ORF AC16760

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160042.1
Annotathon code: ORF_AC16760
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : damat
Annotated on : 2008-03-19 18:52:37
  • Fontaine Mathilde
  • Ouedraogo David

Synopsis

Genomic Sequence

>AACY01160042.1 ORF_AC16760 genomic DNA
GAAATGAATCTTCATGTACCTCAAAGTGAAGAGGCACGTTCTGAAGCAATCCTACTAATGAGAGTTCAAGATCAATTAATCTCTCCACGATTTGGTGGTC
CAATTATTGGTGGTCTAAGAGACTTTATCACTGGTGCTTATCTTCTCACAAAAGATGGTACTACACTTTCTAGTCAAGAATTTGCAAATCTAGCAATGTT
AGGCGGTTTTACAGGAAAACTACCGGACCCTGAAAATAAAAAAGAAAATCTTTACACTGGAAAACAACTTTTCTCATTATTCTTACCTGAAGATTTCAAT
TACGTAATGACATCAAAATGGTCTAAAGGAACAAAAGGTACTCAAAAAGATGTTGTAATCAAAAACGGTCAATTGATTAGTGGAGTAATTGATAAATCAT
CTATCGGTGCTGAAGAACCTGAAAGTGTTTTGCATAGAATTGCAAAGGATTATGGTAATGAAAAAGCAAAAGTTTTCTTAAATTCCGAATTAATAATTAT
CAAACAATTTGTAACCCATTATGGATTTAGTTATGGTTATGGTGACTTAGAAGTACCTGAAAAAGATAGACAGGCAATAATAGATGATACTCAAAAGACA
TACGATGAAATTCATGATTTAATCCAACAAGAAAAGAAAGGCACACTAAAGCCAATTAGAGGAATGACAACAAAAGAAACTCTTGAGGCATACATTATGA
GTAATCTAGGAAAATTAAGAGATAGGGCAGCAAATGCAGCAAATCTTTCATTAGATGATGATAATGCTGGAAAAATTATGGCAACTACCGGTGCTAGAGG
TTCATCTCTAAATGTAGGTCAAATGGCTGGTGCATTGGGACAACAAGCACGTCGTGGTAATCGTCTAAACAAAGGTTACAATAATCGTGTTTTAACTCAC
TTTGAAGAACATGAAAATGATCCCGATGCCCATGGAAT

Translation

[4 - 936/938]   direct strand
>ORF_AC16760 Translation [4-936   direct strand]
MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEFANLAMLGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNY
VMTSKWSKGTKGTQKDVVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHYGFSYGYGDLEVPEKDRQAIIDDTQKTY
DEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMSNLGKLRDRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGYNNRVLTHF
EEHENDPDAHG

[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

   
noeud 8:Archae    noeud 11: Archae;Crenarchaeta;Thermoprotei 
noeud 6:Archae;Euryarchaeta
noeud 1: Cenarchaeales

                                                 +--------------Orf       
                            +--------------------1                  
                            !                    +-C.symbiosum      
                         +-10  
                         !  !   +------------S.acidocaldarius
                         !  ! +-7 
                      +-11  +-9 +------------------A.pernix       
                      !  !    ! 
                      !  !    +-----------------P.aerophilum
                      !  !  
                      !  +---------------T.pendens 
                      ! 
  +-------------------8      +----------M.thermophila              
  !                   !    +-4                                   
  !                   !    ! +---------A.fulgidus
  !                   !  +-5 
  !                   !  ! !           +------T.volcanium
  !                   +--6 +-----------3                         
  !                      !             +--------F.acidarmanus
  !                      ! 
  !                      +-----------P.furiosus
  ! 
  2-------------O.sativa  (Eukariota, plante)
  ! 
  +----------------O.haysii (Eukariota, zygomycètes)  




Ci joint les résultats sous forme parenthésée du meme arbre en parcimonie:
(O.haysii,((((P.furiosus,((F.acidarma,T.volcaniu),(A.fulgidus,
M.thermoph))),(T.pendens,((P.aerophil,A.pernix),S.acidocal))),
(O.sativa,C.symbiosu)),orf)); 

Annotator commentaries

Recherche d'Orf Nous avons cherché les orfs potentielles avec la méthode Any codon et ATG + codons alternatifs. Dans les deux cas, l'ORF la plus probable se trouve sur le direct strand frame 1 (environ 311 aa ). Il y a également une ORF de 68 aa sur le reverse strand frame 1 mais nous avons privilégié l'ORF le plus grand. On a choisi la séquence de l'ORF commença par ATG car elle a seulement un codon en moins par rapport à celle sans codon; ce qui ne fera pas une grande différence dans la suite de l'analyse. De plus, elle commence par le codon ATG, qui est un codon d'initiation de traduction ; on peut supposer que la traduction commence en position +4 de notre ADN. Le dernier codon de notre sequence n'est pas un codon stop, ce qui veut dire que l'extrémité 3'est incomplète.

Analyse des résultats du Blast Pour le blast réalisé dans swiss prot, on trouve de très bons hits avec l'evalue la plus forte 7E-66 (score de 249) mais dans le blast contre NR apparait une séquence qui se distingue de toutes les autres et qui était passée inaperçue dans swiss prot. Elle a une e-value excellente de 4e-122 !! avec un score de 440! ; les nombreuses autres séquences ont également de très forte e_value(environ e-60) avec des scores entourant les 200. La séquence la plus similaire provient du sous-groupe Crenorchaetes des Archae. Notre groupe d'étude surement les Archae. On remarque que les séquences avec de très fortes similarités avec la notre dans le groupe des Archae codent toutes pour une sous-unité de DNA-directed ARN polymerase.

Remarque : Nous avons trouvé des homologues de notre séquence dans des taxons très variés : dans les Archae on trouve des Crenorchaetes et des Euryarchaetes; et chez les Eucaryotes, nous trouvons des Insectes, des Crustacées, des Plantes, et des Champignons. De plus pratiquement tous ces homologues codent pour la DNA-directed RNA polymerase. Cela montre que cette séquence et sa fonction ont été très conservés au cours de l'évolution.

Alignement multiple (Clustal w) On observe que la méthionine en première position n'est pas un résidu conservé (présente 1 fois sur 13, que chez A.pernix) donc notre hypothèse selon laquelle la traduction de notre séquence commence au nucléotide 4 n'est pas valide. L'initiation de traduction peut se trouver en amont de notre séquence.

Recherche de domaine dans Interpro Interpro a donné trois domaines protéiques distinctes, tous issues de Pfam avec des evalues significatives RNA_pol rpb1_2(1.5e-08 ), RNA_pol rpb1_3(24-182),RNA_pol rpb1_4(5.1e-28).Tous ces domaines sont caractéristique de la RNA polymérase.On peut supposer que le domaine RNA_pol rpb1_1 manquant se trouve surement sur l'extrémité C terminale du gene.Notre sequence est une portion d'un gene.

Analyse phylogénétique Les résultats du blast contre nr montrent que notre séquence présente de fortes similarités avec des séquences provenant d'Archaes. Les premiers arbres que nous avons realisés montrent que notre séquence est plus proche des Thermoprotei (un sous groupe des Archaes, Crenarchaetes).Nous avons ensuite enrichi notre pool de séquences avec d'autres séquences de Crenarchaetes: A.pernix, T.pendens et P.aerophilum pour contruire l'arbre ci dessus. Nous avons finalement retenu un champignon Orphella haysii pour raciner notre arbre parce que c'est un groupe extérieur à notre domaine d'étude qui présente 32%d'identité avec notre séquence avec un score de 165 et une evalue de 3e-39. L'arbre obtenue par parcinomie presente quelques différences(voir arbre) avec celui obtenue par la methode des distances mais notre sequence est encore plus proche des Crenarchaeta que du sous groupe des Euryarchaeta. L'arbre ci dessus(NJ)avec l'ensemble de nos données permet de dire que notre sequence est plus apparentée aux Crenorchaetes.

Fonction La recherche sur interpro montre que la sequence possedent des conservés domaines caractéristiques d'une RNA polymérase.Le choix du processus biologique et de la fonction moléculaire à été confirmé par les GO terms GO:003677(DNA binding)et GO:0006350(transcription)des fiches de domaines. Les resultats des blast contre swiss prot et NR montrent respectivement que les sequences les plus similaires N°sp P11512(7e-66 )et N°ABK78186(7e-128) codent pour une sous unité de la DNA-directed RNA polymerase.DNA-directed RNA polymerase serait la fonction probable de notre sequence.

