711),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 137/149 (91%), Positives = 139/149 (93%), Gaps = 0/149 (0%)

Query  4    FDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTML  63
            F ++  IWSQDMAIDLGTANTLVVLKG GVVLNEPSVVAI D  GKK VLAVGDEAKTML
Sbjct  5    FKNLSSIWSQDMAIDLGTANTLVVLKGQGVVLNEPSVVAIADNNGKKTVLAVGDEAKTML  64

Query  64   GRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERK  123
            GRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHK  TFANPRILICVPTGSTPVERK
Sbjct  65   GRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKNKTFANPRILICVPTGSTPVERK  124

Query  124  AIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            AIQDSALAAGARRVQLIEEPIAAAIGAGL
Sbjct  125  AIQDSALAAGARRVQLIEEPIAAAIGAGL  153


>ref|YP_266780.1|  rod shape-determining protein MreB [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|AAZ22176.1|  rod shape-determining protein MreB [Candidatus Pelagibacter ubique 
HTCC1062]
Length=345

 GENE ID: 3517471 mreB | rod shape-determining protein MreB
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  278 bits (711),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 137/149 (91%), Positives = 139/149 (93%), Gaps = 0/149 (0%)

Query  4    FDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTML  63
            F ++  IWSQDMAIDLGTANTLVVLKG GVVLNEPSVVAI D  GKK VLAVGDEAKTML
Sbjct  5    FKNLSSIWSQDMAIDLGTANTLVVLKGQGVVLNEPSVVAIADNNGKKTVLAVGDEAKTML  64

Query  64   GRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERK  123
            GRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHK  TFANPRILICVPTGSTPVERK
Sbjct  65   GRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKNKTFANPRILICVPTGSTPVERK  124

Query  124  AIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            AIQDSALAAGARRVQLIEEPIAAAIGAGL
Sbjct  125  AIQDSALAAGARRVQLIEEPIAAAIGAGL  153


>ref|YP_001413745.1|  cell shape determining protein, MreB/Mrl family [Parvibaculum 
lavamentivorans DS-1]
 gb|ABS64088.1|  cell shape determining protein, MreB/Mrl family [Parvibaculum 
lavamentivorans DS-1]
Length=346

 GENE ID: 5454058 Plav_2479 | cell shape determining protein, MreB/Mrl family
[Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score =  232 bits (592),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/143 (76%), Positives = 130/143 (90%), Gaps = 0/143 (0%)

Query  10   IWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGN  69
            ++S DMAIDLGTANTLV +KG G+VLNEPSVVAI+++GGKK VLAVG+EAK MLGRTPGN
Sbjct  8    MFSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIIEKGGKKQVLAVGEEAKMMLGRTPGN  67

Query  70   ISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERKAIQDSA  129
            I AIRP+RDGVIADF + EEMIKHFI+KVH   +FANP+I++CVP+GST VER+AIQ+SA
Sbjct  68   IQAIRPMRDGVIADFEIAEEMIKHFIRKVHNRRSFANPQIIVCVPSGSTAVERRAIQESA  127

Query  130  LAAGARRVQLIEEPIAAAIGAGL  152
            L+AGARRV LIEEP+AAAIGAGL
Sbjct  128  LSAGARRVYLIEEPMAAAIGAGL  150


>ref|YP_425562.1|  Cell shape determining protein MreB/Mrl [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC21275.1|  rod shape-determining protein MreB [Rhodospirillum rubrum ATCC 
11170]
Length=342

 GENE ID: 3834073 Rru_A0470 | Cell shape determining protein MreB/Mrl
[Rhodospirillum rubrum ATCC 11170]

 Score =  224 bits (572),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (86%), Gaps = 0/143 (0%)

Query  10   IWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGN  69
            + S DMAIDLGTANTLV +KG G+VLNEPSVVAI D  GKK VLAVGDEAK MLGRTPGN
Sbjct  4    LLSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIADVKGKKQVLAVGDEAKQMLGRTPGN  63

Query  70   ISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERKAIQDSA  129
            I AIRPLRDGVIADF V EEMIKHFI+KVH   +FA+P ++ICVP+GST VER+AIQ+SA
Sbjct  64   IQAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRSFASPMVIICVPSGSTAVERRAIQESA  123

Query  130  LAAGARRVQLIEEPIAAAIGAGL  152
             AAGARRV LIEEP+AAAIGAGL
Sbjct  124  EAAGARRVFLIEEPMAAAIGAGL  146


>gb|AAL57491.1|AF438483_1  cell-shape determining protein MreB [Azospirillum brasilense]
Length=374

 Score =  222 bits (565),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)

Query  10   IWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGN  69
            + S DMAIDLGTANTLV +KG G+VLNEPSVVAI +  GKK VLAVGDEAK MLGRTPGN
Sbjct  8    VLSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIANVRGKKQVLAVGDEAKMMLGRTPGN  67

Query  70   ISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERKAIQDSA  129
            I AIRPLRDGVIADF V EEMIKHFI+KVH   +FA+P+++ICVP+GST VER+AIQ+SA
Sbjct  68   IQAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRSFASPQVIICVPSGSTAVERRAIQESA  127

Query  130  LAAGARRVQLIEEPIAAAIGAGL  152
             AAGARRV LIEEP+AAAIGAGL
Sbjct  128  EAAGARRVFLIEEPMAAAIGAGL  150


>ref|YP_745291.1|  rod shape-determining protein mreB [Granulibacter bethesdensis 
CGDNIH1]
 gb|ABI62368.1|  rod shape-determining protein mreB [Granulibacter bethesdensis 
CGDNIH1]
Length=370

 GENE ID: 4276561 GbCGDNIH1_1470 | rod shape-determining protein mreB
[Granulibacter bethesdensis CGDNIH1]

 Score =  221 bits (562),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTM  62
            +F  +  + S DMAIDLGTANTLV +KG G+VL EPSVVAI D  G+K VLAVG+EAK M
Sbjct  24   MFSRLLGVMSADMAIDLGTANTLVYVKGRGIVLAEPSVVAIADSRGRKQVLAVGEEAKNM  83

Query  63   LGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVER  122
            LGRTPGNI AIRPLRDGVIADF V EEMIKHFI+KVH  S FA+P I++CVP+GST VER
Sbjct  84   LGRTPGNIQAIRPLRDGVIADFEVAEEMIKHFIRKVHSRSRFASPLIIVCVPSGSTAVER  143

Query  123  KAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            +AIQ+SA +AGARRV LIEEP+AAAIGAGL
Sbjct  144  RAIQESAESAGARRVLLIEEPMAAAIGAGL  173


>ref|YP_422876.1|  Actin-like ATPase involved in cell morphogenesis [Magnetospirillum 
magneticum AMB-1]
 dbj|BAE52317.1|  Actin-like ATPase involved in cell morphogenesis [Magnetospirillum 
magneticum AMB-1]
Length=346

 GENE ID: 3805055 amb3513 | Actin-like ATPase involved in cell morphogenesis
[Magnetospirillum magneticum AMB-1] (10 or fewer PubMed links)

 Score =  221 bits (562),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTM  62
            +F  +    S DMAIDLGTANTLV +KG G+VLNEPSVVAI ++ GKK VLAVGDEAK M
Sbjct  1    MFSKLTGWMSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIAEEKGKKKVLAVGDEAKMM  60

Query  63   LGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVER  122
            LGRTPG I AIRPLRDGVIADF V EEMIKHFI+KVH   +FA+P +++CVP+GST VER
Sbjct  61   LGRTPGYIQAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRSFASPLVIVCVPSGSTAVER  120

Query  123  KAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            +AIQ+SA +AGARRV LIEEP+AAAIGAGL
Sbjct  121  RAIQESAESAGARRVFLIEEPMAAAIGAGL  150


>emb|CAM76495.1|  Rod shape-determining protein [Magnetospirillum gryphiswaldense 
MSR-1]
Length=346

 Score =  219 bits (559),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTM  62
            +F ++   +S DMAIDLGTANTLV +KG G+VLNEPSVVAI ++ GKK VLAVGDEAK M
Sbjct  1    MFPNLTGWFSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIAEEKGKKKVLAVGDEAKMM  60

Query  63   LGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVER  122
            LGRTPG I AIRPLRDGVIADF V EEMIKHFI+KVH   +FA+P +++CVP+GST VER
Sbjct  61   LGRTPGYIQAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRSFASPLVIVCVPSGSTAVER  120

Query  123  KAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            +AIQ+SA +AGAR+V LIEEP+AAAIGAGL
Sbjct  121  RAIQESAESAGARKVFLIEEPMAAAIGAGL  150


>ref|ZP_02187329.1|  Actin-like ATPase involved in cell morphogenesis [alpha proteobacterium 
BAL199]
 gb|EDP65671.1|  Actin-like ATPase involved in cell morphogenesis [alpha proteobacterium 
BAL199]
Length=347

 Score =  219 bits (559),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTM  62
             F ++  + S DMAIDLGTANTLV +KG G+VLNEPSVVAI    GKK VLAVGDEAK M
Sbjct  2    FFANLLGMLSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIATVRGKKQVLAVGDEAKQM  61

Query  63   LGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVER  122
            LGRTPGNI AIRPLRDGVIADF V EEMIKHFI+KVH   +FA+P++++CVP+GST VER
Sbjct  62   LGRTPGNIQAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRSFASPQVIVCVPSGSTAVER  121

Query  123  KAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            +AIQ+SA +AGARRV LIEEP+AAAIGA L
Sbjct  122  RAIQESAESAGARRVFLIEEPMAAAIGANL  151


>ref|YP_192132.1|  Rod shape-determining protein MreB [Gluconobacter oxydans 621H]
 gb|AAW61476.1|  Rod shape-determining protein MreB [Gluconobacter oxydans 621H]
Length=349

 GENE ID: 3249477 GOX1737 | Rod shape-determining protein MreB
[Gluconobacter oxydans 621H] (10 or fewer PubMed links)

 Score =  219 bits (558),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTM  62
            +F  +  + S DMAIDLGTANTLV +KG G+VL+EPSVVAI +  GKK VLAVG+EAK M
Sbjct  1    MFSRLLGLMSADMAIDLGTANTLVYVKGRGIVLDEPSVVAIAEVRGKKQVLAVGNEAKQM  60

Query  63   LGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVER  122
            +GRTPGNI+AIRPLRDGVIADF V EEMIKHFI+KVH    FA+P+I+ICVP+G+T VER
Sbjct  61   VGRTPGNITAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRAFASPQIIICVPSGATAVER  120

Query  123  KAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            +AIQ+SA +AGAR+V LIEEP+AAAIGAGL
Sbjct  121  RAIQESAESAGARKVMLIEEPMAAAIGAGL  150





BlastP contre banque SWISSPROT, max target sequences : 1000
on n'obtient pas de resultat avec "max target = 5000"