Multiple Alignement

CLUSTAL W (1.82) multiple sequence alignment


Orf                   ------------------------------------------------------------
C.symbiosum           ---------MSIQTVKSISAIRFSVWSPHEIRKYSVAEITAPETYDEEGMPVQGGLMDGR
S.acidocaldarius      ------------MSEKIIRGVKFGVLSPNEIRQMSVTAIITSEVYDEDGTPIEGGVMDPK
A.pernix              MLGAMSLRLSEFRETNLLDKILFGVLSPHEIRQLAKVTVVRGDLYEADGTPVSGGLRDPH
P.aerophilum          ---MSLREEFDAIPKKVIKSIKFGVLSPEMIRKYSVMEVTTSEVYDEGGLPVRGGIADRR
T.pendens             --------MSTSTNPKIVAGIKFGILSPEMIRKIAVLRIETSELYDEEGFPIPGGLMDRR
M.thermophila         -----------MSVPKRIGKIRFGLISPQEFRKMSVVKVITADTYDDDGFPIEMGLMDPR
A.fulgidus            ------------MVPKRISAIKFEVLSPQEIRRMSVVKIITPETYDDDGFPIDGGLMDTR
T.volcanium           ----------MMGISKRISSIKFALLSPDEIRKLSQVKVITADTYDDDGYPIEHGLMDLH
F.acidarmanus         --------MNFNNVSKRIEKIKFALLSPDEIRKMSQIRVITPDTYDDDGYPIERGLMDLH
P.furiosus            -------------MKKVIGSIEFGILSPQEIRKMSAVEVTVPDTYDDDGYPIEGGVMDKR
O.sativa              --MDAARFPYSPAEVAKVEAVQFGVLSPDEIRQMSVVHIEHAETMEK-GKPKPGGLSDPR
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           LGTLEPGQKCLTCGNTAARCPGHFGHIELAEPILHIAFIDNIHKLLLGMCRSCSRLKVPQ
S.acidocaldarius      LGVIEPGEKCPVCGNTLAGCPGHFGHIELIKPVIHIGYVKHIYDFLRSTCWRCGRIKIKE
A.pernix              FGAIEPGERCPVCGNSREECPGHFGKIELARPVLIPHYTDYVYKILQATCRVCGRITLPE
P.aerophilum          LGVAEPGSRCETCGQTHDVCPGHFGHIELVKPVIHVGFARIIYDVLRATCPNCGRIMLRD
T.pendens             MGSIEPGAVCQTCGNRFTNCPGHFGYIELARPVIHPSFAPYIAILLKATCNRCGRLKLPE
M.thermophila         LGVIDPGLRCRTCGGRPGECPGHFGHIDLVAPVIHVGFAKLIRKILRAICRECSKLMLSE
A.fulgidus            LGVIDPGLRCKTCGGKAGECPGHFGHVELAAPVIHVGYAKMIARLLNGTCSECGRILLKD
T.volcanium           MGVIEPGLRCATCGGKVDECPGHFGHIELAMPVVHVGFVKEIKMFLDATCKSCGRIKLTD
F.acidarmanus         MGVIEPGLKCATCGGKVDECPGHFGHIELAMPVVHIGFIKEIKTMLDASCKECGRIKLTD
P.furiosus            MGVIDPGLRCETCGGRAGECPGHFGHIELARPVIHVGFAKTIYRILESTCRECGRIKLTD
O.sativa              MGTIDRKIKCETCMAGMAECPGHFGHLELAKPMFHIGFIKTVLSIMRCVCFNCSKILADE
O.haysii              -------------------------HIELARPVYHIGFIIKVKKILECVCWYCSKLKADE
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           EELDSLSKIRRRESAYTV--ISQKRIPEQILDRAKK------------------------
S.acidocaldarius      QDLERYKRIYNAIKLRWP--SAARRLVEYIKKISIK------------------------
A.pernix              EKIKYYRLIFRRLRGKWP--QLAKTFATMVVKEAAQ------------------------
P.aerophilum          EEIERYRERLNKLKARWR--LLALNLHEKIRKKATE------------------------
T.pendens             EKINKAKKRMEVYSAKWP--SLKTKYANTLLKEAAK------------------------
M.thermophila         LEKKEFLRQIRTLEDLG---QPTEDVVNKVFAEARK------------------------
A.fulgidus            ERRDKFIAEIERRKELN---QSYEEVVKEVFRLTKA------------------------
T.volcanium           DEIKTYLPEVQKVDFETGDPEDIELMTKRFVDLASQ------------------------
F.acidarmanus         DEINNYRTQISSVDFETTDPEIIDMTLKKILDVAIQ------------------------
P.furiosus            EEIEEYMKKIELARNRR---SEFNEIIKEIHKKAKE------------------------
O.sativa              DDIKFKQALKIRNPKNKLKRIYDACKNRKICAGGDNLDVQEQQG----------------
O.haysii              TDPAFILAKSIQDPNKRMKRVWDICKARTICESTGDDGSGEQLASSINELPNESERMRNA
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ---------SKECPHCGKTQYELIFTKPTIFIEKTEI----------G-----ENRLLPI
S.acidocaldarius      ---------NLECPHCGEKQFKIKLEKPYNFNEERNG---------------SIVKLSPS
A.pernix              ---------ATQCPHCGKPQYKVVYIRPFHFYEKKPE---------------GDVKLTPS
P.aerophilum          ---------RMTCPHCGYKRNKVRFERPYYFYEETKS----------G----ALVKLDPE
T.pendens             ---------ATVCPHCGAPQYKIRLDKPYTFYEEREE---------------GLVKLTPL
M.thermophila         ---------HKTCPYCGAPQREIKFERPLSYIED-------------------GHKLTPS
A.fulgidus            ---------AKKCPHCGAEQLEVKFDKPTFFYLG-------------------EHRLTPK
T.volcanium           ---------RMVCPHCGAQQSKIILDKPTTFREEG-----------------TNVKITPK
F.acidarmanus         ---------RNICPHCSSESPKVILDKPTTFRE-------------------GGIKITPK
P.furiosus            ---------RMVCPHCGAPQYPIKFEKPTIYWEIRKD----------EQGNEYRHRLMPT
O.sativa              -----TDDPVKKRGGCGAQQPNITVDGMKMVAEYKAPKKKNDDQEQLPEPVDRKQILSAE
O.haysii              VDGMLGDKRRKGHGGCGHRQPIFRKEGLKLNATFKAGSGEEGVAE-------GKQQLSVI
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           TIREKFSQITNEDLVLLGYDPATARPEWFILQALPVPPVTVRPSIILETGIRSEDDLTHK
S.acidocaldarius      EIRDRLERIPDSDVELLGYDPKSSRPEWMILTVLPVPPITIRPSITIESGIRAEDDLTHK
A.pernix              EIRERLEKTG-SEIEILGVHPERSRPEWMVATVLIVPPLAVRPSITLETGLRSEDDLTHA
P.aerophilum          VLRERLSKVPSEDLELLGINPSVARPEWAILKVLPVPPPHVRPSIQLETGIRSEDDLTHK
T.pendens             EIWERLSRIPEGDLRVVGIDPKEARPEWMVLRVIPVVPPSVRPSITLESGDRSEDDLTHK
M.thermophila         DIRDRFERISDEDIMVMGMNPETARPEWTILTVLPVPPVTMRPSITLESGQRSEDDLTHK
A.fulgidus            DVREWLEKIPDDDLPAFGINPKATRPEWFVLTVLPVPPVTVRPSIILETGQRSEDDLTHK
T.volcanium           EIRERLERIPDDDLVFFGFNPKTARPEWMILTVLPVPPINVRPSITLETGERSEDDLTHK
F.acidarmanus         EIRERLERIPDNDLLFFGINSTAARPEWMILTVLPVPPIDVRPSITLETGERSEDDLTHK
P.furiosus            EVRDWLEKIPDKDLPLLGLDPEKSRPEWMVLTVLPVPPVTARPSITLETGIRAEDDLTHK
O.sativa              RVLNVLKHISDEDCLLLGLNPKFARPDWMILQVLPIPPPPVRPSVMMDTSSRSEDDLTHQ
O.haysii              QVLQVLKRITDDDSFAMGINPDYSRPEWMILSVMPVPPMSVRPSIQMDATRQSEDDLTYK
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           MVDIIRVNQRLKESKEAGTPPLIVQDLVDLLQYHATTYFDNEISGIPQAHHRSGRPLKTL
S.acidocaldarius      LVDIIRLNERLKESIEAGAPQLIIEDLWDLLQYHVATYFDNEIPGLPPAKHRSGRPLRTL
A.pernix              LAEIVRQNEKLRNVIVTNAPETLIEENWMVLQEMVAAYIDNELPGARRLTHRRKRYLKTL
P.aerophilum          LVDIIRMNEKLKIAIETGAPTNVVDNLWELLQYHVATYFDNELPGIPVAKHRGGRPLKGI
T.pendens             LVDIIRVNQRLKENIDAGSPSLVIEDLWNLLQFHVATYFDNELPGIPPARHRSGRPLRTL
M.thermophila         LVDIIRINQRFQENREAGAPQLIIEDLWELLQYHVTTFLDNTVSGVPPARHRSGRPLKTL
A.fulgidus            LVDIIRINQRFMENKEAGAPQQILEDLWELLQYHVTTYIDNEVSGIPPARHRSGRPLKTL
T.volcanium           LVDIIRISQRLRESRDNGSPQLIIEDLWDLLQFHVTTYFDNQTPGIPPARHRSGRALKTL
F.acidarmanus         LVDIIRISQRLRESRDNGSPQLIIEDLWDLLQYHITTYFDNQTAGIPPARHRSGRALKTL
P.furiosus            LVDIIRINNRLKQNIEAGAPQLIIEDLWDLLQYHVTTYINNEAPGVPPAKHKSGRPLKTL
O.sativa              LAMIIRHNENLRRQERNGAPAHIITEFAQLLQFHIATYFDNELPGQPRATQRSGRPIKSI
O.haysii              LNDILKANARVRSCEMEGAPLHIIEEFEALLQFHVATFMNNELSGLPQALQKSGRPIKSI
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           TQRLKGKEGRFRGSLSGKRVDFSSRTVISPDPNLDLSEVGVPESVAMKLTIPEIVTEWNI
S.acidocaldarius      AQRLKGKEGRFRGNLSGKRVDFSARTVISPDPNLSIDEVGIPYTIARMLTVPERVTNINI
A.pernix              AQRLKGKDGRIRGNLSGKRVNYSARTVISPDPYISINEVGVPEEIAKTLTIAMRVTPYNL
P.aerophilum          AQRLKGKEGRFRGSLSGKRVNFSARTVISPDPHISINEVGVPYDIAKVLTVPERVTAWNV
T.pendens             AQRLKGKEGRFRGSLAGKRVDFSSRTVISPDPNLSINEVGVPIDVAKVLTVPEKVTPWNI
M.thermophila         SQRLKGKEGRFRGSLSGKRVNFSARTVISPYPNLSINEVGVPIEVAKELTVPIMVTPKNI
A.fulgidus            AQRLKGKEGRFRGSLSGKRVNFSARTVISPDPCLSINEVGVPREIAEELTVPIYVTPQNI
T.volcanium           VQRLKGKEGRFRSNLSGKRVNFSSRTVISPEPYLSVNEVGVPEKAARELTVPVIVNQFNI
F.acidarmanus         VQRLKGKEGRFRANLSGKRVNFSSRSVISPEPFLSMNEVGIPEVAARELTVPVLINSFNI
P.furiosus            AQRLKGKEGRFRGNLSGKRVNFSARTVISPDPMISINEVGVPVEVAMELTVPEKVTEFNI
O.sativa              CSRLKAKEGRIRGNLMGKRVDFSARTVITPDPNINIDELGVPWSIALNLTYPETVTPYNI
O.haysii              RARLKGKEGRLRGNLMGKRVDFSARTVITGDPNISIDQVGVPRSIARNLTVPEAVTPYNI
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ARMKELVVNGP-------DHYPGVNYIVRPDGVK-IRLDFVEDRSTIADTLEMGYLIERH
S.acidocaldarius      ERIRQYIINGP-------DKWPGANYVIKPDGRR-IDLRYVKDRKELASSITAGYVVERH
A.pernix              EEARRYVLNGP-------DKWPGALFVYKASERKKYDLRFFKDYEKLAESLEPGDVVERH
P.aerophilum          DVLREYVIRGP-------ESWPGANYVVTPEGRR-IDLRYVKDRKALAERLAPGWIVERH
T.pendens             EKLRKLVINGP-------DVWPGANYIIKPDGSR-IDLRYVKHREEISQTLKPGYIVERH
M.thermophila         EVVRKYVMRGP-------DNHPGVNYVTRADGRR--VKVTERNCQEVAEQLEVGWKVDRQ
A.fulgidus            DMAREFVLR---------SEHPKANYIVRPDGRR--IRVIESNKEELAEKLEPGWIVERQ
T.volcanium           DEMREFIKRGRNPRDKYGKYMAGVNYVIRPDGRR--IKITDQNAEENANRIEIGWTVERQ
F.acidarmanus         DKMKEWIKRGTAPRTPDGKYLAGINYLIRPDGRR--IKLTDQNAEINSDRIDIGWTVERQ
P.furiosus            ERLRKMVLNGP-------DKYPGANYVIDPEGRR--RRIMDSNKETLANQLDIGWTVERH
O.sativa              ERLKELVEYGPHPPPGK----TGAKYIIREDGQR---LDLRYVKKSSDQHLELGYKVERH
O.haysii              ATLQMMVRNGPTEHPG-------AKYVIRDTGER---IDLRYNKRGGDIPLQIGYRVERH
                                                                                  

Orf                   ---------------------------------------------------MNLHVPQSE
C.symbiosum           LLDGDIVMFNRQPSLHQMSIMAHHVRVLPGKTFRLHPSVCPPYNADFDGDEMNLHVPQSE
S.acidocaldarius      LVDGDVVLFNRQPSLHRISMMAHKVRVLPGRTFRLNLLDCPPYNADFDGDEMNLHVPQSE
A.pernix              LINGDIVLFNRQPSLHRMSIMGHIVRVMPGKTFRLNLLVCPPYNADFDGDEMNLHVPRLE
P.aerophilum          LIDGDIVLFNRQPSLHRVSMMGHLVKVLPGRTFRLHLAVCPPYNADFDGDEMNLHVPQTE
T.pendens             LMDGDVVLFNRQPSLHRISIMAHIVKVLPYKTFRLNLLVTIPYNADFDGDEMNLHVPQSE
M.thermophila         LADGDIVLFNRQPSLHRMSIMAHRVKVMPYKTFRLNPAVCPPYNADFDGDEMNLHVPQTE
A.fulgidus            LMDGDIVLFNRQPSLHRMSIMAHYVRVLPYKTFRLNPAVCPPYNADFDGDEMNLHVPQSL
T.volcanium           LMEGDIVLFNRQPSLHRMSMMGHTVRVLPGQTFRFNLAVCTPYNADFDGDEMNLHVIQKE
F.acidarmanus         MTEGDIVLFNRQPSLHRMSMMAHAVRVLPGMTFRFNLSDCTPYNADFDGDEMNLHVIQSE
P.furiosus            LMDGDIVLFNRQPSLHRMSIMAHRVRVMPYRTFRLNLAVCPPYNADFDGDEMNLHVPQTE
O.sativa              LNDGDFVLFNRQPSLHKMSIMGHRIKIMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSF
O.haysii              LVDNDVVIFNRQPSLHKMSMMGHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNMHVPQSE
                                                                         **:** :  

Orf                   EARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLS----SQEFANLAM
C.symbiosum           EARAEAMLLMRVQDQLISPRYGGPIIGGLRDFITGSYLLTKDDTTLT----REEFTNLAM
S.acidocaldarius      EAIAEARELMLVHKNIITPRYGGPIIGGGQDYISGAYLLSVKTTLLT---VEEVATILGV
A.pernix              EAQAEAREIMLVEKHILTPRYGGPIIGGRQDYVSGAYLLTVKTRLFT---KEEVERLLSV
P.aerophilum          EARAEARALMLVEKHIITPRYGGAIIGARQDYIIGAYLLSHKSTFLT---KKEVAFLLGA
T.pendens             EARAEARELMLVQEHIMTPRYGAPIIGGLHDYISGSYLLTRKDALLD---KKSALRLLYI
M.thermophila         EARAEAEILMRVQENILSPRFGGPIIGGIHDYVTGSFLLTHKERRLN--KDRLMEVLKKL
A.fulgidus            EAQAEAKILMAVQEHILSPRFGGPIIGGIHDHISGLYLLTRGEKKFT--REEAMELLRSL
T.volcanium           EARAEARIIMKVQEQIMSPRFGRPIIGGIHDHVTAMFLLTHNNPLFT--QEEMIHIMCYV
F.acidarmanus         ESRAEARIIMKVQEQIMSPRFGGPIIGAIHDHITSLFLLTHNNPLIS--EDDTLHTVSYI
P.furiosus            EAQAEARILMEVQNHIISPRYGGPIIGGIQDHISGGYLLTREGAYFTRDEVEQMLMFAGV
O.sativa              ETRAEVLELMMVPKCIVSPQSNRPVMGIVQDTLLGCRKITKRDTLIEK--DVFMNILMWW
O.haysii              ETRAEIKEICMVPRQIVSPQSNKPVMGIVQDTLAAIRKFTKRDCFLEA--DLVMNLLMTL
                      *: :*   :  *   :::*: . .::*  :* : .   ::     :              

Orf                   LGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKG-------------
C.symbiosum           LGDYGGALPKP-GAKGQLFTGKQLFSLFLPKDFNYIITSKWSKGTKG-------------
S.acidocaldarius      TDFVGELGEPAILAPKPYYTGKQVISLFLPKDFNFHGPANISKGP---------------
A.pernix              AGYKGDLPEPAILKPEPLWTGKQLASIFLPEDLSFKGKSKTNAGD---------------
P.aerophilum          GKSQEDPPEPAILHPVELWTGKQIISHFLPKDLNWVQPTAFKS-----------------
T.pendens             GNNCDPLVEPAIIKPGPYWTGKQIVSMFLPKGLNYVGRASVAPAS---------------
M.thermophila         DISDIPVPAGYDENGDPYWTGKQIFSLILPKDLNLTFKADFCSN----------------
A.fulgidus            DISEIPVKDEY--------TGKEIFSFILP-DITLEFKAEICQG----------------
T.volcanium           DPDLIPDATIVN--GKKYYSGRNIFSTILPKGLNLRFRSKLCSGS---------------
F.acidarmanus         EFDRLPEPVIKD--GKKYYHGRDIFSLILPEGLNVKFKSHLCAGA---------------
P.furiosus            DITELPEPDKYDENGNPLWSGKTIFSLLLPEDLTVWYRNKLCDEPERCEALEKLIEEKLM
O.sativa              EDFDGKVPAPAILKPRPIWTGKQVFNLIIPKQINLIRFSGWHSEA---------------
O.haysii              PEWDGIVPPPCIMKPKMLWTGKQIYSLVIPKGTNCYRFHSTHPDE---------------
                                          *: : . .:*   .                          