sp|P0A9X4.1|MREB_ECOLI  Rod shape-determining protein mreB >sp...   193    2e-49
sp|Q9L6A3|MREB_PASMU  Rod shape-determining protein mreB            186    2e-47
sp|P44474|MREB_HAEIN  Rod shape-determining protein mreB            185    7e-47
sp|P39751|MBL_BACSU  MreB-like protein (Protein mbl)                171    1e-42
sp|P32444|MBL_BACC1  MreB-like protein (Protein mbl)                169    4e-42 
sp|P39763|MREBH_BACSU  Protein mreBH                                153    3e-37
sp|Q01465|MREB_BACSU  Rod shape-determining protein mreB            151    1e-36
sp|Q7NZ33|HSCA_CHRVO  Chaperone protein hscA homolog               46.6    4e-05
sp|Q5F8E8|HSCA_NEIG1  Chaperone protein hscA homolog               46.2    4e-05 
sp|Q9JS04|HSCA_NEIMB  Chaperone protein hscA homolog               44.7    2e-04
sp|Q9JUF4|HSCA_NEIMA  Chaperone protein hscA homolog               44.3    2e-04
sp|P75344|DNAK_MYCPN  Chaperone protein dnaK (Heat shock prote...  44.3    2e-04
sp|A1AWL7.1|HSCA_RUTMC  Chaperone protein hscA homolog             43.9    3e-04
sp|Q486Y6.1|HSCA_COLP3  Chaperone protein hscA homolog             42.4    7e-04
sp|Q4AAR4|DNAK_MYCHJ  Chaperone protein dnaK (Heat shock prote...  42.4    8e-04 
sp|Q8EUH7|DNAK_MYCPE  Chaperone protein dnaK (Heat shock prote...  42.0    9e-04
sp|Q49539|DNAK_MYCH2  Chaperone protein dnaK (Heat shock prote...  42.0    9e-04
sp|Q65RT2|HSCA_MANSM  Chaperone protein hscA homolog               42.0    0.001 
sp|Q4A8U5|DNAK_MYCH7  Chaperone protein dnaK (Heat shock prote...  42.0    0.001 
sp|Q63SN5|HSCA_BURPS  Chaperone protein hscA homolog               42.0    0.001
sp|A3ML96.1|HSCA_BURM7  Chaperone protein hscA homolog >sp|A2S...  41.6    0.001
sp|A3NX33.1|HSCA_BURP0  Chaperone protein hscA homolog >sp|A3N...  41.6    0.001
sp|P47547|DNAK_MYCGE  Chaperone protein dnaK (Heat shock prote...  41.6    0.001
sp|Q04EE1.1|DNAK_OENOB  Chaperone protein dnaK (Heat shock pro...  41.6    0.001 
sp|Q3JQN9.1|HSCA_BURP1  Chaperone protein hscA homolog             41.6    0.001
sp|Q7NAU6|DNAK_MYCGA  Chaperone protein dnaK (Heat shock prote...  41.6    0.001
sp|Q8Z4N2|HSCA_SALTI  Chaperone protein hscA (Hsc66)               41.2    0.001
sp|Q5PNH1|HSCA_SALPA  Chaperone protein hscA (Hsc66)               41.2    0.001
sp|Q0I1K8.1|HSCA_HAES1  Chaperone protein hscA homolog             40.8    0.002 
sp|Q7VIE3|DNAK_HELHP  Chaperone protein dnaK (Heat shock prote...  40.8    0.002
sp|Q9PQF2|DNAK_UREPA  Chaperone protein dnaK (Heat shock prote...  40.8    0.002
sp|Q0BDQ8.1|HSCA_BURCM  Chaperone protein hscA homolog             40.4    0.003 
sp|Q7N228|HSCA_PHOLL  Chaperone protein hscA (Hsc66)               40.4    0.003
sp|Q6FCE6|HSCA_ACIAD  Chaperone protein hscA homolog               40.0    0.003 
sp|Q7V1H4|DNAK1_PROMP  Chaperone protein dnaK1 (Heat shock pro...  40.0    0.004 
sp|Q2SXE0.1|HSCA_BURTA  Chaperone protein hscA homolog             39.7    0.004
sp|Q8RH05|DNAK_FUSNN  Chaperone protein dnaK (Heat shock prote...  39.7    0.005
sp|A1W7T4.1|HSCA_ACISJ  Chaperone protein hscA homolog             39.7    0.005 
sp|A8AD56.1|HSCA_CITK8  Chaperone protein hscA (Hsc66)             39.7    0.005
sp|Q8ZN42|HSCA_SALTY  Chaperone protein hscA (Hsc66)               39.7    0.005
sp|A0B747.1|DNAK_METTP  Chaperone protein dnaK (Heat shock pro...  39.3    0.006 
sp|Q049W6.1|DNAK_LACDB  Chaperone protein dnaK (Heat shock pro...  39.3    0.006 
sp|Q39EU4.1|HSCA_BURS3  Chaperone protein hscA homolog             39.3    0.006 
sp|A5CWM2.1|HSCA_VESOH  Chaperone protein hscA homolog             39.3    0.006
sp|A2SI25.1|HSCA_METPP  Chaperone protein hscA homolog             39.3    0.007
sp|Q1WUE8.1|DNAK_LACS1  Chaperone protein dnaK (Heat shock pro...  38.9    0.007
sp|Q1BHT5.1|HSCA_BURCA  Chaperone protein hscA homolog >sp|A0K...  38.9    0.007 
sp|Q4A658|DNAK_MYCS5  Chaperone protein dnaK (Heat shock prote...  38.9    0.008 
sp|A1U614.1|DNAK_MARAV  Chaperone protein dnaK (Heat shock pro...  38.9    0.008 
sp|A4WDA7.1|HSCA_ENT38  Chaperone protein hscA (Hsc66)             38.9    0.008
sp|P20163|HSP7D_CAEEL  Heat shock 70 kDa protein D precursor       38.9    0.009 
sp|O51883|HSCA_BUCAP  Chaperone protein hscA                       38.9    0.009
sp|A1ANV0.1|DNAK_PELPD  Chaperone protein dnaK (Heat shock pro...  38.9    0.009 
sp|Q74IT6|DNAK_LACJO  Chaperone protein dnaK (Heat shock prote...  38.5    0.011
sp|Q044A9.1|DNAK_LACGA  Chaperone protein dnaK (Heat shock pro...  38.5    0.011 
sp|Q1H365.1|HSCA_METFK  Chaperone protein hscA homolog             38.5    0.011 
sp|Q038N3.1|DNAK_LACC3  Chaperone protein dnaK (Heat shock pro...  38.5    0.012 
sp|A5IK42.1|DNAK_THEP1  Chaperone protein dnaK (Heat shock pro...  38.1    0.012 
sp|A1WKG6.1|HSCA_VEREI  Chaperone protein hscA homolog             38.1    0.013
sp|Q30Q10.1|DNAK_SULDN  Chaperone protein dnaK (Heat shock pro...  38.1    0.014 
sp|A4SP09.1|HSCA_AERS4  Chaperone protein hscA homolog             38.1    0.014 
sp|Q03QU1.1|DNAK_LACBA  Chaperone protein dnaK (Heat shock pro...  38.1    0.015
sp|Q88VM0|DNAK_LACPL  Chaperone protein dnaK (Heat shock prote...  38.1    0.015
sp|Q98QY7|DNAK_MYCPU  Chaperone protein dnaK (Heat shock prote...  37.7    0.016
sp|Q9ZEJ0|DNAK_MYCHO  Chaperone protein dnaK (Heat shock prote...  37.7    0.017
sp|A6VMP1.1|HSCA_ACTSZ  Chaperone protein hscA homolog             37.7    0.017
sp|A8FLH2.1|DNAK_CAMJ8  Chaperone protein dnaK (Heat shock pro...  37.7    0.017
sp|Q11QH3.1|DNAK_CYTH3  Chaperone protein dnaK (Heat shock pro...  37.7    0.017 
sp|O69298|DNAK_CAMJE  Chaperone protein dnaK (Heat shock prote...  37.7    0.017
sp|Q9CNV2|HSCA_PASMU  Chaperone protein hscA homolog               37.7    0.017
sp|Q84BU4|DNAK_LACAC  Chaperone protein dnaK (Heat shock prote...  37.7    0.018
sp|A8GHX9.1|HSCA_SERP5  Chaperone protein hscA (Hsc66)             37.7    0.018
sp|Q12WE6.1|DNAK_METBU  Chaperone protein dnaK (Heat shock pro...  37.7    0.019 
sp|Q3AF08|DNAK_CARHZ  Chaperone protein dnaK (Heat shock prote...  37.7    0.020 
sp|A1JKQ7.1|HSCA_YERE8  Chaperone protein hscA (Hsc66)             37.7    0.020 
sp|A3N0T5.1|HSCA_ACTP2  Chaperone protein hscA homolog             37.7    0.020 
sp|Q7MA35|DNAK_WOLSU  Chaperone protein dnaK (Heat shock prote...  37.4    0.022
sp|P44669|HSCA_HAEIN  Chaperone protein hscA homolog               37.4    0.022
sp|A5UGH6.1|HSCA_HAEIG  Chaperone protein hscA homolog             37.4    0.022
sp|Q2SSB0|DNAK_MYCCT  Chaperone protein dnaK (Heat shock prote...  37.4    0.023 
sp|Q95YL7|HSP70_ENCHE  Mitochondrial-type heat shock protein 7...  37.4    0.023
sp|Q27031|HSP70_THEPA  Heat shock 70 kDa protein (HSP 70.1) (7...  37.4    0.024
sp|Q2SMM8.1|DNAK_HAHCH  Chaperone protein dnaK (Heat shock pro...  37.4    0.024 
sp|Q6MT06|DNAK_MYCMS  Chaperone protein dnaK (Heat shock prote...  37.4    0.025
sp|Q8KML6|DNAK_LACSN  Chaperone protein dnaK (Heat shock prote...  37.4    0.025
sp|A8YVQ3.1|DNAK_LACH4  Chaperone protein dnaK (Heat shock pro...  37.4    0.025
sp|A7I2D4.1|DNAK_CAMHC  Chaperone protein dnaK (Heat shock pro...  37.4    0.025
sp|P16019|HSP70_THEAN  Heat shock 70 kDa protein (HSP 70.1) (7...  37.4    0.026
sp|Q65H54|DNAK_BACLD  Chaperone protein dnaK (Heat shock prote...  37.4    0.026 
sp|A5VJE7.1|DNAK_LACRF  Chaperone protein dnaK (Heat shock pro...  37.4    0.026 
sp|A7H484.1|DNAK_CAMJD  Chaperone protein dnaK (Heat shock pro...  37.0    0.027
sp|Q5N0G0|DNAK3_SYNP6  Chaperone protein dnaK 3 (Heat shock pr...  37.0    0.027 
sp|Q0SMZ0.1|DNAK_BORAP  Chaperone protein dnaK (Heat shock pro...  37.0    0.028 
sp|Q661A3|DNAK_BORGA  Chaperone protein dnaK (Heat shock prote...  37.0    0.028
sp|P06761|GRP78_RAT  78 kDa glucose-regulated protein precurso...  37.0    0.030 
sp|P28608|DNAK_BORBU  Chaperone protein dnaK (Heat shock prote...  37.0    0.030
sp|P11021.2|GRP78_HUMAN  78 kDa glucose-regulated protein prec...  37.0    0.031 
sp|Q89A16|HSCA_BUCBP  Chaperone protein hscA                       37.0    0.031
sp|P20029|GRP78_MOUSE  78 kDa glucose-regulated protein precur...  37.0    0.031 
sp|Q6B8V2|DNAK_GRATL  Chaperone protein dnaK (Heat shock prote...  37.0    0.031 
sp|Q0VCX2|GRP78_BOVIN  78 kDa glucose-regulated protein precur...  37.0    0.031 
sp|Q8GLE4|HSCA_XENNE  Chaperone protein hscA (Hsc66)               37.0    0.033
sp|Q3S4T7|GRP78_SPETR  78 kDa glucose-regulated protein precur...  37.0    0.034
sp|P20030|HSP7C_TRYBB  Heat shock cognate HSP70 protein            37.0    0.034
sp|Q8EPW4|DNAK_OCEIH  Chaperone protein dnaK (Heat shock prote...  37.0    0.034
sp|P07823|GRP78_MESAU  78 kDa glucose-regulated protein precur...  37.0    0.035
sp|Q0VST6.1|DNAK_ALCBS  Chaperone protein dnaK (Heat shock pro...  36.6    0.035 
sp|Q90473|HSP7C_BRARE  Heat shock cognate 71 kDa protein (Heat...  36.6    0.035 
sp|Q9HHB9|DNAK_HALME  Chaperone protein dnaK (Heat shock prote...  36.6    0.036
sp|Q3IFG5.1|HSCA_PSEHT  Chaperone protein hscA homolog             36.6    0.036
sp|Q8FF44.2|HSCA_ECOL6  Chaperone protein hscA (Hsc66)             36.6    0.037
sp|A7MGW6.1|HSCA_ENTS8  Chaperone protein hscA (Hsc66)             36.6    0.037
sp|Q67S54|DNAK_SYMTH  Chaperone protein dnaK (Heat shock prote...  36.6    0.039
sp|Q2YT47.1|DNAK_STAAB  Chaperone protein dnaK (Heat shock pro...  36.6    0.039 
sp|Q91883|GRP78_XENLA  78 kDa glucose-regulated protein precur...  36.6    0.040 
sp|Q0T1Z3.1|HSCA_SHIF8  Chaperone protein hscA (Hsc66) >sp|Q83...  36.6    0.042
sp|A7ZPW9.1|HSCA_ECO24  Chaperone protein hscA (Hsc66)             36.6    0.042
sp|Q31XW4.1|HSCA_SHIBS  Chaperone protein hscA (Hsc66)             36.6    0.042
sp|P45554|DNAK_STAAU  Chaperone protein dnaK (Heat shock prote...  36.6    0.042
sp|P11143|HSP70_MAIZE  Heat shock 70 kDa protein                   36.6    0.043
sp|Q3SEX4.1|HSCA_THIDA  Chaperone protein hscA homolog             36.6    0.043 
sp|Q1QSX0.1|DNAK_CHRSD  Chaperone protein dnaK (Heat shock pro...  36.6    0.043 
sp|Q9TLT1|DNAK_CYACA  Chaperone protein dnaK (Heat shock prote...  36.6    0.043 
sp|Q91233|HSP70_ONCTS  Heat shock 70 kDa protein (HSP70)           36.6    0.043
sp|P0A6Z1.1|HSCA_ECOLI  Chaperone protein hscA (Hsc66) >sp|Q0T...  36.6    0.043
sp|A1TPY4.1|HSCA_ACIAC  Chaperone protein hscA homolog             36.6    0.044
sp|Q6NEY9|DNAK_CORDI  Chaperone protein dnaK (Heat shock prote...  36.6    0.044
sp|Q2FXZ2.1|DNAK_STAA8  Chaperone protein dnaK (Heat shock pro...  36.6    0.044 
sp|Q9GSU7|HSP71_DROSI  Major heat shock 70 kDa protein Ab (Hea...  36.6    0.045
sp|Q835R7|DNAK_ENTFA  Chaperone protein dnaK (Heat shock prote...  36.2    0.047
sp|A3CQC2.1|DNAK_STRSV  Chaperone protein dnaK (Heat shock pro...  36.2    0.048
sp|Q7VC04|DNAK1_PROMA  Chaperone protein dnaK1 (Heat shock pro...  36.2    0.049
sp|P50020|DNAK1_SYNP7  Chaperone protein dnaK1 (Heat shock pro...  36.2    0.049 
sp|O74225|HSP88_NEUCR  Heat shock protein Hsp88                    36.2    0.050
sp|Q05944|HSP70_HYDMA  Heat shock 70 kDa protein                   36.2    0.055
sp|P08108|HSP70_ONCMY  Heat shock cognate 70 kDa protein (HSP70)   36.2    0.055 
sp|Q5KWZ7|DNAK_GEOKA  Chaperone protein dnaK (Heat shock prote...  36.2    0.057
sp|A4VZB5.1|DNAK_STRS2  Chaperone protein dnaK (Heat shock pro...  36.2    0.057
sp|P17820|DNAK_BACSU  Chaperone protein dnaK (Heat shock prote...  36.2    0.058
sp|Q4U0F3|HS70B_BOSMU  Heat shock 70 kDa protein 1B (HSP70.2)      35.8    0.061
sp|Q4L6T0|DNAK_STAHJ  Chaperone protein dnaK (Heat shock prote...  35.8    0.061 
sp|Q24789|HSP70_ECHGR  Heat shock cognate 70 kDa protein (HSP70)   35.8    0.061
sp|Q6YPM1|DNAK_ONYPE  Chaperone protein dnaK (Heat shock prote...  35.8    0.062
sp|O06942|DNAK_STRMU  Chaperone protein dnaK (Heat shock prote...  35.8    0.063
sp|Q0HVP0.1|HSCA_SHESR  Chaperone protein hscA homolog             35.8    0.065 
sp|Q27965|HS70B_BOVIN  Heat shock 70 kDa protein 1B (HSP70.2)      35.8    0.069 
sp|Q730M1|DNAK_BACC1  Chaperone protein dnaK (Heat shock prote...  35.8    0.069 
sp|Q27975|HS70A_BOVIN  Heat shock 70 kDa protein 1A (HSP70.1)      35.8    0.069 
sp|Q7NDH1|DNAK_GLOVI  Chaperone protein dnaK (Heat shock prote...  35.8    0.070
sp|Q9I8F9|HSP71_ORYLA  Heat shock 70 kDa protein 1 (HSP70-1)       35.8    0.072
sp|Q818E9|DNAK_BACCR  Chaperone protein dnaK (Heat shock prote...  35.8    0.073 