Orf                   ----------TQKDVVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSE
C.symbiosum           ----------TPKDVVIKNGELISGVIDKSSIGAEEPESVLHRIAKDYGNAPAKKFLNSV
S.acidocaldarius      -RACKDEICPHDSFIVIKNGLLLEGVFDKKAIGNQQPESMLHWSIREYGTEYGKWLMDNV
A.pernix              -LACSDELCLHDSYIVITNGKLLEGVLDKKAIGAEEPNNLLHIIALEYGNSKARQLLDSF
P.aerophilum          -KCQNAYTCPTDEWIIVINGNLVKGVLDKKSIGAEQVDSLWHRIARDYSPEVARRWLDSS
T.pendens             -GKCDEEYCENDGYVLIKDGKLLLGVFDKQAIGAEKHGTVLHEIVREFGVEKAKELMDGM
M.thermophila         CPVCKGEDCENDAYVVIRNGVLLKGTIDAEAVGAFK-GKVIDRIIKEYDPGVASQFLDRM
A.fulgidus            CEECKGAECEYDAYVIIENGKLLKGTIDEKAVGAFK-GIIIDEIARKYGKEMAKKFIDDM
T.volcanium           SETCEYEKEKEDTYVTIVDGKLIHGTIDEAAISPFS-GAIIDKIFRKFGPNEAAKFIDRM
F.acidarmanus         KDKCEYEDDPADTYVVITDGKLVHGTIDDEAVGPFS-GVIVDKIFRNIGPQAAAKFIDSV
P.furiosus            PDPEEVRKLAYDGFVYIQNGKLLSGAIDKKAYGRED-GIILDLIVREYGVERARQFLDQV
O.sativa              ---ETRFITPGDTMVRIEKGELLSGTLCKKTLGTST-GSLIHVIWEEVGPDAARKFLGHT
O.haysii              ---ENTWCSPGDTRVIIENGQVLAGIICKRTVGSSE-GGLIHIIMNEFGFEVATAFFNGT
                                    : : .* :: * :   : .      : .    . .   .   :.  

Orf                   LIIIKQFVTHYGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMT
C.symbiosum           LIIAKQFITHYGFSYGYADLELPEKARKEIFDDIGASYDKVYGYIADAKKGGLRLTRGLS
S.acidocaldarius      FKMFIRFLEMRGFTMTLEDITIPDEAQNEITTKIKEGYSQVDEYIRKFNEGQLEPIPGRT
A.pernix              YRMFIRMLELRGLTISLHDIDLPDRAKQEIEELIREYKGRVYSIIEEYRKGTLEPIPGRS
P.aerophilum          LRLFLRFLDLRGFTFGMDSIYIPPEAYREIDNIIKASLEKVDKLIDDFRSGHLEAMPGFT
T.pendens             FKVFIAYLDMHGFTMGVDSVEIPREAEDDIREILQEAEKKVEDLIRQYESGELQPMPGKT
M.thermophila         TLLALRGIMLAGFSFGISDEDVPREAAEQIQDVTRSAKESVQRLIEAYRAGELEPLPGRT
A.fulgidus            TQLAIRIISKLGFTVGIDDEDIPPEAAEQIEEVLKEAENEVNRLIEAYRRGDLEPMPGRS
T.volcanium           TRLAVGFITYYGFSTGISDYDIPYSATARIEELVNQAEDRINKLIETYKRGELQPAPGRS
F.acidarmanus         TRLAVGFLSHRGFSTGIKDYDIPKDAISRIQEISNETLEKIEKLVDAFRSGQLQPLPGRS
P.furiosus            TKLTIWVITHKGFTTGIDDEDLPEEARDRIREIIREAEERVNKLIEAYKRGELEPLPGKS
O.sativa              QWLVNYWLLQNGFSIGIGDTIADAATMENINETISKAKNDVKKLIKQFRDNQLEAEAGRT
O.haysii              QRVINYWFQNYGFSIGIGDTIADDSTMQTVGTIINECYERVDELIRTAQEDKLECLPGMT
                        :    .   *::    .          :          :   :   . . *.   * :

Orf                   TKETLEAYIMSNLGKLRDRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQA
C.symbiosum           PDEALEAYIVSELSRARDTAGGIADQSFDHTNAGKIMASTGARGSSLNIGQMAGSLGQQS
S.acidocaldarius      IEESLESYILDTLDKLRKVAGEIATKYLDPFNNVYIMAITGARGSELNITQMTALLGQQS
A.pernix              LEESLEIKIMEVLDELRKRVQEVASNNLDPFNDVFVMARTGARGSDVNISQMAAMLGQQA
P.aerophilum          VEETFENKVTEILSKVREDAAVVVEKYIDKNSEGYLMAKTGARGSIVNIVQMVATLGQQT
T.pendens             RKETLEDLIMNVLAEARTRAGEVTSKHLGLLNHAVIMAKTGARGSMLNLTQMAAVVGQQS
M.thermophila         LEETLEMRIMQTLGKARDAAGQIAGRYLGLDNSGVVMAVSGARGSMLNLTQMAACVGQQS
A.fulgidus            IEETLEMRIMQVLGRARDRAGKIAQRHLGMDNAAVIMAVSGARGSMLNLTQMAACIGQQS
T.volcanium           VEDTLEIEILSEAGVVRDESGKIASSYLGLSVPSVIMARSGARATMLNISEVAGIVGQQS
F.acidarmanus         VEDTLEVEILSSTGGVRDESGKIASQYLGLNDPSVIMARSGARAKMLNIAEVAGMVGQQS
P.furiosus            LEDTLESLIMAVLAEARDNAGAVAEKYLGMDNHTVIMAKTGARGKILNITQMAALLGQQS
O.sativa              TMESFENRVNEVLNKARDVAGSSAEKSLSESNNLKAMATAGSKGTFINISQMTACVGQQN
O.haysii              LKESFEHKVNFELNRARDQSGKIVQRRLKEDNNVRQMVDAGSKGSFINVSQMTACVGQQN
                        :::*  :       *      .   :        *. :*::.. :*: ::.. :*** 

Orf                   RRGNRLNK--GYNNRVLTHFEEHENDPDAHG-----------------------------
C.symbiosum           RRGQRLLK--GYNNRALPHFRENDDSPDAHGFVKSNYRDGLSALEFFFHAMAGREGLVDT
S.acidocaldarius      VRGERIRR--GYRERTLSLFKYGDIAPEARGFVKNSFMRGLSPYEMFFHAAGGREGLVDT
A.pernix              VRGRRIRR--GLRNRVLAHFKENDIEPEAWGFVRSSFRKGLRPTEVFFHAAAGREGLVDT
P.aerophilum          IRGERIRR--GFRTRTLPHFPVGDIGAFSGGFVRNCFRCGLTPVEYFFHAAAGRDGLIDT
T.pendens             VRGKRIER--GYTGRALPHFVKGDLSPLAKGFVYSSFRRGLSPVEFFFHAISGREGLVDT
M.thermophila         VRGERIKR--GYTDRTLPHFKRGDLGAEAHGFVESSYKKGLSPTEFFFHAIGGREGLVDT
A.fulgidus            VRGERISRGYTYTNRTLSHFKPGDLGAEARGFVRSSYKKGLSPVEFFFHAAGGREGLVDT
T.volcanium           VRGGRLNR--GYYNRTLPHFKRGDIGADARGFVKSSYMTGLTPTEYFFHSIGGREGLVDT
F.acidarmanus         VRGGRLNR--GYANRTLSHFKENDLGAYARGFIKSSYRAGLNPTEYFFHSIGGREGLVDI
P.furiosus            IRGKRLYR--GFRGRVLSHFKPGDLGARAKGFVVNSYKSGLTPQEYFFHAMGGREGLVDT
O.sativa              VEGKRIPFG--FTNRTLPHFTKNDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDT
O.haysii              VEGKRIPFG--FRYRTLPHFCKDDYSPQSKGFVEN-------------------------
                       .* *:        *.*. *   :  . : *                             