sp|A0RIT3.1|DNAK_BACAH  Chaperone protein dnaK (Heat shock pro...  35.8    0.073
sp|A0RPW7.1|DNAK_CAMFF  Chaperone protein dnaK (Heat shock pro...  35.8    0.074
sp|Q3IUI0|DNAK_NATPD  Chaperone protein dnaK (Heat shock prote...  35.8    0.074 
sp|Q5E780|HSCA_VIBF1  Chaperone protein hscA homolog               35.8    0.075 
sp|P53421.2|HSP71_PICAN  Heat shock protein 70 1 (HSP72)           35.8    0.075
sp|Q4FPS9|DNAK_PSYAR  Chaperone protein dnaK (Heat shock prote...  35.8    0.077
sp|P27322|HSP72_LYCES  Heat shock cognate 70 kDa protein 2         35.8    0.077
sp|P27094|DNAK_METMA  Chaperone protein dnaK (Heat shock prote...  35.4    0.078
sp|Q2RKX4.1|DNAK_MOOTA  Chaperone protein dnaK (Heat shock pro...  35.4    0.079 
sp|Q7W8U9|HSCA_BORPA  Chaperone protein hscA homolog               35.4    0.080
sp|Q9ZIV1|DNAK_MEGEL  Chaperone protein dnaK (Heat shock prote...  35.4    0.080
sp|O69268|DNAK_BACSH  Chaperone protein dnaK (Heat shock prote...  35.4    0.081
sp|O87777|DNAK_LACSK  Chaperone protein dnaK (Heat shock prote...  35.4    0.082
sp|O65719|HSP73_ARATH  Heat shock cognate 70 kDa protein 3 (Hs...  35.4    0.083 
sp|Q38W93|DNAK_LACSS  Chaperone protein dnaK (Heat shock prote...  35.4    0.083 
sp|Q49Y22|DNAK_STAS1  Chaperone protein dnaK (Heat shock prote...  35.4    0.083 
sp|Q1Q7X0.1|DNAK_PSYCK  Chaperone protein dnaK (Heat shock pro...  35.4    0.083 
sp|Q6S4N2|HS70B_PIG  Heat shock 70 kDa protein 1B (HSP70.2)        35.4    0.085 
sp|P57660|HSCA_BUCAI  Chaperone protein hscA                       35.4    0.085
sp|A6TCE7.1|HSCA_KLEP7  Chaperone protein hscA (Hsc66)             35.4    0.085
sp|Q5R7D3.1|HSP71_PONPY  Heat shock 70 kDa protein 1 >sp|P0810...  35.4    0.085
sp|A4IR31.1|DNAK_GEOTN  Chaperone protein dnaK (Heat shock pro...  35.4    0.086
sp|Q7YQC6|HSP71_CANFA  Heat shock 70 kDa protein 1                 35.4    0.086
sp|P40918|HSP70_CLAHE  Heat shock 70 kDa protein (Allergen Cla...  35.4    0.086
sp|Q8INI8|HSP72_DROME  Major heat shock 70 kDa protein Ba (Hea...  35.4    0.086 
sp|Q04LY0.1|DNAK_STRP2  Chaperone protein dnaK (Heat shock pro...  35.4    0.087
sp|Q9VG58|HSP74_DROME  Major heat shock 70 kDa protein Bbb (He...  35.4    0.089 
sp|P95829|DNAK_STRPN  Chaperone protein dnaK (Heat shock prote...  35.4    0.089
sp|Q5M6D1|DNAK_STRT2  Chaperone protein dnaK (Heat shock prote...  35.4    0.090 
sp|P02825|HSP71_DROME  Major heat shock 70 kDa protein Ab (Hea...  35.4    0.090 
sp|Q92260|HSP70_PENCI  Heat shock 70 kDa protein (Allergen Pen...  35.4    0.090
sp|A7Z6W1.1|DNAK_BACA2  Chaperone protein dnaK (Heat shock pro...  35.4    0.091 
sp|P09189|HSP7C_PETHY  Heat shock cognate 70 kDa protein           35.4    0.091
sp|P53623|HSP72_PICAN  Heat shock protein 70 2                     35.4    0.092
sp|Q9GSU4|HSP72_DROSI  Major heat shock 70 kDa protein Ba (Hea...  35.4    0.094
sp|A1UUC3.1|DNAK_BARBK  Chaperone protein dnaK (Heat shock pro...  35.4    0.094
sp|Q8EEU5|HSCA_SHEON  Chaperone protein hscA homolog               35.4    0.096
sp|A1S548.1|HSCA_SHEAM  Chaperone protein hscA homolog             35.4    0.096 
sp|A3DF25.1|DNAK_CLOTH  Chaperone protein dnaK (Heat shock pro...  35.4    0.098 
sp|P0A3J0|DNAK_LACLA  Chaperone protein dnaK (Heat shock prote...  35.4    0.099
sp|Q5HNW6|DNAK_STAEQ  Chaperone protein dnaK (Heat shock prote...  35.4    0.100 
sp|Q8CP17|DNAK_STAES  Chaperone protein dnaK (Heat shock prote...  35.4    0.10  
sp|Q5FSL5|DNAK_GLUOX  Chaperone protein dnaK (Heat shock prote...  35.0    0.10 
sp|Q03MR6.1|DNAK_STRTD  Chaperone protein dnaK (Heat shock pro...  35.0    0.10  
sp|A0KJ36.1|HSCA_AERHH  Chaperone protein hscA homolog             35.0    0.10 
sp|P87047|HSP70_PARBR  Heat shock 70 kDa protein                   35.0    0.10 
sp|Q4QNG9.1|HSCA_HAEI8  Chaperone protein hscA homolog             35.0    0.11 
sp|Q02028|HSP7S_PEA  Stromal 70 kDa heat shock-related protein...  35.0    0.11 
sp|Q8TQR2|DNAK_METAC  Chaperone protein dnaK (Heat shock prote...  35.0    0.11 
sp|A3D573.1|HSCA_SHEB5  Chaperone protein hscA homolog             35.0    0.11  
sp|A6WNY1.1|HSCA_SHEB8  Chaperone protein hscA homolog             35.0    0.11 
sp|Q6F149|DNAK_MESFL  Chaperone protein dnaK (Heat shock prote...  35.0    0.11 
sp|P29357|HSP7E_SPIOL  Chloroplast envelope membrane 70 kDa he...  35.0    0.11 
sp|A8FFD2.1|DNAK_BACP2  Chaperone protein dnaK (Heat shock pro...  35.0    0.12 
sp|Q05945|HSP70_HYDOL  Heat shock 70 kDa protein                   35.0    0.12 
sp|P19378|HSP7C_CRIGR  Heat shock cognate 71 kDa protein (Heat...  35.0    0.12 
sp|Q54215|DNAK_STRGR  Chaperone protein dnaK (Heat shock prote...  35.0    0.12 
sp|P64410|DNAK_TROW8  Chaperone protein dnaK (Heat shock prote...  35.0    0.12  
sp|P63018|HSP7C_RAT  Heat shock cognate 71 kDa protein (Heat s...  35.0    0.12  
sp|Q5NVM9|HSP7C_PONPY  Heat shock cognate 71 kDa protein (Heat...  35.0    0.12 
sp|P19120|HSP7C_BOVIN  Heat shock cognate 71 kDa protein (Heat...  35.0    0.12  
sp|A7GXU4.1|DNAK_CAMC5  Chaperone protein dnaK (Heat shock pro...  35.0    0.12 
sp|Q465Y6|DNAK_METBF  Chaperone protein dnaK (Heat shock prote...  35.0    0.12  
sp|P11142.1|HSP7C_HUMAN  Heat shock cognate 71 kDa protein (He...  35.0    0.12  
sp|Q45551|DNAK_BACST  Chaperone protein dnaK (Heat shock prote...  35.0    0.12 
sp|Q5UPU0|HSP7L_MIMIV  Heat shock protein 70 homolog               35.0    0.13 
sp|Q10265|HSP71_SCHPO  Probable heat shock protein ssa1            35.0    0.13 
sp|Q03WI2.1|DNAK_LEUMM  Chaperone protein dnaK (Heat shock pro...  35.0    0.13  
sp|P19208|HSP7C_CAEBR  Heat shock 70 kDa protein C precursor       35.0    0.13 
sp|Q5R4P0|GRP78_PONPY  78 kDa glucose-regulated protein precur...  35.0    0.13 
sp|O59855|HSP72_SCHPO  Probable heat shock protein ssa2            34.7    0.13 
sp|A4Y7D3.1|HSCA_SHEPC  Chaperone protein hscA homolog             34.7    0.14  
sp|Q080Q0.1|HSCA_SHEFN  Chaperone protein hscA homolog             34.7    0.14  
sp|Q01233|HSP70_NEUCR  Heat shock 70 kDa protein (HSP70)           34.7    0.14 
sp|A5CM86.1|DNAK_CLAM3  Chaperone protein dnaK (Heat shock pro...  34.7    0.14  
sp|Q1JA83.1|DNAK_STRPB  Chaperone protein dnaK (Heat shock pro...  34.7    0.14 
sp|Q8DKR6|DNAK1_SYNEL  Chaperone protein dnaK1 (Heat shock pro...  34.7    0.14 
sp|Q1JFC8.1|DNAK_STRPD  Chaperone protein dnaK (Heat shock pro...  34.7    0.14 
sp|Q5X3M7|DNAK_LEGPA  Chaperone protein dnaK (Heat shock prote...  34.7    0.14  
sp|Q5WV15|DNAK_LEGPL  Chaperone protein dnaK (Heat shock prote...  34.7    0.14  
sp|P27541|HSP70_BRUMA  Heat shock 70 kDa protein                   34.7    0.14 
sp|P0A3J2|DNAK_STRA3  Chaperone protein dnaK (Heat shock prote...  34.7    0.14 
sp|P27420|HSP7C_CAEEL  Heat shock 70 kDa protein C precursor       34.7    0.14  
sp|A1RJ56.1|HSCA_SHESW  Chaperone protein hscA homolog             34.7    0.14  
sp|O32482|DNAK_LEGPN  Chaperone protein dnaK (Heat shock prote...  34.7    0.14 
sp|P02827|HSP70_XENLA  Heat shock 70 kDa protein (HSP70)           34.7    0.14 
sp|Q1LPL1.1|HSCA_RALME  Chaperone protein hscA homolog             34.7    0.15  
sp|A5IDK8.1|DNAK_LEGPC  Chaperone protein dnaK (Heat shock pro...  34.7    0.15 
sp|Q8K624|DNAK_STRP3  Chaperone protein dnaK (Heat shock prote...  34.7    0.15 
sp|A0L4Z2.1|DNAK_MAGSM  Chaperone protein dnaK (Heat shock pro...  34.7    0.15  
sp|P29844|HSP7C_DROME  Heat shock 70 kDa protein cognate 3 pre...  34.7    0.15  
sp|Q05558|DNAK_STRCO  Chaperone protein dnaK (Heat shock prote...  34.7    0.15 
sp|P14834|HSP70_LEIMA  Heat shock 70 kDa protein                   34.7    0.15 
sp|Q60C59|HSCA_METCA  Chaperone protein hscA homolog               34.7    0.16 
sp|Q00043|HSP70_AJECA  Heat shock 70 kDa protein                   34.7    0.16 
sp|Q61696|HS70A_MOUSE  Heat shock 70 kDa protein 1A (Heat shoc...  34.7    0.16  
sp|P17879|HS70B_MOUSE  Heat shock 70 kDa protein 1B (HSP70.1)      34.7    0.16  
sp|Q05FS8.1|DNAK_CARRP  Chaperone protein dnaK (Heat shock pro...  34.7    0.16 
sp|Q9HRY2|DNAK_HALSA  Chaperone protein dnaK (Heat shock prote...  34.7    0.16 
sp|Q55154|DNAK1_SYNY3  Chaperone protein dnaK1 (Heat shock pro...  34.7    0.17  
sp|P11145|HSP74_TRYBB  Heat shock 70 kDa protein 4 (HSP70)         34.7    0.17 
sp|A7ZEB5.1|DNAK_CAMC1  Chaperone protein dnaK (Heat shock pro...  34.3    0.18 
sp|Q4FNP9|DNAK_PELUB  Chaperone protein dnaK (Heat shock prote...  34.3    0.18  
sp|Q71ZJ7|DNAK_LISMF  Chaperone protein dnaK (Heat shock prote...  34.3    0.18  
sp|P25840|HSP70_CHLRE  Heat shock 70 kDa protein                   34.3    0.18 
sp|P11147.3|HSP7D_DROME  Heat shock 70 kDa protein cognate 4 (...  34.3    0.18  
sp|Q48RR3|DNAK_STRPM  Chaperone protein dnaK (Heat shock prote...  34.3    0.18 
sp|Q1J578.1|DNAK_STRPF  Chaperone protein dnaK (Heat shock pro...  34.3    0.18 
sp|Q0HJF0.1|HSCA_SHESM  Chaperone protein hscA homolog             34.3    0.19  
sp|Q92BN8|DNAK_LISIN  Chaperone protein dnaK (Heat shock prote...  34.3    0.19 
sp|Q81LK0|SYA_BACAN  Alanyl-tRNA synthetase (Alanine--tRNA lig...  34.3    0.19 
sp|A5UAB3.1|HSCA_HAEIE  Chaperone protein hscA homolog             34.3    0.19 
sp|Q634F6|SYA_BACCZ  Alanyl-tRNA synthetase (Alanine--tRNA lig...  34.3    0.19  
sp|A4XKA4.1|DNAK_CALS8  Chaperone protein dnaK (Heat shock pro...  34.3    0.19  
sp|Q6G554|DNAK_BARHE  Chaperone protein dnaK (Heat shock prote...  34.3    0.19 
sp|Q6G1F9|DNAK_BARQU  Chaperone protein dnaK (Heat shock prote...  34.3    0.19 
sp|A5WI20.1|DNAK_PSYWF  Chaperone protein dnaK (Heat shock pro...  34.3    0.19  
sp|Q9W6Y1|HSP7C_ORYLA  Heat shock cognate 71 kDa protein (Hsc7...  34.3    0.19  
sp|P34930|HS70A_PIG  Heat shock 70 kDa protein 1A (HSP70.1)        34.3    0.20 
sp|Q99170|GRP78_YARLI  78 kDa glucose-regulated protein homolo...  34.3    0.20 
sp|Q9S5A4|DNAK_LISMO  Chaperone protein dnaK (Heat shock prote...  34.3    0.20 
sp|P0A3J1|DNAK_LACLM  Chaperone protein dnaK (Heat shock prote...  34.3    0.20  
sp|Q85FW4|DNAK_CYAME  Chaperone protein dnaK (Heat shock prote...  34.3    0.20 
sp|O27351|DNAK_METTH  Chaperone protein dnaK (Heat shock prote...  34.3    0.20  
sp|Q473J2.1|HSCA_RALEJ  Chaperone protein hscA homolog             34.3    0.21  
sp|Q90593|GRP78_CHICK  78 kDa glucose-regulated protein precur...  34.3    0.21  
sp|A0AIS4.1|DNAK_LISW6  Chaperone protein dnaK (Heat shock pro...  34.3    0.21  
sp|Q31HA7.1|DNAK_THICR  Chaperone protein dnaK (Heat shock pro...  34.3    0.21  
sp|P16627|HS70L_MOUSE  Heat shock 70 kDa protein 1L (Heat shoc...  34.3    0.21  
sp|Q02ZQ7.1|DNAK_LACLS  Chaperone protein dnaK (Heat shock pro...  34.3    0.21  
sp|Q82EX9|DNAK1_STRAW  Chaperone protein dnaK1 (Heat shock pro...  34.3    0.21 
sp|A0KXI6.1|HSCA_SHESA  Chaperone protein hscA homolog             34.3    0.21  
sp|A1T2S3.1|DNAK_MYCVP  Chaperone protein dnaK (Heat shock pro...  34.3    0.22  
sp|Q07439|HSP71_RAT  Heat shock 70 kDa protein 1A/1B (Heat sho...  34.3    0.22  
sp|A4G782.1|HSCA_HERAR  Chaperone protein hscA homolog             34.3    0.23 
sp|Q0KCG7.1|HSCA_RALEH  Chaperone protein hscA homolog             34.3    0.23 
sp|Q9U639|HSP7D_MANSE  Heat shock 70 kDa protein cognate 4 (Hs...  34.3    0.23 
sp|Q7WK59|HSCA_BORBR  Chaperone protein hscA homolog               33.9    0.23 
sp|P34931|HS70L_HUMAN  Heat shock 70 kDa protein 1L (Heat shoc...  33.9    0.23  
sp|P55063|HS70L_RAT  Heat shock 70 kDa protein 1L (Heat shock ...  33.9    0.23  
sp|Q8YUA6|DNAK3_ANASP  Chaperone protein dnaK3 (Heat shock pro...  33.9    0.23  
sp|A6SXE9.1|HSCA_JANMA  Chaperone protein hscA homolog             33.9    0.23 
sp|P24629|HSP71_LYCES  Heat shock cognate 70 kDa protein 1         33.9    0.23 
sp|P29215|DNAK_GUITH  Chaperone protein dnaK (Heat shock prote...  33.9    0.24  
sp|O52960|DNAK_APHHA  Chaperone protein dnaK (Heat shock prote...  33.9    0.24 
sp|P41825|HSP71_ANOAL  Heat shock protein 70 A1                    33.9    0.24 
sp|P41826|HSP72_ANOAL  Heat shock protein 70 A2                    33.9    0.24 
sp|Q87S24|HSCA_VIBPA  Chaperone protein hscA homolog               33.9    0.25 
sp|P36604|GRP78_SCHPO  78 kDa glucose-regulated protein homolo...  33.9    0.26 
sp|Q03FR7.1|DNAK_PEDPA  Chaperone protein dnaK (Heat shock pro...  33.9    0.26  
sp|Q7VMA4|HSCA_HAEDU  Chaperone protein hscA homolog               33.9    0.26 
sp|P22953|HSP71_ARATH  Heat shock cognate 70 kDa protein 1 (Hs...  33.9    0.27  
sp|A0QQC8.1|DNAK_MYCS2  Chaperone protein dnaK (Heat shock pro...  33.9    0.27  
sp|Q6D263|HSCA_ERWCT  Chaperone protein hscA (Hsc66)               33.9    0.27 
sp|P22954|HSP72_ARATH  Heat shock cognate 70 kDa protein 2 (Hs...  33.9    0.27  
sp|Q4JXX6|DNAK_CORJK  Chaperone protein dnaK (Heat shock prote...  33.9    0.28  
sp|A6Q421.1|DNAK_NITSB  Chaperone protein dnaK (Heat shock pro...  33.9    0.28 
sp|Q0RBC4.1|DNAK_FRAAA  Chaperone protein dnaK (Heat shock pro...  33.9    0.28  
sp|Q6AC76|DNAK_LEIXX  Chaperone protein dnaK (Heat shock prote...  33.9    0.28 
sp|A0KMI6.1|DNAK_AERHH  Chaperone protein dnaK (Heat shock pro...  33.9    0.28 
sp|Q892R0|DNAK_CLOTE  Chaperone protein dnaK (Heat shock prote...  33.9    0.28 
sp|Q42434|BIP_SPIOL  Luminal-binding protein precursor (BiP) (...  33.9    0.29 
sp|Q02FR1.1|DNAK_PSEAB  Chaperone protein dnaK (Heat shock pro...  33.9    0.30 
sp|Q826F6|DNAK2_STRAW  Chaperone protein dnaK2 (Heat shock pro...  33.5    0.30 
sp|A6VCL8.1|DNAK_PSEA7  Chaperone protein dnaK (Heat shock pro...  33.5    0.31 
sp|O24581|BIP3_MAIZE  Luminal-binding protein 3 precursor (BiP3)   33.5    0.31  
sp|Q9ZAD3|DNAK_PORGI  Chaperone protein dnaK (Heat shock prote...  33.5    0.31 
sp|P08418.2|HSP70_SCHMA  Heat shock 70 kDa protein homolog (HS...  33.5    0.31 
sp|Q8Y0L9|HSCA_RALSO  Chaperone protein hscA homolog               33.5    0.32 
sp|P17156|HSP72_MOUSE  Heat shock-related 70 kDa protein 2 (He...  33.5    0.32  
sp|A0PLQ1.1|DNAK_MYCUA  Chaperone protein dnaK (Heat shock pro...  33.5    0.32  
sp|Q7UM31|DNAK_RHOBA  Chaperone protein dnaK (Heat shock prote...  33.5    0.32 
sp|Q9HG01|GRP78_PICAN  78 kDa glucose-regulated protein homolo...  33.5    0.32 
sp|P24067|BIP2_MAIZE  Luminal-binding protein 2 precursor (BiP...  33.5    0.32  
sp|Q16956|GRP78_APLCA  78 kDa glucose-regulated protein precur...  33.5    0.32 
sp|A8EWT6.1|DNAK_ARCB4  Chaperone protein dnaK (Heat shock pro...  33.5    0.33 
sp|Q01100|DNAK_HALMA  Chaperone protein dnaK (Heat shock prote...  33.5    0.33 
sp|A4VPQ5.1|DNAK_PSEU5  Chaperone protein dnaK (Heat shock pro...  33.5    0.34 
sp|P05646|DNAK_BACME  Chaperone protein dnaK (Heat shock prote...  33.5    0.34 
sp|Q18GZ4.1|DNAK_HALWD  Chaperone protein dnaK (Heat shock pro...  33.5    0.34 
sp|Q9LKR3.1|BIP1_ARATH  Luminal-binding protein 1 precursor (B...  33.5    0.34  
sp|Q5PAB8|DNAK_ANAMM  Chaperone protein dnaK (Heat shock prote...  33.5    0.34  
sp|Q03685|BIP5_TOBAC  Luminal-binding protein 5 precursor (BiP...  33.5    0.34 
sp|P54652|HSP72_HUMAN  Heat shock-related 70 kDa protein 2 (He...  33.5    0.34  
sp|A7MU49.1|HSCA_VIBHB  Chaperone protein hscA homolog             33.5    0.35 
sp|P14659|HSP72_RAT  Heat shock-related 70 kDa protein 2 (Heat...  33.5    0.35  
sp|Q03684|BIP4_TOBAC  Luminal-binding protein 4 precursor (BiP...  33.5    0.35 
sp|A5F3G8.1|HSCA_VIBC3  Chaperone protein hscA homolog >sp|Q9K...  33.5    0.35 
sp|P34933|HSP72_BOVIN  Heat shock-related 70 kDa protein 2 (He...  33.5    0.36  
sp|P49118|BIP_LYCES  Luminal-binding protein precursor (BiP) (...  33.5    0.36  
sp|P16394|HSP70_BRELC  Heat shock 70 kDa protein                   33.5    0.36 
sp|Q75E44|HSP75_ASHGO  Heat shock protein SSB                      33.5    0.37 
sp|Q39043|BIP2_ARATH  Luminal-binding protein 2 precursor (BiP...  33.5    0.37  
sp|P20442|DNAK_CAUCR  Chaperone protein dnaK (Heat shock prote...  33.5    0.37 
sp|Q15WH0.1|HSCA_PSEA6  Chaperone protein hscA homolog             33.5    0.37  
sp|P78695|GRP78_NEUCR  78 kDa glucose-regulated protein homolo...  33.5    0.37 
sp|Q9TUG3|HSP72_CAPHI  Heat shock-related 70 kDa protein 2 (He...  33.5    0.38 
sp|O96772|HSP70_ENCCU  Mitochondrial-type heat shock protein 7...  33.5    0.38 
sp|Q6BZH1|GRP78_DEBHA  78 kDa glucose-regulated protein homolo...  33.5    0.38 
sp|Q05746|HSP70_PLACB  Heat shock 70 kDa protein (HSP70) (Cyto...  33.5    0.38 
sp|Q5YNI0|DNAK_NOCFA  Chaperone protein dnaK (Heat shock prote...  33.5    0.39 
sp|Q89YW6|DNAK_BACTN  Chaperone protein dnaK (Heat shock prote...  33.5    0.39 
sp|P16474|GRP78_YEAST  78 kDa glucose-regulated protein homolo...  33.5    0.39  
sp|P11144|HSP70_PLAFA  Heat shock 70 kDa protein (HSP70) (Cyto...  33.1    0.39 
sp|Q1BEV1.1|DNAK_MYCSS  Chaperone protein dnaK (Heat shock pro...  33.1    0.40  
sp|Q74H59|DNAK_GEOSL  Chaperone protein dnaK (Heat shock prote...  33.1    0.40 
sp|Q9KWS7|DNAK_BACTR  Chaperone protein dnaK (Heat shock prote...  33.1    0.42 
sp|A1SPX5.1|DNAK_NOCSJ  Chaperone protein dnaK (Heat shock pro...  33.1    0.42  
sp|A1K724.1|HSCA_AZOSB  Chaperone protein hscA homolog             33.1    0.42  
sp|Q6C061.1|ARP4_YARLI  Actin-related protein 4 (Actin-like pr...  33.1    0.42 
sp|P05456|HSP70_TRYCR  Heat shock 70 kDa protein                   33.1    0.43 
sp|Q7VXG7|HSCA_BORPE  Chaperone protein hscA homolog               33.1    0.44 
sp|P41827|HSP74_ANOAL  Heat shock protein 70 B2                    33.1    0.44 
sp|A0RZ01.1|DNAK_CENSY  Chaperone protein dnaK (Heat shock pro...  33.1    0.45 
sp|Q3YRR6|DNAK_EHRCJ  Chaperone protein dnaK (Heat shock prote...  33.1    0.45  
sp|Q6HDD7|SYA_BACHK  Alanyl-tRNA synthetase (Alanine--tRNA lig...  33.1    0.45 
sp|Q6FW50|GRP78_CANGA  78 kDa glucose-regulated protein homolo...  33.1    0.45 
sp|P09435|HSP73_YEAST  Heat shock protein SSA3                     33.1    0.45  
sp|Q667Y5|HSCA_YERPS  Chaperone protein hscA (Hsc66)               33.1    0.45 
sp|Q5NYT1|HSCA_AZOSE  Chaperone protein hscA homolog               33.1    0.46  
sp|O67118|DNAK_AQUAE  Chaperone protein dnaK (Heat shock prote...  33.1    0.46 
sp|Q8ZCS5|HSCA_YERPE  Chaperone protein hscA (Hsc66)               33.1    0.46 
sp|Q4ZX30.1|HSCA_PSEU2  Chaperone protein hscA homolog             33.1    0.46 
sp|Q493S7|DNAK_BLOPB  Chaperone protein dnaK (Heat shock prote...  33.1    0.47  
sp|P87222|HSP75_CANAL  Heat shock protein SSB1                     33.1    0.47 
sp|P10591|HSP71_YEAST  Heat shock protein SSA1 (Heat shock pro...  33.1    0.47  
sp|O73885.1|HSP7C_CHICK  Heat shock cognate 71 kDa protein (He...  33.1    0.48  
sp|Q5LG30|DNAK_BACFN  Chaperone protein dnaK (Heat shock prote...  33.1    0.48  
sp|Q6CQ83|HSP75_KLULA  Heat shock protein SSB                      33.1    0.48 
sp|Q4G366|DNAK_EMIHU  Chaperone protein dnaK (Heat shock prote...  33.1    0.48  
sp|P48205|DNAK_FRATU  Chaperone protein dnaK (Heat shock prote...  33.1    0.50 
sp|Q8FM78|DNAK_COREF  Chaperone protein dnaK (Heat shock prote...  33.1    0.50 
sp|Q91291|HSP70_PLEWA  Heat shock 70 kDa protein (HSP70)           33.1    0.50 
sp|P10592|HSP72_YEAST  Heat shock protein SSA2                     32.7    0.51  
sp|A6GXZ1.1|DNAK_FLAPJ  Chaperone protein dnaK (Heat shock pro...  32.7    0.52  
sp|Q08080|HSP7S_SPIOL  Stromal 70 kDa heat shock-related prote...  32.7    0.52 
sp|Q21H36.1|DNAK_SACD2  Chaperone protein dnaK (Heat shock pro...  32.7    0.53  
sp|Q5HAY1|DNAK_EHRRW  Chaperone protein dnaK (Heat shock prote...  32.7    0.53  
sp|P59769|GRP78_ASPAW  78 kDa glucose-regulated protein homolo...  32.7    0.53 
sp|P41797|HSP71_CANAL  Heat shock protein SSA1                     32.7    0.53 
sp|Q75C78|GRP78_ASHGO  78 kDa glucose-regulated protein homolo...  32.7    0.53 
sp|A0Q7F0.1|DNAK_FRATN  Chaperone protein dnaK (Heat shock pro...  32.7    0.54 
sp|Q3ZYV1|DNAK_DEHSC  Chaperone protein dnaK (Heat shock prote...  32.7    0.54  
sp|Q24895|GRP78_ECHMU  78 kDa glucose-regulated protein precur...  32.7    0.54 
sp|Q3Z6P1|DNAK_DEHE1  Chaperone protein dnaK (Heat shock prote...  32.7    0.54  
sp|Q0BLK4.1|DNAK_FRATO  Chaperone protein dnaK (Heat shock pro...  32.7    0.54 
sp|Q88PK4|HSCA_PSEPK  Chaperone protein hscA homolog               32.7    0.54  
sp|A4IX28.1|DNAK_FRATW  Chaperone protein dnaK (Heat shock pro...  32.7    0.55  
sp|A6LM32.1|DNAK_THEM4  Chaperone protein dnaK (Heat shock pro...  32.7    0.55 
sp|Q14GW9.1|DNAK_FRAT1  Chaperone protein dnaK (Heat shock pro...  32.7    0.55  
sp|Q707W3|HSP75_KLUDE  Heat shock protein SSB                      32.7    0.55 
sp|A4J7F3.1|DNAK_DESRM  Chaperone protein dnaK (Heat shock pro...  32.7    0.55  
sp|P22202|HSP74_YEAST  Heat shock protein SSA4                     32.7    0.56  
sp|P59565|DNAK_BUCBP  Chaperone protein dnaK (Heat shock prote...  32.7    0.56 
sp|P18694|HSP72_USTMA  Heat shock 70 kDa protein 2                 32.7    0.56 
sp|Q876N3|HSP75_CANGA  Heat shock protein SSB                      32.7    0.56 
sp|A4QHJ0.1|DNAK_CORGB  Chaperone protein dnaK (Heat shock pro...  32.7    0.57 
sp|Q8NLY6|DNAK_CORGL  Chaperone protein dnaK (Heat shock prote...  32.7    0.57 
sp|P09446|HSP7A_CAEEL  Heat shock 70 kDa protein A                 32.7    0.57  
sp|P22010|GRP78_KLULA  78 kDa glucose-regulated protein homolo...  32.7    0.57 
sp|Q5FFM4|DNAK_EHRRG  Chaperone protein dnaK (Heat shock prote...  32.7    0.58  
sp|A4XY39.1|HSCA_PSEMY  Chaperone protein hscA homolog             32.7    0.58 
sp|P47773|HSP7C_ICTPU  Heat shock cognate 71 kDa protein           32.7    0.58 
sp|Q145F1.1|DNAK_BURXL  Chaperone protein dnaK (Heat shock pro...  32.7    0.59  
sp|Q9LCQ5|DNAK_BRECH  Chaperone protein dnaK (Heat shock prote...  32.7    0.59 
sp|Q24798|GRP78_ECHGR  78 kDa glucose-regulated protein precur...  32.7    0.59 
sp|Q3K7A9.1|HSCA_PSEPF  Chaperone protein hscA homolog             32.7    0.59  
sp|P46587|HSP72_CANAL  Heat shock protein SSA2                     32.7    0.61 
sp|A4VNX8.1|HSCA_PSEU5  Chaperone protein hscA homolog             32.7    0.61 
sp|Q12P79.1|HSCA_SHEDO  Chaperone protein hscA homolog             32.7    0.62  
sp|P40150|HSP76_YEAST  Heat shock protein SSB2                     32.7    0.62  
sp|P77319.1|HSCC_ECOLI  Chaperone protein hscC (Hsc62)             32.7    0.62 
sp|Q0BW82.1|DNAK_GRABC  Chaperone protein dnaK (Heat shock pro...  32.7    0.62 
sp|P11484|HSP75_YEAST  Heat shock protein SSB1 (Cold-inducible...  32.7    0.63  
sp|P48720|HSP70_BLAEM  Heat shock 70 kDa protein                   32.7    0.64 
sp|Q02RW4.1|HSCA_PSEAB  Chaperone protein hscA homolog             32.7    0.64 
sp|Q4K6U2.1|HSCA_PSEF5  Chaperone protein hscA homolog             32.7    0.64 
sp|Q07437|HSP70_LEIAM  Heat shock 70 kDa protein                   32.7    0.64 
sp|Q182E8.1|DNAK_CLOD6  Chaperone protein dnaK (Heat shock pro...  32.7    0.65  
sp|Q51382|HSCA_PSEAE  Chaperone protein hscA homolog               32.7    0.65 
sp|Q48M01.1|HSCA_PSE14  Chaperone protein hscA homolog             32.7    0.65  
sp|P12077|HSP74_LEIMA  Heat shock 70-related protein 4             32.7    0.65 
sp|P17066|HSP76_HUMAN  Heat shock 70 kDa protein 6 (Heat shock...  32.7    0.65  
sp|Q97BG8|DNAK_THEVO  Chaperone protein dnaK (Heat shock prote...  32.7    0.66 
sp|Q10284|HSP75_SCHPO  Heat shock protein sks2 (Heat shock cog...  32.3    0.66 
sp|O97125|HSP68_DROME  Heat shock protein 68                       32.3    0.67  
sp|P61697|SYA_BACC1  Alanyl-tRNA synthetase (Alanine--tRNA lig...  32.3    0.68  
sp|Q11KJ6.1|DNAK_MESSB  Chaperone protein dnaK (Heat shock pro...  32.3    0.68  
sp|A6V0V2.1|HSCA_PSEA7  Chaperone protein hscA homolog             32.3    0.68 
sp|P08106|HSP70_CHICK  Heat shock 70 kDa protein (HSP70)           32.3    0.68  
sp|P50023|DNAK_THEAC  Chaperone protein dnaK (Heat shock prote...  32.3    0.68 
sp|Q1XDH2|DNAK_PORYE  Chaperone protein dnaK (Heat shock prote...  32.3    0.69  
sp|Q707X3|HSP75_ZYGRO  Heat shock protein SSB                      32.3    0.69 
sp|Q0AKB1.1|DNAK_MARMM  Chaperone protein dnaK (Heat shock pro...  32.3    0.70 
sp|Q2KDW6.1|DNAK_RHIEC  Chaperone protein dnaK (Heat shock pro...  32.3    0.71 
sp|Q1IEI8.1|HSCA_PSEE4  Chaperone protein hscA homolog             32.3    0.72 
sp|A8IPT1.1|DNAK_AZOC5  Chaperone protein dnaK (Heat shock pro...  32.3    0.72 
sp|Q05647|DNAK_ERYRH  Chaperone protein dnaK (Heat shock prote...  32.3    0.72 
sp|Q13E60.1|DNAK_RHOPS  Chaperone protein dnaK (Heat shock pro...  32.3    0.72  
sp|Q2GF34.1|DNAK_NEOSM  Chaperone protein dnaK (Heat shock pro...  32.3    0.73 
sp|A7HZ39.1|DNAK_PARL1  Chaperone protein dnaK (Heat shock pro...  32.3    0.73 
sp|Q7MNF8|HSCA_VIBVY  Chaperone protein hscA homolog               32.3    0.74  