Orf                   ------------------------------------------------------------
C.symbiosum           AVRTQQSGYMQRRLINALEHIRLEYDNTVRDPHG-HIIQFLYGEDGIDVAKSDHGEAFNV
S.acidocaldarius      AVKTSQSGYMQRRLINALSDLRIEYDGTVRSLYG-DIVQVVYGDDAVHPMYSAHSKSVNV
A.pernix              AVKTSQSGYMQRRLINALQDIVVTYDGTVRDLYG-NLIQLKYGEDGVDPMKTYHGKPVDV
P.aerophilum          AVRTAQSGYMQRRLINALQDVYVAYDGTVRFGGA-MLLQYLYGEDGVDVSRSDHGKVVDI
T.pendens             AVRTAQSGYMYRRLQSAMQDFYVSYDGTVRNSEG-MIIQFRYGEDSVDPARSDHGKPVDV
M.thermophila         AIRTSQSGYLQRRLVNALQDLEVNYDGTVRETRG-MIVQFKYGEDGVDPSRRDYASPENV
A.fulgidus            AVRTSQSGYLQRRMINALQDLKVEYDGTVREQTSGALVQFRYGEDGVDPMRSFRGKPVDV
T.volcanium           AVRTSRSGYMQRRLINAFEDLKVDEERQVKDTVG-SLIQIKYGEDGIDPTRSEKGRAIDI
F.acidarmanus         AVRTSRSGYMQRRLINAFEDLKVNETRRVEDTIG-SVVQFKYGEDGIDPTRSDEGQTVDV
P.furiosus            AVRTAQSGYMQRRLINALQDLKVEYDGTVRSPEG-IIVQFKYGEDGVDPMKSWRGKTVDV
O.sativa              AVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLG-DVIQFLYGEDGMDAIWIESQKLDSL
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           HRLIESQMIVDTGKKATAPEIAEIAKKYAKTFNPRMKEIVTGALAECGLSKEGAEKVGKK
S.acidocaldarius      NRVIERVIGWKR------------------------------------------------
A.pernix              KRIIQRVKASKAETV---------------------------------------------
P.aerophilum          KSLKMWIR----------------------------------------------------
T.pendens             DKLIKKVLTLRGEKRE--------------------------------------------
M.thermophila         HRIIRKVLAGENA-----------------------------------------------
A.fulgidus            RRIIREVIGEVKK-----------------------------------------------
T.volcanium           NYILFDENAGR-------------------------------------------------
F.acidarmanus         DYAAYDEFGDEQ------------------------------------------------
P.furiosus            DRIIVRTLLKMRGNNKAKV-----------------------------------------
O.sativa              KMKKAEFDNVFRYELDDENWKPNYLSTQHAEDLKTISEIRNVFEAEVQKLEADRFQLGTE
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           GLDLYNKAKVEPGQAVGIVTAQSIGEPGTQMTLRTFHFAGIKERNVTLGLPRLIELVDAR
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              IATTGDNTWPMPVNLKRLIWNAQKTFKIDLRRPSDMHPMEIVDAIDKLQERLKVVPGDDD
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           KKPVTPTMDIHLDGESKGSRDRAIEIAKNVLQTKISALIADMDTDYSTQIRLGLDEGKMD
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              ISIEAQKNATLFFNILLRSTFASKRVLKEYRLTKEAFEWVIGEIESRFLQSLVAPGEMIG
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           DRGCTPDDVAAALASNKKFKVSVEGRRLTLDMAEEYDAPAVIAVRNKVLNTTVKGVPDVE
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              CVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKNIKTPSLSVHLKPEVN
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           RLTLVQKDDEWVIQTTGSNLPKVLAVEGIDKRQVRTNNVFEIAGTLGIEAARNALINELR
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              KKKELAKNVQCALEYTTLRSVTHATEIWYDPDPLGTIIEEDAEFVQSYYEMPDEDIDPDK
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           STLEDQGLEVDIRYIMLVSDLMCSRGYMQQIGRHGIAGTKDSVLARAAFEITVPTIAHAA
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              ISPWLLRIELNREMMVDKKLSMADIAEKINHEFDDDLSCIFNDDNADKLILRVRITNDEA
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           LSGEVEHLRGVTENVIVGSNIPIGSGTVDLYMQVAKKK----------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              QKGEIQDEYGEDDVFLKKIESNMLTEMALRGIPGINKVFIKEGNVNKFEDNDGFKTEKGW
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              MLDTEGVNLLAVMCHEDVDATRTTSNHLIEVIEVLGIEAVRRALLDELRVVISFDGSYVN
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              YRHLAVLCDTMTYRGHLMAITRHGINRNDTGPLMRCSFEETVDILLDAAVYAESDPLRGV
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              SENIMLGQLAPIGTGGCDLYLNDQMLKQAIELQLPSYVEGLDFGMMTSACSPISGTPYHQ
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              GMMSPSYLLSPDIRASPTAADAQFSPYVGGMAFSPVSSPGNYTPSSGGGYSPSPPVCTPG
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              PGSFTSSSPYNPVSPFYSPASPLSCPLTSPSYVPTSLPHSPTSPIYSATSPIYSPSSPIY
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              SPTSLSYSPTSPVYSPTSPVYNPTSSAYSPTSPSYNPTSPSYSYSPTSPSYSPTSPSYSY
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              SPTSPSYSPTSPSYNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSSAYSP
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              TSPAYSPTSPGYSPTSPSYSPSSPSYNPSSVKYTPSHAYSPSSPNYYSSTSPTYSPTSPS
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              YSQPSPSYSPTRGEEGAIANGDGVKRLVAFPSSSPAREDSVATPLFVVGSPPCHLFGCGV
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              AASPRRRCTVSLRCRRFPPPPLSYLIIVAHGRSVIVVSLRRGHHPQGGAPSSSPLPPRPP
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              SPEPRSADAVHIICHQPRIASSLRPPLASTRERIGERGRKKKAREEEHLGGGEGEGAAAA
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ------------------------------------------------------------
C.symbiosum           ------------------------------------------------------------
S.acidocaldarius      ------------------------------------------------------------
A.pernix              ------------------------------------------------------------
P.aerophilum          ------------------------------------------------------------
T.pendens             ------------------------------------------------------------
M.thermophila         ------------------------------------------------------------
A.fulgidus            ------------------------------------------------------------
T.volcanium           ------------------------------------------------------------
F.acidarmanus         ------------------------------------------------------------
P.furiosus            ------------------------------------------------------------
O.sativa              LRSRRSSAAAAAVGNMMRALQTNTCHRNKYAAAADITLPNPAMRGEAEVDAEMETRRPRR
O.haysii              ------------------------------------------------------------
                                                                                  

Orf                   ----------------------------------------
C.symbiosum           ----------------------------------------
S.acidocaldarius      ----------------------------------------
A.pernix              ----------------------------------------
P.aerophilum          ----------------------------------------
T.pendens             ----------------------------------------
M.thermophila         ----------------------------------------
A.fulgidus            ----------------------------------------
T.volcanium           ----------------------------------------
F.acidarmanus         ----------------------------------------
P.furiosus            ----------------------------------------
O.sativa              GKEEHLASVGVGGAGHCLPASPRRRLPAPTHRDFLHRPPL
O.haysii              ----------------------------------------

BLAST

Blast P contre Swiss Prot
 

Query=  Translation of ORF number 1 in reading frame 1 on the direct strand.
Length=311