sp|Q8DEZ1|HSCA_VIBVU  Chaperone protein hscA homolog               32.3    0.75 
sp|P69376|DNAK_PORPU  Chaperone protein dnaK (Heat shock prote...  32.3    0.75  
sp|Q1MN11.1|DNAK_RHIL3  Chaperone protein dnaK (Heat shock pro...  32.3    0.76  
sp|Q16D45.1|DNAK_ROSDO  Chaperone protein dnaK (Heat shock pro...  32.3    0.76 
sp|Q9N1U2|HSP76_SAGOE  Heat shock 70 kDa protein 6 (Hsp-70-rel...  32.3    0.76 
sp|A0K1L3.1|DNAK_ARTS2  Chaperone protein dnaK (Heat shock pro...  32.3    0.76  
sp|A1B4E9.1|DNAK_PARDP  Chaperone protein dnaK (Heat shock pro...  32.3    0.77  
sp|Q2VYT1.1|DNAK_MAGMM  Chaperone protein dnaK (Heat shock pro...  32.3    0.78 
sp|Q04967|HSP76_PIG  Heat shock 70 kDa protein 6 (Heat shock 7...  32.3    0.79  
sp|O93866|HSP70_TRIRU  Heat shock 70 kDa protein                   32.3    0.79 
sp|Q886Z7|HSCA_PSESM  Chaperone protein hscA homolog               32.3    0.80 
sp|P71331|DNAK_ACTAC  Chaperone protein dnaK (Heat shock prote...  32.3    0.80 
sp|Q5LWJ6|DNAK_SILPO  Chaperone protein dnaK (Heat shock prote...  32.3    0.80 
sp|O05700|DNAK_RHOS7  Chaperone protein dnaK (Heat shock prote...  32.3    0.80 
sp|Q8YE76|DNAK_BRUME  Chaperone protein dnaK (Heat shock prote...  32.3    0.80 
sp|Q2G6N0.1|DNAK_NOVAD  Chaperone protein dnaK (Heat shock pro...  32.3    0.81  
sp|P30721|DNAK_CLOAB  Chaperone protein dnaK (Heat shock prote...  32.3    0.81 
sp|Q52701|DNAK_RHOCA  Chaperone protein dnaK (Heat shock prote...  32.3    0.81 
sp|Q8FXX2|DNAK_BRUSU  Chaperone protein dnaK (Heat shock prote...  32.3    0.81 
sp|A4WW89.1|DNAK_RHOS5  Chaperone protein dnaK (Heat shock pro...  32.3    0.81  
sp|A6L2X7.1|DNAK_BACV8  Chaperone protein dnaK (Heat shock pro...  32.3    0.82 
sp|P29843|HSP7A_DROME  Heat shock 70 kDa protein cognate 1 (He...  32.3    0.82  
sp|Q2J320.1|DNAK_RHOP2  Chaperone protein dnaK (Heat shock pro...  32.3    0.83  
sp|Q05981.2|DNAK_BRUO2  Chaperone protein dnaK (Heat shock pro...  32.3    0.83  
sp|Q0BWZ9.1|DNAK_HYPNA  Chaperone protein dnaK (Heat shock pro...  32.3    0.84  
sp|Q4ZNP7|DNAK_PSEU2  Chaperone protein dnaK (Heat shock prote...  32.3    0.84  
sp|Q5NPS6|DNAK_ZYMMO  Chaperone protein dnaK (Heat shock prote...  32.3    0.84 
sp|P91902|HSP70_CERCA  Heat shock protein 70 (HSP70)               32.3    0.85 
sp|Q3IYM7|DNAK_RHOS4  Chaperone protein dnaK (Heat shock prote...  32.3    0.86  
sp|Q7U3C4|DNAK2_SYNPX  Chaperone protein dnaK2 (Heat shock pro...  32.3    0.86  
sp|A3PNM1.1|DNAK_RHOS1  Chaperone protein dnaK (Heat shock pro...  32.3    0.86  
sp|Q28VY3.1|DNAK_JANSC  Chaperone protein dnaK (Heat shock pro...  32.0    0.87  
sp|Q48E62|DNAK_PSE14  Chaperone protein dnaK (Heat shock prote...  32.0    0.87  
sp|Q6NCY4|DNAK_RHOPA  Chaperone protein dnaK (Heat shock prote...  32.0    0.87 
sp|Q9UXR0|DNAK_METTE  Chaperone protein dnaK (Heat shock prote...  32.0    0.87 
sp|Q07US6.1|DNAK_RHOP5  Chaperone protein dnaK (Heat shock pro...  32.0    0.87  
sp|Q2KWA2.1|DNAK_BORA1  Chaperone protein dnaK (Heat shock pro...  32.0    0.88 
sp|Q3SIN4|DNAK_THIDA  Chaperone protein dnaK (Heat shock prote...  32.0    0.88  
sp|Q1QRU1.1|DNAK_NITHX  Chaperone protein dnaK (Heat shock pro...  32.0    0.88  
sp|Q1GKS3.1|DNAK_SILST  Chaperone protein dnaK (Heat shock pro...  32.0    0.88  
sp|P22623|HSP72_PARLI  Heat shock 70 kDa protein II (HSP70 II)     32.0    0.89 
sp|P94317|DNAK_BRAJA  Chaperone protein dnaK (Heat shock prote...  32.0    0.90 
sp|Q98DD1|DNAK_RHILO  Chaperone protein dnaK (Heat shock prote...  32.0    0.90 
sp|A5V5P9.1|DNAK_SPHWW  Chaperone protein dnaK (Heat shock pro...  32.0    0.92 
sp|O69221|HSCA_AZOVI  Chaperone protein hscA homolog               32.0    0.92 
sp|Q21CI2.1|DNAK_RHOPB  Chaperone protein dnaK (Heat shock pro...  32.0    0.93  
sp|Q0I3V2.1|DNAK_HAES1  Chaperone protein dnaK (Heat shock pro...  32.0    0.94  
sp|Q3SW76|DNAK_NITWN  Chaperone protein dnaK (Heat shock prote...  32.0    0.95  
sp|A6TSM0.1|DNAK_ALKMQ  Chaperone protein dnaK (Heat shock pro...  32.0    0.97 
sp|P48209|DNAK_HAEDU  Chaperone protein dnaK (Heat shock prote...  32.0    0.98 
sp|Q8RB68|DNAK_THETN  Chaperone protein dnaK (Heat shock prote...  32.0    1.0  
sp|Q5UQ49.1|HSP70_MIMIV  Heat shock 70 kDa protein homolog         32.0    1.0   
sp|Q01877|HSP71_PUCGR  Heat shock protein HSS1                     32.0    1.0  
sp|Q37106|DNAK_CYAPA  Chaperone protein dnaK (Heat shock prote...  32.0    1.0   
sp|A6QBG0.1|DNAK_SULNB  Chaperone protein dnaK (Heat shock pro...  32.0    1.1  
sp|Q1LST3.1|DNAK_BAUCH  Chaperone protein dnaK (Heat shock pro...  32.0    1.1  
sp|Q7V3T5|DNAK2_PROMM  Chaperone protein dnaK2 (Heat shock pro...  32.0    1.1   
sp|O32464|DNAK_BUCAI  Chaperone protein dnaK (Heat shock prote...  32.0    1.1  
sp|Q46I76|DNAK_PROMT  Chaperone protein dnaK (Heat shock prote...  32.0    1.1   
sp|Q7U6R7|DNAK1_SYNPX  Chaperone protein dnaK1 (Heat shock pro...  32.0    1.1   
sp|P37899|HSP70_PYRSA  Heat shock 70 kDa protein                   32.0    1.1  
sp|Q9KD72|DNAK_BACHD  Chaperone protein dnaK (Heat shock prote...  32.0    1.1  
sp|P50019|DNAK_AGRT5  Chaperone protein dnaK (Heat shock prote...  32.0    1.1   
sp|Q3J7D8|DNAK_NITOC  Chaperone protein dnaK (Heat shock prote...  32.0    1.1   
sp|Q7VQL4|DNAK_BLOFL  Chaperone protein dnaK (Heat shock prote...  32.0    1.1   
sp|P42374|DNAK_RHIME  Chaperone protein dnaK (Heat shock prote...  32.0    1.1  
sp|Q6F6N3|DNAK_ACIAD  Chaperone protein dnaK (Heat shock prote...  32.0    1.1   
sp|Q87WP0|DNAK_PSESM  Chaperone protein dnaK (Heat shock prote...  32.0    1.1  
sp|A1WX31.1|DNAK_HALHL  Chaperone protein dnaK (Heat shock pro...  31.6    1.1   
sp|Q08276|HSP7M_SOLTU  Heat shock 70 kDa protein, mitochondria...  31.6    1.2  
sp|Q8D2Q5|DNAK_WIGBR  Chaperone protein dnaK (Heat shock prote...  31.6    1.2   
sp|Q7V9G2|DNAK2_PROMA  Chaperone protein dnaK2 (Heat shock pro...  31.6    1.2  
sp|A2BZ91.1|DNAK_PROM5  Chaperone protein dnaK (Heat shock pro...  31.6    1.2  
sp|A6UEY0.1|DNAK_SINMW  Chaperone protein dnaK (Heat shock pro...  31.6    1.2  
sp|Q8K9Y8|DNAK_BUCAP  Chaperone protein dnaK (Heat shock prote...  31.6    1.2  
sp|A0QLZ6.1|DNAK_MYCA1  Chaperone protein dnaK (Heat shock pro...  31.6    1.2   
sp|Q39PT7.1|DNAK_GEOMG  Chaperone protein dnaK (Heat shock pro...  31.6    1.2   
sp|Q47TI0|DNAK_THEFY  Chaperone protein dnaK (Heat shock prote...  31.6    1.2   
sp|P30722|DNAK_PAVLU  Chaperone protein dnaK (Heat shock prote...  31.6    1.2  
sp|Q00488|DNAK_MYCPA  Chaperone protein dnaK (Heat shock prote...  31.6    1.2  
sp|Q7UZG3|DNAK2_PROMP  Chaperone protein dnaK2 (Heat shock pro...  31.6    1.2   
sp|A1KFH2.1|DNAK_MYCBP  Chaperone protein dnaK (Heat shock pro...  31.6    1.3  
sp|Q9ZDX9|DNAK_RICPR  Chaperone protein dnaK (Heat shock prote...  31.6    1.3  
sp|Q01PM8.1|DNAK_SOLUE  Chaperone protein dnaK (Heat shock pro...  31.6    1.4   
sp|Q2LUH6.1|DNAK_SYNAS  Chaperone protein dnaK (Heat shock pro...  31.6    1.4  
sp|O85282|DNAK_EHRSE  Chaperone protein dnaK (Heat shock prote...  31.6    1.4  
sp|A4SQ25.1|DNAK_AERS4  Chaperone protein dnaK (Heat shock pro...  31.6    1.4   
sp|Q5R7A9|LYAG_PONPY  Lysosomal alpha-glucosidase precursor (A...  31.6    1.4  
sp|Q7VVY2|DNAK_BORPE  Chaperone protein dnaK (Heat shock prote...  31.6    1.4  
sp|Q7WGI4|DNAK_BORBR  Chaperone protein dnaK (Heat shock prote...  31.6    1.4  
sp|P41770|HSP75_KLUMA  Heat shock protein SSB                      31.6    1.4  
sp|Q68XI2|DNAK_RICTY  Chaperone protein dnaK (Heat shock prote...  31.6    1.4  
sp|Q06248|HSP74_PARLI  Heat shock 70 kDa protein IV (HSP70 IV)     31.6    1.4  
sp|P50021|DNAK2_SYNP7  Chaperone protein dnaK2 (Heat shock pro...  31.6    1.5   
sp|Q0W874.1|DNAK_UNCMA  Chaperone protein dnaK (Heat shock pro...  31.2    1.5  
sp|Q92J36|DNAK_RICCN  Chaperone protein dnaK (Heat shock prote...  31.2    1.5  
sp|Q73GL7|DNAK_WOLPM  Chaperone protein dnaK (Heat shock prote...  31.2    1.5  
sp|Q3APD2|DNAK_CHLCH  Chaperone protein dnaK (Heat shock prote...  31.2    1.5   
sp|P26413|HSP70_SOYBN  Heat shock 70 kDa protein                   31.2    1.5  
sp|P41753|HSP70_ACHKL  Heat shock 70 kDa protein                   31.2    1.5  
sp|Q9ZMW4|DNAK_HELPJ  Chaperone protein dnaK (Heat shock prote...  31.2    1.6   
sp|P10253|LYAG_HUMAN  Lysosomal alpha-glucosidase precursor (A...  31.2    1.6   
sp|A8GR22.1|DNAK_RICRS  Chaperone protein dnaK (Heat shock pro...  31.2    1.6  
sp|A8GMF9.1|DNAK_RICAH  Chaperone protein dnaK (Heat shock pro...  31.2    1.6  
sp|Q1RHH0|DNAK_RICBR  Chaperone protein dnaK (Heat shock prote...  31.2    1.6   
sp|Q57TP3|DNAK_SALCH  Chaperone protein dnaK (Heat shock prote...  31.2    1.6  
sp|Q5GSE1|DNAK_WOLTR  Chaperone protein dnaK (Heat shock prote...  31.2    1.6   
sp|P48741.2|HSP77_HUMAN  Putative heat shock 70 kDa protein 7 ...  31.2    1.6   
sp|Q06W39|DNAK_PORHA  Chaperone protein dnaK (Heat shock prote...  31.2    1.6  
sp|Q2RNE6.1|DNAK_RHORT  Chaperone protein dnaK (Heat shock pro...  31.2    1.6   
sp|P11146|HSP7B_DROME  Heat shock 70 kDa protein cognate 2 (He...  31.2    1.6   
sp|Q56073|DNAK_SALTY  Chaperone protein dnaK (Heat shock prote...  31.2    1.6  
sp|Q4KIH1|DNAK_PSEF5  Chaperone protein dnaK (Heat shock prote...  31.2    1.6   
sp|P0A6Y8.2|DNAK_ECOLI  Chaperone protein dnaK (Heat shock pro...  31.2    1.6  
sp|A8ALU3.1|DNAK_CITK8  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|Q0T8H6.1|DNAK_SHIF8  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|P95334|DNAK_MYXXD  Chaperone protein dnaK (Heat shock prote...  31.2    1.7   
sp|Q96VB9|HSP7F_CANAL  Heat shock protein homolog SSE1 (Chaper...  31.2    1.7  
sp|A7ZVV7.1|DNAK_ECOHS  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|Q0SRE3.1|DNAK_CLOPS  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|Q8Z9R1|DNAK_SALTI  Chaperone protein dnaK (Heat shock prote...  31.2    1.7  
sp|A8G9K8.1|DNAK_SERP5  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|A6T4F4.1|DNAK_KLEP7  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|A7FXL5.1|DNAK_CLOB1  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|A4W6D5.1|DNAK_ENT38  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|Q65U55|DNAK_MANSM  Chaperone protein dnaK (Heat shock prote...  31.2    1.7  
sp|Q2S307.1|DNAK_SALRD  Chaperone protein dnaK (Heat shock pro...  31.2    1.7  
sp|Q0TNS7.1|DNAK_CLOP1  Chaperone protein dnaK (Heat shock pro...  31.2    1.7   
sp|O30156|ARGD_ARCFU  Acetylornithine aminotransferase (ACOAT)     31.2    1.8  
sp|A1A3P5.1|DNAK_BIFAA  Chaperone protein dnaK (Heat shock pro...  31.2    1.8  
sp|A5W9A3.1|DNAK_PSEP1  Chaperone protein dnaK (Heat shock pro...  31.2    1.8  
sp|P22358|DNAK2_SYNY3  Chaperone protein dnaK2 (Heat shock pro...  31.2    1.8   
sp|O86103|DNAK_AQUPY  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|A7FME3.1|DNAK_YERP3  Chaperone protein dnaK (Heat shock pro...  31.2    1.8   
sp|Q6D0B7|DNAK_ERWCT  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|Q7N8Y4|DNAK_PHOLL  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|O52064|DNAK_PASHA  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|A7MIK5.1|DNAK_ENTS8  Chaperone protein dnaK (Heat shock pro...  31.2    1.8  
sp|Q9L7Z1|DNAK_VIBPR  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|Q607A5|DNAK_METCA  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|P57870|DNAK_PASMU  Chaperone protein dnaK (Heat shock prote...  31.2    1.8  
sp|P73098|DNAK3_SYNY3  Chaperone protein dnaK3 (Heat shock pro...  31.2    1.8  
sp|Q885K0|ARGD1_PSESM  Acetylornithine aminotransferase 1 (ACO...  31.2    1.8  
sp|Q3B577.1|DNAK_PELLD  Chaperone protein dnaK (Heat shock pro...  31.2    1.8   
sp|Q1CMV7.1|DNAK_YERPN  Chaperone protein dnaK (Heat shock pro...  31.2    1.8   
sp|Q6P7A9|LYAG_RAT  Lysosomal alpha-glucosidase precursor (Aci...  31.2    1.9   
sp|Q8KEP3|DNAK_CHLTE  Chaperone protein dnaK (Heat shock prote...  31.2    1.9  
sp|Q87RX3|DNAK_VIBPA  Chaperone protein dnaK (Heat shock prote...  31.2    1.9  
sp|A7MWW0.1|DNAK_VIBHB  Chaperone protein dnaK (Heat shock pro...  30.8    1.9  
sp|A5FZ19.1|DNAK_ACICJ  Chaperone protein dnaK (Heat shock pro...  30.8    1.9   
sp|Q88DU2|DNAK_PSEPK  Chaperone protein dnaK (Heat shock prote...  30.8    1.9   
sp|A5F361.1|DNAK_VIBC3  Chaperone protein dnaK (Heat shock pro...  30.8    2.0  
sp|A1JJD5.1|DNAK_YERE8  Chaperone protein dnaK (Heat shock pro...  30.8    2.0   
sp|A3QFD1.1|HSCA_SHELP  Chaperone protein hscA homolog             30.8    2.0   
sp|P55994|DNAK_HELPY  Chaperone protein dnaK (Heat shock prote...  30.8    2.1  
sp|Q6LUA7|DNAK1_PHOPR  Chaperone protein dnaK 1 (Heat shock pr...  30.8    2.1  
sp|Q8DF66|DNAK_VIBVU  Chaperone protein dnaK (Heat shock prote...  30.8    2.1  
sp|Q2NVZ1.1|DNAK_SODGM  Chaperone protein dnaK (Heat shock pro...  30.8    2.1   
sp|Q6LU58|HSCA_PHOPR  Chaperone protein hscA homolog               30.8    2.1  
sp|A6T226.1|DNAK_JANMA  Chaperone protein dnaK (Heat shock pro...  30.8    2.1  
sp|Q6KIH7|DNAK_MYCMO  Chaperone protein dnaK (Heat shock prote...  30.8    2.1  
sp|A4XYF6.1|DNAK_PSEMY  Chaperone protein dnaK (Heat shock pro...  30.8    2.2  
sp|Q1CV46.1|DNAK_HELPH  Chaperone protein dnaK (Heat shock pro...  30.8    2.2  
sp|Q7NXI3|DNAK_CHRVO  Chaperone protein dnaK (Heat shock prote...  30.8    2.2  
sp|Q17VY4.1|DNAK_HELAH  Chaperone protein dnaK (Heat shock pro...  30.8    2.2   
sp|Q05931|HSP7Q_YEAST  Heat shock protein SSQ1, mitochondrial ...  30.8    2.2   
sp|Q2Y6U0.1|DNAK_NITMU  Chaperone protein dnaK (Heat shock pro...  30.8    2.3   
sp|Q128K2.1|DNAK_POLSJ  Chaperone protein dnaK (Heat shock pro...  30.8    2.3   
sp|Q93R27|DNAK_TETHA  Chaperone protein dnaK (Heat shock prote...  30.8    2.3  
sp|A4JBS1.1|DNAK_BURVG  Chaperone protein dnaK (Heat shock pro...  30.8    2.3   
sp|Q8G6W1|DNAK_BIFLO  Chaperone protein dnaK (Heat shock prote...  30.8    2.3  
sp|A0T0H7|DNAK_PHATR  Chaperone protein dnaK (Heat shock prote...  30.8    2.4   
sp|Q7W519|DNAK_BORPA  Chaperone protein dnaK (Heat shock prote...  30.8    2.4  
sp|A6VNB1.1|DNAK_ACTSZ  Chaperone protein dnaK (Heat shock pro...  30.8    2.4  
sp|P49463|DNAK_ODOSI  Chaperone protein dnaK (Heat shock prote...  30.8    2.5   
sp|P61442|DNAK_LEPIC  Chaperone protein dnaK (Heat shock prote...  30.4    2.5  
sp|A1BET8.1|DNAK_CHLPD  Chaperone protein dnaK (Heat shock pro...  30.4    2.5   
sp|Q817Z0|SYA_BACCR  Alanyl-tRNA synthetase (Alanine--tRNA lig...  30.4    2.5   
sp|A6LDG8.1|DNAK_PARD8  Chaperone protein dnaK (Heat shock pro...  30.4    2.6  
sp|Q6LS31|DNAK2_PHOPR  Chaperone protein dnaK 2 (Heat shock pr...  30.4    2.6  
sp|Q9CMZ9|NORM_PASMU  Probable multidrug resistance protein no...  30.4    2.6  
sp|A0Q1R4.1|DNAK_CLONN  Chaperone protein dnaK (Heat shock pro...  30.4    2.7  
sp|Q1AXX6.1|DNAK_RUBXD  Chaperone protein dnaK (Heat shock pro...  30.4    2.7   
sp|Q7V7N7|DNAK1_PROMM  Chaperone protein dnaK1 (Heat shock pro...  30.4    2.8   
sp|O83246|DNAK_TREPA  Chaperone protein dnaK (Heat shock prote...  30.4    2.8  
sp|Q8DI58|DNAK2_SYNEL  Chaperone protein dnaK2 (Heat shock pro...  30.4    2.8  
sp|Q21X09.1|DNAK_RHOFD  Chaperone protein dnaK (Heat shock pro...  30.4    2.8   
sp|P61443|DNAK_LEPIN  Chaperone protein dnaK (Heat shock prote...  30.4    2.9  
sp|P38647|GRP75_MOUSE  Stress-70 protein, mitochondrial precur...  30.4    2.9   
sp|P48721.3|GRP75_RAT  Stress-70 protein, mitochondrial precur...  30.4    2.9   
sp|Q5N1J4|DNAK2_SYNP6  Chaperone protein dnaK 2 (Heat shock pr...  30.4    2.9   
sp|O88600|HSP74_RAT  Heat shock 70 kDa protein 4 (Ischemia res...  30.4    3.0   
sp|P42373|DNAK_BURCE  Chaperone protein dnaK (Heat shock prote...  30.4    3.0  
sp|Q1BYX3.1|DNAK_BURCA  Chaperone protein dnaK (Heat shock pro...  30.4    3.0   
sp|P38646|GRP75_HUMAN  Stress-70 protein, mitochondrial precur...  30.4    3.0   
sp|Q61316|HSP74_MOUSE  Heat shock 70 kDa protein 4 (Heat shock...  30.4    3.1   
sp|Q39JC8|DNAK_BURS3  Chaperone protein dnaK (Heat shock prote...  30.4    3.1   
sp|Q0BI18.1|DNAK_BURCM  Chaperone protein dnaK (Heat shock pro...  30.4    3.1   
sp|Q3A8C2|DNAK_PELCD  Chaperone protein dnaK (Heat shock prote...  30.4    3.2   
sp|Q3ZCH0|GRP75_BOVIN  Stress-70 protein, mitochondrial precur...  30.4    3.2   
sp|Q5WHG1|DNAK_BACSK  Chaperone protein dnaK (Heat shock prote...  30.4    3.2   
sp|O35501|GRP75_CRIGR  Stress-70 protein, mitochondrial precur...  30.4    3.2  
sp|Q9WWG9|DNAK_PSESG  Chaperone protein dnaK (Heat shock prote...  30.4    3.2  
sp|Q3KIA0|DNAK_PSEPF  Chaperone protein dnaK (Heat shock prote...  30.4    3.3   
sp|Q47HK2|DNAK_DECAR  Chaperone protein dnaK (Heat shock prote...  30.4    3.3   
sp|Q5ZM98|GRP75_CHICK  Stress-70 protein, mitochondrial precur...  30.0    3.3   
sp|Q5R511.1|GRP75_PONPY  Stress-70 protein, mitochondrial prec...  30.0    3.3  
sp|A0LWS7.1|DNAK_ACIC1  Chaperone protein dnaK (Heat shock pro...  30.0    3.3   
sp|Q1IT15.1|DNAK_ACIBL  Chaperone protein dnaK (Heat shock pro...  30.0    3.3   
sp|P11141.2|HSP7F_CAEEL  Heat shock 70 kDa protein F, mitochon...  30.0    3.3   
sp|Q2SYZ4.1|DNAK_BURTA  Chaperone protein dnaK (Heat shock pro...  30.0    3.4  
sp|P87142|YDMC_SCHPO  Heat shock protein 70 homolog C57A7.12       30.0    3.4  
sp|A3MN99.1|DNAK_BURM7  Chaperone protein dnaK (Heat shock pro...  30.0    3.4  
sp|A1WAR6.1|DNAK_ACISJ  Chaperone protein dnaK (Heat shock pro...  30.0    3.5   
sp|Q3JP10|DNAK_BURP1  Chaperone protein dnaK (Heat shock prote...  30.0    3.5   
sp|A4G8D2.1|DNAK_HERAR  Chaperone protein dnaK (Heat shock pro...  30.0    3.6  
sp|Q5QXL1|DNAK_IDILO  Chaperone protein dnaK (Heat shock prote...  30.0    3.6  
sp|A1VMG2.1|DNAK_POLNA  Chaperone protein dnaK (Heat shock pro...  30.0    3.6  
sp|Q8PMB0|DNAK_XANAC  Chaperone protein dnaK (Heat shock prote...  30.0    3.6  
sp|Q8PAK9|DNAK_XANCP  Chaperone protein dnaK (Heat shock prote...  30.0    3.6  
sp|Q3BVB8|DNAK_XANC5  Chaperone protein dnaK (Heat shock prote...  30.0    3.6   
sp|O06430|DNAK_NITEU  Chaperone protein dnaK (Heat shock prote...  30.0    3.7  
sp|P29845|HSP7E_DROME  Heat shock 70 kDa protein cognate 5         30.0    3.7   
sp|Q01899|HSP7M_PHAVU  Heat shock 70 kDa protein, mitochondria...  30.0    3.7  
sp|Q8XW40|DNAK_RALSO  Chaperone protein dnaK (Heat shock prote...  30.0    3.7  
sp|Q5H186|DNAK_XANOR  Chaperone protein dnaK (Heat shock prote...  30.0    3.8  
sp|A2SIR4.1|DNAK_METPP  Chaperone protein dnaK (Heat shock pro...  30.0    3.8  
sp|Q2P459.1|DNAK_XANOM  Chaperone protein dnaK (Heat shock pro...  30.0    3.8   
sp|A1TLH9.1|DNAK_ACIAC  Chaperone protein dnaK (Heat shock pro...  30.0    3.9  
sp|Q9XCB1|DNAK_RHOMR  Chaperone protein dnaK (Heat shock prote...  30.0    3.9  
sp|Q3IC08|DNAK_PSEHT  Chaperone protein dnaK (Heat shock prote...  30.0    4.0   
sp|Q8DH10|DNAK3_SYNEL  Chaperone protein dnaK3 (Heat shock pro...  30.0    4.0  
sp|A1WGJ9.1|DNAK_VEREI  Chaperone protein dnaK (Heat shock pro...  30.0    4.0  
sp|Q1H3B8.1|DNAK_METFK  Chaperone protein dnaK (Heat shock pro...  30.0    4.0   
sp|P19993|DNAK_MYCLE  Chaperone protein dnaK (Heat shock prote...  30.0    4.1  
sp|A3N3K0.1|DNAK_ACTP2  Chaperone protein dnaK (Heat shock pro...  30.0    4.1   
sp|Q9PB05|DNAK_XYLFA  Chaperone protein dnaK (Heat shock prote...  30.0    4.2  
sp|Q87BS8|DNAK_XYLFT  Chaperone protein dnaK (Heat shock prote...  30.0    4.2   
sp|Q9ZFC6|DNAK_METSS  Chaperone protein dnaK (Heat shock prote...  30.0    4.2  
sp|Q5E4T4|DNAK1_VIBF1  Chaperone protein dnaK 1 (Heat shock pr...  30.0    4.3   
sp|Q9ZEJ6|DNAK1_ANASP  Chaperone protein dnaK1 (Heat shock pro...  29.6    4.3   
sp|Q5E3A7|DNAK2_VIBF1  Chaperone protein dnaK 2 (Heat shock pr...  29.6    4.5   
sp|O05714|DNAK_ANAVT  Chaperone protein dnaK (Heat shock prote...  29.6    4.5   
sp|Q15UD3.1|DNAK_PSEA6  Chaperone protein dnaK (Heat shock pro...  29.6    4.7   
sp|O87712|DNAK_COXBU  Chaperone protein dnaK (Heat shock prote...  29.6    4.8  
sp|P26791|HSP70_DAUCA  Heat shock 70 kDa protein                   29.6    4.9  
sp|O87384|DNAK_VIBHA  Chaperone protein dnaK (Heat shock prote...  29.6    4.9  
sp|A5UBQ1.1|DNAK_HAEIE  Chaperone protein dnaK (Heat shock pro...  29.6    5.1  
sp|A5EYG3.1|DNAK_DICNV  Chaperone protein dnaK (Heat shock pro...  29.6    5.4  
sp|Q1IF59.1|DNAK_PSEE4  Chaperone protein dnaK (Heat shock pro...  29.6    5.5  
sp|Q47XI6|DNAK2_COLP3  Chaperone protein dnaK 2 (Heat shock pr...  29.6    5.5   
sp|A0T0X1|DNAK_THAPS  Chaperone protein dnaK (Heat shock prote...  29.6    5.6   
sp|Q5P1H5|DNAK_AZOSE  Chaperone protein dnaK (Heat shock prote...  29.3    5.6   
sp|Q0HY11.1|DNAK_SHESR  Chaperone protein dnaK (Heat shock pro...  29.3    5.6   
sp|Q0K757.1|DNAK_RALEH  Chaperone protein dnaK (Heat shock pro...  29.3    5.7  
sp|Q0HLN0.1|DNAK_SHESM  Chaperone protein dnaK (Heat shock pro...  29.3    5.7   
sp|P59320|ARGD_SHEON  Acetylornithine aminotransferase (ACOAT)     29.3    5.8  
sp|A0KTS5.1|DNAK_SHESA  Chaperone protein dnaK (Heat shock pro...  29.3    5.9   
sp|Q6MNF8|DNAK_BDEBA  Chaperone protein dnaK (Heat shock prote...  29.3    6.0  
sp|A1AW22.1|DNAK_RUTMC  Chaperone protein dnaK (Heat shock pro...  29.3    6.1  
sp|Q8EHT7|DNAK_SHEON  Chaperone protein dnaK (Heat shock prote...  29.3    6.1  
sp|Q39Y12.1|RPOC_GEOMG  DNA-directed RNA polymerase subunit be...  29.3    6.2   
sp|Q8YW74|DNAK2_ANASP  Chaperone protein dnaK2 (Heat shock pro...  29.3    6.2   
sp|Q12Q08.1|DNAK_SHEDO  Chaperone protein dnaK (Heat shock pro...  29.3    6.2   
sp|A5CX56.1|DNAK_VESOH  Chaperone protein dnaK (Heat shock pro...  29.3    6.3  
sp|A3QGW2.1|DNAK_SHELP  Chaperone protein dnaK (Heat shock pro...  29.3    6.3   
sp|A1S8K7.1|DNAK_SHEAM  Chaperone protein dnaK (Heat shock pro...  29.3    6.3   
sp|A1K4C5.1|DNAK_AZOSB  Chaperone protein dnaK (Heat shock pro...  29.3    6.4   
sp|Q93GF1|DNAK_PRELO  Chaperone protein dnaK (Heat shock prote...  29.3    6.4  
sp|P37900|HSP7M_PEA  Heat shock 70 kDa protein, mitochondrial ...  29.3    6.4  
sp|Q0AIY1.1|DNAK_NITEC  Chaperone protein dnaK (Heat shock pro...  29.3    6.4   
sp|Q01269|PHEC_PSEAE  Cyclohexadienyl dehydratase precursor [I...  29.3    6.6  
sp|Q46XI7|DNAK_RALEJ  Chaperone protein dnaK (Heat shock prote...  29.3    6.7   
sp|Q875V0|HSP7F_SACCA  Heat shock protein homolog SSE1             29.3    6.7  
sp|P43736|DNAK_HAEIN  Chaperone protein dnaK (Heat shock prote...  29.3    7.0  
sp|P36415.2|HS7C1_DICDI  Heat shock cognate 70 kDa protein 1 (...  29.3    7.0  
sp|Q63617|HYOU1_RAT  Hypoxia up-regulated protein 1 precursor ...  29.3    7.2   
sp|A1STE4.1|DNAK_PSYIN  Chaperone protein dnaK (Heat shock pro...  29.3    7.2  
sp|Q9Y4L1|HYOU1_HUMAN  Hypoxia up-regulated protein 1 precurso...  29.3    7.2   
sp|Q9JKR6.1|HYOU1_MOUSE  Hypoxia up-regulated protein 1 precur...  29.3    7.2   
sp|Q60432.1|HYOU1_CRIGR  Hypoxia up-regulated protein 1 precur...  29.3    7.2  
sp|A5UF68.1|DNAK_HAEIG  Chaperone protein dnaK (Heat shock pro...  28.9    7.3  
sp|Q486F9|DNAK1_COLP3  Chaperone protein dnaK 1 (Heat shock pr...  28.9    7.5   
sp|A0M353.1|DNAK_GRAFK  Chaperone protein dnaK (Heat shock pro...  28.9    7.6  
sp|Q875P5|HSP7F_SACKL  Heat shock protein homolog SSE1             28.9    7.7  
sp|P12076|HSP71_LEIMA  Heat shock 70-related protein 1, mitoch...  28.9    7.9  
sp|A3D7T4.1|DNAK_SHEB5  Chaperone protein dnaK (Heat shock pro...  28.9    7.9   
sp|O33522|DNAK_RALME  Chaperone protein dnaK (Heat shock prote...  28.9    8.0   
sp|P39987|HSP7E_YEAST  Heat shock protein SSC3, mitochondrial ...  28.9    8.2   
sp|Q9YBY6|ARGD_AERPE  Acetylornithine/acetyl-lysine aminotrans...  28.9    8.4  
sp|P61456|SAHH_CORDI  Adenosylhomocysteinase (S-adenosyl-L-hom...  28.9    8.5  
sp|O95757|HS74L_HUMAN  Heat shock 70 kDa protein 4L (Osmotic s...  28.9    8.5   
sp|Q9L7P1|DNAK_PROAC  Chaperone protein dnaK (Heat shock prote...  28.9    8.5  
sp|P40829|GABT_MYCLE  4-aminobutyrate aminotransferase ((S)-3-...  28.9    8.6  
sp|A4Y9Q3.1|DNAK_SHEPC  Chaperone protein dnaK (Heat shock pro...  28.9    8.8   
sp|Q5N1V0|DNAK1_SYNP6  Chaperone protein dnaK 1 (Heat shock pr...  28.9    9.1   
sp|Q086J3.1|DNAK_SHEFN  Chaperone protein dnaK (Heat shock pro...  28.9    9.1   
sp|P50022|DNAK3_SYNP7  Chaperone protein dnaK3 (Heat shock pro...  28.9    9.3   
sp|P48722|HS74L_MOUSE  Heat shock 70 kDa protein 4L (Osmotic s...  28.9    9.3   
sp|Q5HRQ2|MFD_STAEQ  Transcription-repair-coupling factor (TRC...  28.5    9.7   
sp|Q8CMT1|MFD_STAES  Transcription-repair-coupling factor (TRC...  28.5    9.7   
sp|O59838|HSP7F_SCHPO  Heat shock protein homolog pss1             28.5    9.8  
sp|Q5F6W5|DNAK_NEIG1  Chaperone protein dnaK (Heat shock prote...  28.5    9.9   