Sequences producing significant alignments:                        (Bits)  Value

gi|73920763|sp|P11512|RPOA1_SULAC  DNA-directed RNA polymerase su   249    7e-66
gi|17368575|sp|Q980R2|RPOA1_SULSO  DNA-directed RNA polymerase su   233    6e-61
gi|47117321|sp|Q9HM79|RPOA1_HALSA  DNA-directed RNA polymerase su   228    2e-59
gi|6685898|sp|O27125|RPOA1_METTH  DNA-directed RNA polymerase sub   228    3e-59  Gene info
gi|1173129|sp|P41556|RPOA1_METVA  DNA-directed RNA polymerase sub   226    1e-58
gi|401016|sp|P31813|RPOA1_THECE  DNA-directed RNA polymerase subu   217    3e-56
gi|3915860|sp|Q58445|RPOA1_METJA  DNA-directed RNA polymerase ...   207    4e-53
gi|548820|sp|Q03585|RPOA1_THEAC  DNA-directed RNA polymerase subu   199    1e-50
gi|3122765|sp|O14802|RPC1_HUMAN  DNA-directed RNA polymerase III    185    1e-46  Gene info
gi|133402|sp|P09846|RPOA1_METTW  DNA-directed RNA polymerase subu   185    2e-46
gi|133356|sp|P04051|RPC1_YEAST  DNA-directed RNA polymerase III l   183    8e-46  Gene info
gi|9297042|sp|O94666|RPC1_SCHPO  DNA-directed RNA polymerase III    181    3e-45
gi|59800205|sp|Q6BI69|RPC1_DEBHA  DNA-directed RNA polymerase III   176    1e-43
gi|548817|sp|P36594|RPB1_SCHPO  DNA-directed RNA polymerase II...   175    2e-43
gi|12644149|sp|P18616|RPB1_ARATH  DNA-directed RNA polymerase II    167    5e-41  Gene info
gi|51701979|sp|Q75A34|RPB1_ASHGO  DNA-directed RNA polymerase ...   156    1e-37  Gene info
gi|133327|sp|P08775|RPB1_MOUSE  DNA-directed RNA polymerase II la   153    9e-37  Gene info
gi|133326|sp|P24928|RPB1_HUMAN  DNA-directed RNA polymerase II la   153    9e-37  Gene info
gi|133355|sp|P08968|RPC1_TRYBB  DNA-directed RNA polymerase III l   151    2e-36
gi|60393735|sp|P35074|RPB1_CAEBR  DNA-directed RNA polymerase II    149    8e-36
gi|14286163|sp|P04052|RPB1_DROME  DNA-directed RNA polymerase II    149    9e-36  Gene info
gi|21542435|sp|P16356|RPB1_CAEEL  DNA-directed RNA polymerase II    147    3e-35  Gene info
gi|2507347|sp|P04050|RPB1_YEAST  DNA-directed RNA polymerase I...   145    2e-34  Gene info
gi|133329|sp|P17545|RPB1_TRYBB  DNA-directed RNA polymerase II la   145    2e-34
gi|133332|sp|P17546|RPB2_TRYBB  DNA-directed RNA polymerase II la   145    2e-34
gi|133399|sp|P15349|RPOA1_HALMO  DNA-directed RNA polymerase subu   144    4e-34
gi|51702033|sp|Q8SSC4|RPB1_ENCCU  DNA-directed RNA polymerase ...   144    4e-34
gi|133354|sp|P27625|RPC1_PLAFA  DNA-directed RNA polymerase III l   129    1e-29
gi|133352|sp|P25202|RPC1_GIALA  DNA-directed RNA polymerase III l   121    3e-27
gi|1173142|sp|P42486|RPO1_ASFB7  DNA-directed RNA polymerase subu   107    5e-23
gi|2507346|sp|P10964|RPA1_YEAST  DNA-directed RNA polymerase I 19  99.0    2e-20  Gene info
gi|133328|sp|P14248|RPB1_PLAFD  DNA-directed RNA polymerase II la  87.8    5e-17
gi|3914802|sp|O54889|RPA1_RAT  DNA-directed RNA polymerase I l...  85.1    3e-16  Gene info
gi|56405300|sp|O35134|RPA1_MOUSE  DNA-directed RNA polymerase ...  83.2    9e-16  Gene info
gi|2507344|sp|P37871|RPOC_BACSU  DNA-directed RNA polymerase b...  80.9    6e-15
gi|12643662|sp|O95602|RPA1_HUMAN  DNA-directed RNA polymerase ...  80.5    7e-15  Gene info
gi|3334489|sp|P15398|RPA1_SCHPO  DNA-directed RNA polymerase I 19  79.3    1e-14
gi|81171142|sp|P0C0E0|RPOC_STRP1  DNA-directed RNA polymerase ...  78.6    2e-14
gi|56405368|sp|P91875|RPA1_DROME  DNA-directed RNA polymerase I l  78.2    3e-14
gi|90111034|sp|Q48VR0|RPOC_STRPM  DNA-directed RNA polymerase ...  77.8    4e-14
gi|41018036|sp|Q8E238|RPOC_STRA5  DNA-directed RNA polymerase ...  77.4    6e-14
gi|76364061|sp|P0C0D9|RPOC_STRPY  DNA-directed RNA polymerase ...  76.6    1e-13
gi|25453264|sp|Q8P2Y2|RPOC_STRP8  DNA-directed RNA polymerase ...  76.3    1e-13
gi|25453263|sp|Q8K8W2|RPOC_STRP3  DNA-directed RNA polymerase ...  76.3    1e-13
gi|81558137|sp|Q5L404|RPOC_GEOKA  DNA-directed RNA polymerase ...  75.9    2e-13
gi|73917877|sp|Q5XE96|RPOC_STRP6  DNA-directed RNA polymerase ...  75.5    2e-13
gi|90111023|sp|Q38UQ3|RPOC_LACSS  DNA-directed RNA polymerase ...  73.9    7e-13  Gene info
gi|81667234|sp|Q65PB4|RPOC_BACLD  DNA-directed RNA polymerase ...  72.4    2e-12
gi|41018029|sp|Q8DNF1|RPOC_STRR6  DNA-directed RNA polymerase ...  71.6    3e-12  Gene info
gi|81668274|sp|Q74L94|RPOC_LACJO  DNA-directed RNA polymerase ...  71.2    4e-12
gi|73917878|sp|Q5LXV4|RPOC_STRT1  DNA-directed RNA polymerase ...  70.9    6e-12  Gene info
gi|41018114|sp|Q97NQ8|RPOC_STRPN  DNA-directed RNA polymerase ...  70.9    6e-12
gi|41018080|sp|Q8R7U7|RPOC_THETN  DNA-directed RNA polymerase ...  70.5    6e-12
gi|41018127|sp|Q9CEN7|RPOC_LACLA  DNA-directed RNA polymerase ...  70.5    8e-12
gi|49065847|sp|P77819|RPOC_BACAN  DNA-directed RNA polymerase ...  70.1    1e-11
gi|81614035|sp|Q6HPR5|RPOC_BACHK  DNA-directed RNA polymerase ...  69.7    1e-11
gi|81689843|sp|Q63H97|RPOC_BACCZ  DNA-directed RNA polymerase ...  69.7    1e-11
gi|81570006|sp|Q73FA3|RPOC_BACC1  DNA-directed RNA polymerase ...  69.7    1e-11  Gene info
gi|41017963|sp|Q81J47|RPOC_BACCR  DNA-directed RNA polymerase ...  69.7    1e-11  Gene info
gi|114152143|sp|P0C1T4|RPOC_STAAU  DNA-directed RNA polymerase...  69.3    2e-11
gi|109893854|sp|Q2YSB8|RPOC_STAAB  DNA-directed RNA polymerase...  68.9    2e-11
gi|11134852|sp|Q9Z9M1|RPOC_BACHD  DNA-directed RNA polymerase ...  68.9    2e-11
gi|109893853|sp|Q2FJ97|RPOC_STAA3  DNA-directed RNA polymerase...  68.6    2e-11
gi|56749584|sp|Q6GJC5|RPOC_STAAR  DNA-directed RNA polymerase ...  68.6    2e-11  Gene info
gi|41017891|sp|P60284|RPOC_STAAM  DNA-directed RNA polymerase ...  68.6    2e-11  Gene info
gi|41018003|sp|Q88XZ2|RPOC_LACPL  DNA-directed RNA polymerase ...  67.8    4e-11
gi|3914835|sp|P95405|RPOC_OENOE  DNA-directed RNA polymerase b...  67.8    5e-11
gi|41018033|sp|Q8DS47|RPOC_STRMU  DNA-directed RNA polymerase ...  67.0    8e-11
gi|17380561|sp|P77879|RPOC_LISIN  DNA-directed RNA polymerase ...  66.2    1e-10
gi|2500616|sp|P77917|RPOC_PEDAC  DNA-directed RNA polymerase b...  66.2    1e-10
gi|109893837|sp|Q2RFP0|RPOC_MOOTA  DNA-directed RNA polymerase...  65.9    2e-10
gi|20139473|sp|Q8YA96|RPOC_LISMO  DNA-directed RNA polymerase ...  65.1    3e-10
gi|41017979|sp|Q82Z41|RPOC_ENTFA  DNA-directed RNA polymerase ...  64.7    3e-10
gi|73917875|sp|Q724E9|RPOC_LISMF  DNA-directed RNA polymerase ...  64.7    4e-10  Gene info
gi|90111036|sp|Q3SLQ5|RPOC_THIDA  DNA-directed RNA polymerase ...  63.9    6e-10  Gene info
gi|81601107|sp|Q5WLR9|RPOC_BACSK  DNA-directed RNA polymerase ...  63.9    7e-10
gi|3914834|sp|P94899|RPOC_LEUPS  DNA-directed RNA polymerase b...  63.5    1e-09
gi|41018013|sp|Q8CJT1|RPOC_STRCO  DNA-directed RNA polymerase ...  62.8    1e-09
gi|82581606|sp|Q4L3K4|RPOC_STAHJ  DNA-directed RNA polymerase ...  62.8    2e-09  Gene info