>sp|P0A9X4.1|MREB_ECOLI  Rod shape-determining protein mreB
 sp|P0A9X7|MREB_SALTI  Rod shape-determining protein mreB
 sp|P0A9X5|MREB_ECOL6  Rod shape-determining protein mreB
 sp|P0A9X6|MREB_SALTY  Rod shape-determining protein mreB
 sp|P0A9X8|MREB_SHIFL  Rod shape-determining protein mreB
Length=347

 Score =  193 bits (491),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/153 (62%), Positives = 122/153 (79%), Gaps = 3/153 (1%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQ--GGKKNVLAVGDEAK  60
            +    + ++S D++IDLGTANTL+ +KG G+VLNEPSVVAI     G  K+V AVG +AK
Sbjct  1    MLKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAK  60

Query  61   TMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTF-ANPRILICVPTGSTP  119
             MLGRTPGNI+AIRP++DGVIADF VTE+M++HFIK+VH  S    +PR+L+CVP G+T 
Sbjct  61   QMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFMRPSPRVLVCVPVGATQ  120

Query  120  VERKAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            VER+AI++SA  AGAR V LIEEP+AAAIGAGL
Sbjct  121  VERRAIRESAQGAGAREVFLIEEPMAAAIGAGL  153


>sp|Q9L6A3|MREB_PASMU  Rod shape-determining protein mreB
Length=351

 Score =  186 bits (473),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 125/154 (81%), Gaps = 5/154 (3%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQ--GGKKNVLAVGDEAK  60
            LF  ++ ++S D++IDLGTANTL+ +KG G+VL+EPSVVAI  +  G  K++ AVG +AK
Sbjct  2    LFKKIRGLFSNDLSIDLGTANTLIYVKGQGIVLDEPSVVAIRQERSGALKSIAAVGRDAK  61