gi|41018046|sp|Q8ETY7|RPOC_OCEIH  DNA-directed RNA polymerase ...  62.4    2e-09
gi|41018010|sp|Q8A470|RPOC_BACTN  DNA-directed RNA polymerase ...  62.4    2e-09
gi|2500614|sp|P77882|RPOC_LISGR  DNA-directed RNA polymerase b...  62.4    2e-09
gi|548827|sp|P36252|RPOC_THEMA  DNA-directed RNA polymerase be...  62.0    2e-09
gi|75433041|sp|Q5FM96|RPOC_LACAC  DNA-directed RNA polymerase ...  62.0    3e-09
gi|41018014|sp|Q8CQ83|RPOC_STAES  DNA-directed RNA polymerase ...  61.6    3e-09  Gene info
gi|2500612|sp|P77839|RPOC_BROTH  DNA-directed RNA polymerase b...  60.8    5e-09
gi|82581607|sp|Q49V53|RPOC_STAS1  DNA-directed RNA polymerase ...  60.8    5e-09  Gene info
gi|41017974|sp|Q82DQ4|RPOC_STRAW  DNA-directed RNA polymerase ...  60.8    5e-09
gi|81336483|sp|Q4QN34|RPOC_HAEI8  DNA-directed RNA polymerase ...  60.8    6e-09  Gene info
gi|1173155|sp|P43739|RPOC_HAEIN  DNA-directed RNA polymerase b...  60.8    6e-09
gi|110816550|sp|Q65W40|RPOC_MANSM  DNA-directed RNA polymerase...  60.8    6e-09
gi|20139601|sp|Q97EH0|RPOC_CLOAB  DNA-directed RNA polymerase ...  60.5    7e-09
gi|81602029|sp|Q5X865|RPOC_LEGPA  DNA-directed RNA polymerase ...  60.5    7e-09
gi|41018083|sp|Q8RHI7|RPOC_FUSNN  DNA-directed RNA polymerase ...  60.1    9e-09
gi|115305564|sp|Q5ZYP9|RPOC_LEGPH  DNA-directed RNA polymerase...  60.1    9e-09
gi|3914833|sp|P94892|RPOC_LEUME  DNA-directed RNA polymerase b...  60.1    9e-09
gi|81601551|sp|Q5WZL8|RPOC_LEGPL  DNA-directed RNA polymerase ...  60.1    1e-08
gi|81600018|sp|Q5QWA4|RPOC_IDILO  DNA-directed RNA polymerase ...  60.1    1e-08
gi|41018005|sp|Q890N5|RPOC_CLOTE  DNA-directed RNA polymerase ...  60.1    1e-08
gi|109893834|sp|Q2S906|RPOC_HAHCH  DNA-directed RNA polymerase...  59.7    1e-08
gi|90111017|sp|Q3A9Q8|RPOC_CARHZ  DNA-directed RNA polymerase ...  59.7    1e-08  Gene info
gi|115305565|sp|Q3J8Q8|RPOC_NITOC  DNA-directed RNA polymerase...  58.9    2e-08
gi|109893833|sp|Q39Y12|RPOC_GEOMG  DNA-directed RNA polymerase...  58.5    3e-08
gi|81313503|sp|Q5L898|RPOC_BACFN  DNA-directed RNA polymerase ...  58.2    4e-08  Gene info
gi|60390335|sp|Q64NJ8|RPOC_BACFR  DNA-directed RNA polymerase ...  58.2    4e-08
gi|20139578|sp|Q93R87|RPOC_CLOPE  DNA-directed RNA polymerase ...  57.8    4e-08
gi|81558286|sp|Q5LMQ6|RPOC_SILPO  DNA-directed RNA polymerase ...  57.8    4e-08
gi|3914838|sp|P96178|RPOC_WEIPA  DNA-directed RNA polymerase b...  57.8    5e-08
gi|75497690|sp|Q5GRY9|RPOBC_WOLTR  Bifunctional DNA-directed R...  57.8    5e-08
gi|115305567|sp|Q3ILP8|RPOC_PSEHT  DNA-directed RNA polymerase...  57.4    6e-08
gi|41018009|sp|Q89J75|RPOC_BRAJA  DNA-directed RNA polymerase ...  57.4    7e-08
gi|133316|sp|P16355|RPA1_TRYBB  DNA-directed RNA polymerase I lar  57.4    7e-08
gi|108884787|sp|Q3YST4|RPOC_EHRCJ  DNA-directed RNA polymerase...  57.0    8e-08
gi|90111035|sp|Q47LI6|RPOC_THEFY  DNA-directed RNA polymerase ...  56.6    1e-07  Gene info
gi|18203081|sp|Q9J593|RPO1_FOWPV  DNA-directed RNA polymerase 147  56.6    1e-07  Gene info
gi|109893838|sp|Q2ST47|RPOC_MYCCT  DNA-directed RNA polymerase...  56.2    1e-07
gi|109893830|sp|Q2GFP4|RPOC_EHRCR  DNA-directed RNA polymerase...  56.2    2e-07
gi|41018126|sp|Q9AAU1|RPOC_CAUCR  DNA-directed RNA polymerase ...  55.8    2e-07
gi|81599186|sp|Q5PBG3|RPOC_ANAMM  DNA-directed RNA polymerase ...  55.8    2e-07
gi|109893824|sp|Q2GJ69|RPOC_ANAPZ  DNA-directed RNA polymerase...  55.8    2e-07
gi|115305561|sp|Q6FF89|RPOC_ACIAD  DNA-directed RNA polymerase...  55.5    2e-07
gi|109893849|sp|Q1RHD1|RPOC_RICBR  DNA-directed RNA polymerase...  55.5    2e-07
gi|81652940|sp|Q73IW9|RPOBC_WOLPM  Bifunctional DNA-directed R...  55.5    2e-07
gi|81598287|sp|Q5NPK4|RPOC_ZYMMO  DNA-directed RNA polymerase ...  55.5    3e-07
gi|31340405|sp|Q89B21|RPOC_BUCBP  DNA-directed RNA polymerase ...  55.5    3e-07
gi|90111037|sp|Q3BWZ0|RPOC_XANC5  DNA-directed RNA polymerase ...  55.5    3e-07  Gene info
gi|41018076|sp|Q8PNS9|RPOC_XANAC  DNA-directed RNA polymerase ...  55.5    3e-07
gi|75536058|sp|Q4UKD5|RPOC_RICFE  DNA-directed RNA polymerase ...  55.1    3e-07
gi|3914837|sp|P96177|RPOC_WEIHE  DNA-directed RNA polymerase b...  55.1    3e-07
gi|109893848|sp|Q2RQV4|RPOC_RHORT  DNA-directed RNA polymerase...  55.1    3e-07
gi|41017995|sp|Q87KQ5|RPOC_VIBPA  DNA-directed RNA polymerase ...  55.1    3e-07
gi|41018074|sp|Q8PC55|RPOC_XANCP  DNA-directed RNA polymerase ...  55.1    3e-07
gi|41018143|sp|Q9K1J1|RPOC_NEIMB  DNA-directed RNA polymerase ...  55.1    3e-07
gi|62297927|sp|Q8KTH8|RPOC_XANOR  DNA-directed RNA polymerase ...  55.1    3e-07
gi|81682418|sp|Q60A05|RPOC_METCA  DNA-directed RNA polymerase ...  54.7    4e-07
gi|41018065|sp|Q8KG14|RPOC_CHLTE  DNA-directed RNA polymerase ...  54.3    5e-07
gi|75500410|sp|Q4ZMN8|RPOC_PSEU2  DNA-directed RNA polymerase ...  54.3    5e-07  Gene info
gi|41017998|sp|Q889X7|RPOC_PSESM  DNA-directed RNA polymerase ...  54.3    6e-07
gi|41017917|sp|Q7NQE7|RPOC_CHRVO  DNA-directed RNA polymerase ...  53.9    6e-07
gi|81618790|sp|Q6MRX5|RPOC_MYCMS  DNA-directed RNA polymerase ...  53.9    6e-07
gi|90111026|sp|Q3A6Q3|RPOC_PELCD  DNA-directed RNA polymerase ...  53.9    6e-07  Gene info
gi|133379|sp|P20504|RPO1_VACCC  DNA-directed RNA polymerase 147 k  53.9    7e-07
gi|133380|sp|P07392|RPO1_VACCV  DNA-directed RNA polymerase 147 k  53.9    7e-07
gi|56404703|sp|O57204|RPO1_VACCA  DNA-directed RNA polymerase 147  53.9    7e-07
gi|90111018|sp|Q3ATP4|RPOC_CHLCH  DNA-directed RNA polymerase ...  53.5    8e-07  Gene info
gi|417701|sp|P33053|RPO1_VARV  DNA-directed RNA polymerase 147 kD  53.5    9e-07  Gene info
gi|90111015|sp|Q492C0|RPOC_BLOPB  DNA-directed RNA polymerase ...  53.1    1e-06  Gene info
gi|14916697|sp|Q9RH40|RPOC_RICCN  DNA-directed RNA polymerase ...  53.1    1e-06
gi|109893855|sp|Q2LQ86|RPOC_SYNAS  DNA-directed RNA polymerase...  53.1    1e-06
gi|41018131|sp|Q9CK92|RPOC_PASMU  DNA-directed RNA polymerase ...  53.1    1e-06
gi|6226044|sp|Q9ZE20|RPOC_RICPR  DNA-directed RNA polymerase b...  53.1    1e-06
gi|90111027|sp|Q4FLL3|RPOC_PELUB  DNA-directed RNA polymerase ...  53.1    1e-06  Gene info
gi|90111028|sp|Q48D30|RPOC_PSE14  DNA-directed RNA polymerase ...  52.8    1e-06  Gene info
gi|90111022|sp|Q30X04|RPOC_DESDG  DNA-directed RNA polymerase ...  52.8    1e-06  Gene info
gi|75432355|sp|Q5F5R6|RPOC_NEIG1  DNA-directed RNA polymerase ...  52.8    2e-06
gi|41018142|sp|Q9JX03|RPOC_NEIMA  DNA-directed RNA polymerase ...  52.8    2e-06
gi|109893846|sp|Q2IXR9|RPOC_RHOP2  DNA-directed RNA polymerase...  52.4    2e-06
gi|11134497|sp|P57145|RPOC_BUCAI  DNA-directed RNA polymerase ...  52.4    2e-06
gi|109893841|sp|Q2GCD8|RPOC_NOVAD  DNA-directed RNA polymerase...  52.4    2e-06
gi|81562132|sp|Q6N4S0|RPOC_RHOPA  DNA-directed RNA polymerase ...  52.4    2e-06