Query  61   TMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFA--NPRILICVPTGST  118
             MLGRTP +I+AIRP++DGVIADF VTE+M+++FIK+VH  S F   +PR+L+CVP G+T
Sbjct  62   LMLGRTPKSIAAIRPMKDGVIADFFVTEKMLQYFIKQVHS-SNFMRPSPRVLVCVPAGAT  120

Query  119  PVERKAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
             VER+AI++SA+ AGAR V LIEEP+AAAIGA L
Sbjct  121  QVERRAIKESAIGAGAREVYLIEEPMAAAIGAKL  154


>sp|P44474|MREB_HAEIN  Rod shape-determining protein mreB
Length=351

 Score =  185 bits (469),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 122/153 (79%), Gaps = 3/153 (1%)

Query  3    LFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQ--GGKKNVLAVGDEAK  60
            LF  ++ ++S D++IDLGTANTL+ +K  G+VL+EPSVVAI     G  K++ AVG EAK
Sbjct  2    LFKKIRGLFSNDLSIDLGTANTLIYVKRQGIVLDEPSVVAIRQDRVGTLKSIAAVGKEAK  61

Query  61   TMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTF-ANPRILICVPTGSTP  119
             MLGRTP +I AIRP++DGVIADF VTE+M+++FIK+VH G+    +PR+L+CVP G+T 
Sbjct  62   LMLGRTPKSIVAIRPMKDGVIADFFVTEKMLQYFIKQVHSGNFMRPSPRVLVCVPAGATQ  121

Query  120  VERKAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
            VER+AI++SA+ AGAR V LIEEP+AAAIGA L
Sbjct  122  VERRAIKESAIGAGAREVYLIEEPMAAAIGAKL  154


>sp|P39751|MBL_BACSU  MreB-like protein (Protein mbl)
Length=333

 Score =  171 bits (433),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (77%), Gaps = 2/143 (1%)

Query  10   IWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGN  69
            ++++D+ IDLGTAN L+ +KG G+VLNEPSVVA+    GK  VLAVG+EA+ M+GRTPGN
Sbjct  1    MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVALDKNSGK--VLAVGEEARRMVGRTPGN  58

Query  70   ISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERKAIQDSA  129
            I AIRPL+DGVIADF VTE M+KHFI K++    F+ PR+LIC PT  T VE+KAI+++A
Sbjct  59   IVAIRPLKDGVIADFEVTEAMLKHFINKLNVKGLFSKPRMLICCPTNITSVEQKAIKEAA  118

Query  130  LAAGARRVQLIEEPIAAAIGAGL  152
              +G + V L EEP  AAIGAG+
Sbjct  119  EKSGGKHVYLEEEPKVAAIGAGM  141


>sp|P32444|MBL_BACC1  MreB-like protein (Protein mbl)
Length=333

 GENE ID: 2750156 mbl | mbl protein [Bacillus cereus ATCC 10987]
(10 or fewer PubMed links)

 Score =  169 bits (428),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 2/143 (1%)

Query  10   IWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGN  69
            ++++D+ IDLGTAN L+ +KG G+VLNEPSVVAI    GK  VLAVG+EA++M+GRTPGN
Sbjct  1    MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNTGK--VLAVGEEARSMVGRTPGN  58

Query  70   ISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPVERKAIQDSA  129
            I AIRPL+DGVIADF +TE M+K+FI K+   S F+ PRILIC PT  T VE+KAI+++A
Sbjct  59   IVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAA  118

Query  130  LAAGARRVQLIEEPIAAAIGAGL  152
              +G + V L EEP  AA+GAG+
Sbjct  119  ERSGGKTVFLEEEPKVAAVGAGM  141


>sp|P39763|MREBH_BACSU  Protein mreBH
Length=335

 Score =  153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (53%), Positives = 104/143 (72%), Gaps = 4/143 (2%)

Query  12   SQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGNIS  71
            S ++ IDLGTAN LV  K  G++LNEPSVVA+      K VLA+G +AK M+G+TPG I 
Sbjct  4    STEIGIDLGTANILVYSKNKGIILNEPSVVAV--DTTTKAVLAIGADAKNMIGKTPGKIV  61

Query  72   AIRPLRDGVIADFIVTEEMIKHFIKKVHK--GSTFANPRILICVPTGSTPVERKAIQDSA  129
            A+RP++DGVIAD+ +T +++KH +KK  K  G +F  P +++C P+GST VER+AI D+ 
Sbjct  62   AVRPMKDGVIADYDMTTDLLKHIMKKAAKSIGMSFRKPNVVVCTPSGSTAVERRAISDAV  121

Query  130  LAAGARRVQLIEEPIAAAIGAGL  152
               GA+ V LIEEP+AAAIGA L
Sbjct  122  KNCGAKNVHLIEEPVAAAIGADL  144


>sp|Q01465|MREB_BACSU  Rod shape-determining protein mreB
Length=337

 Score =  151 bits (381),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 106/145 (73%), Gaps = 4/145 (2%)

Query  10   IWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAKTMLGRTPGN  69
            I ++D+ IDLGTANTLV +KG G+V+ EPSVVA+  Q   K+++AVG++AK M+GRTPGN
Sbjct  4    IGARDLGIDLGTANTLVFVKGKGIVVREPSVVAL--QTDTKSIVAVGNDAKNMIGRTPGN  61

Query  70   ISAIRPLRDGVIADFIVTEEMIKHFIKKV--HKGSTFANPRILICVPTGSTPVERKAIQD  127
            + A+RP++DGVIAD+  T  M+K++I +   +KG     P +++CVP+G T VE +A+ D
Sbjct  62   VVALRPMKDGVIADYETTATMMKYYINQAIKNKGMFTRKPYVMVCVPSGITAVEERAVID  121

Query  128  SALAAGARRVQLIEEPIAAAIGAGL  152
            +   AGAR    IEEP AAAIGA L
Sbjct  122  ATRQAGARDAYPIEEPFAAAIGANL  146


>sp|Q7NZ33|HSCA_CHRVO  Chaperone protein hscA homolog
Length=619

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 75/175 (42%), Gaps = 43/175 (24%)

Query  17   IDLGTANTLV--VLKGHGVVLNE-------PSVVAIVDQGGKKNVLAVGDEAKTMLGRTP  67
            IDLGT N+LV  V  G   VL +       PSVV   DQG    VLAVG +A+    R P
Sbjct  24   IDLGTTNSLVATVRSGSAAVLPDETGRSLLPSVVRYGDQG----VLAVGYDAQKEQNRDP  79

Query  68   GN--ISAIRPLRDGV--IAD-------FIVTEEMIKHFIKKVHKGSTFANPRIL------  110
             N  +S  R +  GV  I D       F+    M++   +   K     +  IL      
Sbjct  80   HNTIVSVKRFMGRGVSDIKDAGSLPYRFVDAPGMVQLVTRAGVKSPVEVSSDILRALKER  139

Query  111  -------------ICVPTGSTPVERKAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
                         I VP      +R+A +D+A  AG   ++L+ EP AAAI  GL
Sbjct  140  AEASLGGELTGAVITVPAYFDDAQRQATKDAARLAGLNVLRLLNEPTAAAIAYGL  194


>sp|Q5F8E8|HSCA_NEIG1  Chaperone protein hscA homolog
Length=620

 GENE ID: 3282201 hscA | chaperone protein HscA [Neisseria gonorrhoeae FA 1090]

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 75/174 (43%), Gaps = 40/174 (22%)

Query  17   IDLGTANTLV--VLKGHGVVLNE-------PSVVAIVDQGG-----------KKNVLAVG  56
            IDLGT N+LV  V  G    L +       PSVV  ++ GG           K + L   
Sbjct  24   IDLGTTNSLVATVRSGSAACLPDADGRVTLPSVVRYLENGGIEVGKTALSAQKTDPLNTV  83

Query  57   DEAKTMLGRTPGNI---SAIRPLRDGVIADFI-------------VTEEMIKHFIKKVHK  100
              AK ++GRT  ++   +   P R G    FI             V+ E++K    K+  
Sbjct  84   SSAKRLIGRTLADLHQNTHYLPYRFGDNQRFIELHTRQGVKTPVEVSAEILKTL--KLRA  141

Query  101  GSTFANPRI--LICVPTGSTPVERKAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
              T     +  +I VP      +R+A +D+A  AG   ++L+ EP AAAI  GL
Sbjct  142  EETLGGDLVGVVITVPAYFDDAQRQATKDAARLAGLNVLRLLNEPTAAAIAYGL  195


>sp|Q9JS04|HSCA_NEIMB  Chaperone protein hscA homolog
Length=620

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 73/172 (42%), Gaps = 36/172 (20%)

Query  17   IDLGTANTLV--VLKGHGVVLNE-------PSVVAIVDQGG-----------KKNVLAVG  56
            IDLGT N+LV  V  G    L +       PSVV  ++ GG           K + L   
Sbjct  24   IDLGTTNSLVATVRSGSAACLPDAEGRVTLPSVVRYLENGGIEVGKTALSAQKTDPLNTV  83

Query  57   DEAKTMLGRTPGNI---SAIRPLR-------------DGVIADFIVTEEMIKHFIKKVHK  100
              AK ++GRT  ++   +   P R              GV     V+ E++K    +  +
Sbjct  84   SSAKRLIGRTLADLHQNTHYLPYRFGDNQRVIELHTRQGVKTPVEVSAEILKTLKSRAEE  143

Query  101  GSTFANPRILICVPTGSTPVERKAIQDSALAAGARRVQLIEEPIAAAIGAGL  152
                    ++I VP      +R+A +D+A  AG   ++L+ EP AAAI  GL
Sbjct  144  TLGGDLVGVVITVPAYFDDAQRQATKDAARLAGLNVLRLLNEPTAAAIAYGL  195

ORF finding

protocole : codon initiale = any codon, reading frame=1+2+3 , ORF at least 60AA , 
            code genetique = standard , sequence = DIRECT

PAS d'ORF



protocole : codon initiale = any codon, reading frame=1+2+3 , ORF at least 60AA , 
            code genetique = standard , sequence = REVERSE




>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 412.
AATAAAATAAATGCTATTAATTTAAAATCATTAAAAGTTTATGCTGGTACCGGTGAACCT
CAAAGAGCCGAAATGACTCTAGATGTTTTTGGGGATATTAAACAAACTACACAAACAGGT
GATGGTCCAGTCGATGCAATTTTTAAATGTATTAGAGAACTTTATGAACACGATGTTAAG
TTATCACTGTATCAAGTTCATGCTGTTACTGAAGGTACAGATGCACAAGCAACTGTGAGT
GTAAAAATTGAAGAGAATGATCGCACAACAGTTGGCCAATCTGCAGATACAGATACTTTA
GTAGCTTCTGCAAAAGCTTATTTAAATGCATTAAATAAAATGCTTATTAAAAGAGAGAAA
AAATCTCTTTCTGAAAATATTGAACATCAAAAGGTAAAAGGAGGGGTTTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
NKINAINLKSLKVYAGTGEPQRAEMTLDVFGDIKQTTQTGDGPVDAIFKCIRELYEHDVK
LSLYQVHAVTEGTDAQATVSVKIEENDRTTVGQSADTDTLVASAKAYLNALNKMLIKREK
KSLSENIEHQKVKGGV*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 413 to base 868.
ATGGGATTATTTGATAGCGTAAAAAAAATATGGAGCCAAGATATGGCTATTGATCTTGGA
ACTGCAAATACTCTTGTGGTTTTAAAAGGTCATGGAGTGGTTCTCAATGAGCCTTCAGTT
GTTGCCATTGTTGATCAAGGAGGAAAAAAAAATGTATTAGCTGTTGGAGATGAAGCAAAA
ACTATGCTTGGAAGAACACCGGGTAATATAAGCGCTATTAGACCTTTGAGGGATGGAGTA
ATTGCTGATTTTATAGTCACAGAAGAAATGATTAAACACTTTATAAAAAAAGTTCATAAA
GGAAGTACATTTGCTAACCCAAGAATTTTAATTTGTGTGCCAACTGGTTCAACTCCAGTT
GAAAGAAAAGCTATTCAAGATAGTGCTTTAGCAGCAGGAGCAAGAAGAGTTCAATTAATT
GAGGAACCTATTGCTGCCGCTATCGGTGCTGGACTC

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
MGLFDSVKKIWSQDMAIDLGTANTLVVLKGHGVVLNEPSVVAIVDQGGKKNVLAVGDEAK
TMLGRTPGNISAIRPLRDGVIADFIVTEEMIKHFIKKVHKGSTFANPRILICVPTGSTPV
ERKAIQDSALAAGARRVQLIEEPIAAAIGAGL
Personal tools