gi|109893835|sp|Q28UX6|RPOC_JANSC  DNA-directed RNA polymerase...  52.0    2e-06
gi|41018000|sp|Q88QP1|RPOC_PSEPK  DNA-directed RNA polymerase ...  52.0    2e-06  Gene info
gi|60393875|sp|P0A2R4|RPOC_SALTY  DNA-directed RNA polymerase ...  52.0    2e-06
gi|81598745|sp|Q5P338|RPOC_AZOSE  DNA-directed RNA polymerase ...  52.0    2e-06
gi|81557181|sp|Q5FTX8|RPOC_GLUOX  DNA-directed RNA polymerase ...  52.0    3e-06
gi|90111033|sp|Q32AG0|RPOC_SHIDS  DNA-directed RNA polymerase ...  52.0    3e-06  Gene info
gi|67472405|sp|P0A8T7|RPOC_ECOLI  DNA-directed RNA polymerase ...  52.0    3e-06
gi|81557347|sp|Q5HC04|RPOC_EHRRW  DNA-directed RNA polymerase ...  51.2    4e-06  Gene info
gi|75432657|sp|Q5FFD8|RPOC_EHRRG  DNA-directed RNA polymerase ...  51.2    4e-06  Gene info
gi|109893842|sp|Q3B1H8|RPOC_PELLD  DNA-directed RNA polymerase...  51.2    4e-06
gi|32129998|sp|Q87A33|RPOC_XYLFT  DNA-directed RNA polymerase ...  51.2    5e-06  Gene info
gi|109893851|sp|Q2S1Q6|RPOC_SALRD  DNA-directed RNA polymerase...  51.2    5e-06
gi|90111019|sp|Q47UW0|RPOC_COLP3  DNA-directed RNA polymerase ...  50.8    5e-06  Gene info
gi|14423917|sp|Q9HWC9|RPOC_PSEAE  DNA-directed RNA polymerase ...  50.8    6e-06
gi|41018050|sp|Q8F0S3|RPOC_LEPIN  DNA-directed RNA polymerase ...  50.8    6e-06
gi|45477217|sp|Q7VRP8|RPOC_BLOFL  DNA-directed RNA polymerase ...  50.4    7e-06  Gene info
gi|60390463|sp|Q6MJ10|RPOC_BDEBA  DNA-directed RNA polymerase ...  50.4    7e-06
gi|41018051|sp|Q8FB83|RPOC_ECOL6  DNA-directed RNA polymerase ...  50.4    8e-06
gi|41018020|sp|Q8D232|RPOC_WIGBR  DNA-directed RNA polymerase ...  50.4    8e-06  Gene info
gi|17433258|sp|Q9TL05|RPOC1_NEPOL  DNA-directed RNA polymerase...  50.1    9e-06  Gene info
gi|41017970|sp|Q820D6|RPOC_TROWT  DNA-directed RNA polymerase ...  50.1    1e-05  Gene info
gi|41017971|sp|Q820D9|RPOC_TROW8  DNA-directed RNA polymerase ...  50.1    1e-05
gi|90111029|sp|Q4K527|RPOC_PSEF5  DNA-directed RNA polymerase ...  50.1    1e-05  Gene info
gi|41017906|sp|Q7MGS0|RPOC_VIBVY  DNA-directed RNA polymerase ...  49.7    1e-05  Gene info
gi|41018019|sp|Q8D1H3|RPOC_YERPE  DNA-directed RNA polymerase ...  49.7    1e-05
gi|41018047|sp|Q8EWX0|RPOC_MYCPE  DNA-directed RNA polymerase ...  49.3    2e-05
gi|41017935|sp|Q7VKL8|RPOC_HAEDU  DNA-directed RNA polymerase ...  49.3    2e-05
gi|3914814|sp|O67763|RPOC_AQUAE  DNA-directed RNA polymerase b...  49.3    2e-05
gi|60390346|sp|Q661N0|RPOC_BORGA  DNA-directed RNA polymerase ...  49.3    2e-05
gi|90111021|sp|Q47JA9|RPOC_DECAR  DNA-directed RNA polymerase ...  48.9    2e-05  Gene info
gi|109893823|sp|Q2II85|RPOC_ANADE  DNA-directed RNA polymerase...  48.9    2e-05
gi|1350850|sp|P42080|RPOC1_CYAPA  DNA-directed RNA polymerase ...  48.9    2e-05  Gene info
gi|22654278|sp|P41185|RPOC_BUCAP  DNA-directed RNA polymerase ...  48.5    3e-05
gi|81648026|sp|Q6G3X4|RPOC_BARHE  DNA-directed RNA polymerase ...  48.1    4e-05
gi|109893847|sp|Q211D9|RPOC_RHOPB  DNA-directed RNA polymerase...  48.1    4e-05
gi|133425|sp|P22704|RPOC1_ANASP  DNA-directed RNA polymerase g...  48.1    4e-05  Gene info
gi|92090953|sp|Q3K5Y2|RPOC_PSEPF  DNA-directed RNA polymerase ...  47.8    4e-05  Gene info
gi|7531199|sp|Q9X6Y2|RPOC_AQUPY  DNA-directed RNA polymerase b...  47.8    4e-05
gi|41018026|sp|Q8DL56|RPOC1_SYNEL  DNA-directed RNA polymerase...  47.8    4e-05
gi|1710673|sp|P51251|RPOC1_PORPU  DNA-directed RNA polymerase ...  47.8    5e-05  Gene info
gi|13878754|sp|Q9MUS6|RPOC1_MESVI  DNA-directed RNA polymerase...  47.8    5e-05  Gene info
gi|6094127|sp|O83270|RPOC_TREPA  DNA-directed RNA polymerase b...  47.4    6e-05
gi|133434|sp|P14563|RPOC1_NOSCO  DNA-directed RNA polymerase g...  47.4    6e-05
gi|81647016|sp|Q6FZM0|RPOC_BARQU  DNA-directed RNA polymerase ...  47.4    6e-05
gi|32130456|sp|Q9PA87|RPOC_XYLFA  DNA-directed RNA polymerase ...  47.4    7e-05
gi|41018118|sp|Q98N65|RPOC_RHILO  DNA-directed RNA polymerase ...  47.4    7e-05
gi|109893844|sp|Q2K9M3|RPOC_RHIEC  DNA-directed RNA polymerase...  47.0    7e-05
gi|115305562|sp|Q3Z8V3|RPOC_DEHE1  DNA-directed RNA polymerase...  47.0    8e-05
gi|109893852|sp|Q2NWR5|RPOC_SODGM  DNA-directed RNA polymerase...  47.0    8e-05
gi|41017916|sp|Q7NDF8|RPOC1_GLOVI  DNA-directed RNA polymerase...  47.0    8e-05
gi|41017909|sp|Q7MX26|RPOC_PORGI  DNA-directed RNA polymerase ...  47.0    8e-05
gi|3914812|sp|O51349|RPOC_BORBU  DNA-directed RNA polymerase b...  46.6    1e-04
gi|60390507|sp|Q73JJ8|RPOC_TREDE  DNA-directed RNA polymerase ...  46.6    1e-04
gi|85700398|sp|Q56P12|RPOC1_LACSA  DNA-directed RNA polymerase...  46.6    1e-04
gi|41018147|sp|Q9KW13|RPOC_SHEVI  DNA-directed RNA polymerase ...  46.6    1e-04
gi|115305566|sp|Q6LLW3|RPOC_PHOPR  DNA-directed RNA polymerase...  46.6    1e-04
gi|17369153|sp|Q9KV29|RPOC_VIBCH  DNA-directed RNA polymerase ...  46.6    1e-04
gi|41018054|sp|Q8G070|RPOC_BRUSU  DNA-directed RNA polymerase ...  46.2    1e-04
gi|41018097|sp|Q8YHP7|RPOC_BRUME  DNA-directed RNA polymerase ...  46.2    1e-04
gi|81566209|sp|Q727C6|RPOC_DESVH  DNA-directed RNA polymerase ...  46.2    1e-04
gi|109893831|sp|Q2JFI4|RPOC_FRASC  DNA-directed RNA polymerase...  46.2    1e-04
gi|23822110|sp|Q9BBS8|RPOC1_LOTJA  DNA-directed RNA polymerase...  46.2    2e-04  Gene info
gi|14195184|sp|O19897|RPOC1_CYACA  DNA-directed RNA polymerase...  46.2    2e-04  Gene info
gi|41017931|sp|Q7V5P2|RPOC1_PROMM  DNA-directed RNA polymerase...  45.8    2e-04  Gene info
gi|90111025|sp|Q3SSX9|RPOC_NITWN  DNA-directed RNA polymerase ...  45.8    2e-04  Gene info
gi|75496675|sp|Q57CP9|RPOC_BRUAB  DNA-directed RNA polymerase ...  45.4    2e-04
gi|68053287|sp|Q6B8R7|RPOC1_GRATL  DNA-directed RNA polymerase...  45.4    2e-04  Gene info
gi|81612623|sp|Q6ACX6|RPOC_LEIXX  DNA-directed RNA polymerase ...  45.4    2e-04
gi|109893832|sp|Q2A1M8|RPOC_FRATH  DNA-directed RNA polymerase...  45.4    2e-04
gi|81598037|sp|Q5NID1|RPOC_FRATT  DNA-directed RNA polymerase ...  45.4    2e-04
gi|90111031|sp|Q46WD5|RPOC_RALEJ  DNA-directed RNA polymerase ...  45.4    3e-04  Gene info
gi|88984780|sp|Q8HVY4|RPOC1_SOYBN  DNA-directed RNA polymerase...  45.1    3e-04  Gene info
gi|115305563|sp|Q3ZX00|RPOC_DEHSC  DNA-directed RNA polymerase...  45.1    3e-04
gi|3914827|sp|O33431|RPOC_PORCN  DNA-directed RNA polymerase b...  45.1    3e-04
gi|81561185|sp|Q5MZ22|RPOC1_SYNP6  DNA-directed RNA polymerase...  45.1    3e-04
gi|109893840|sp|Q2YB04|RPOC_NITMU  DNA-directed RNA polymerase...  45.1    3e-04
gi|93141305|sp|P42079|RPOC1_SYNP7  DNA-directed RNA polymerase...  45.1    3e-04  Gene info
gi|90111002|sp|Q46J23|RPOC1_PROMT  DNA-directed RNA polymerase...  45.1    3e-04  Gene info
gi|92090947|sp|Q6EW57|RPOC1_NYMAL  DNA-directed RNA polymerase...  45.1    4e-04
gi|41017923|sp|Q7U8K3|RPOC1_SYNPX  DNA-directed RNA polymerase...  45.1    4e-04  Gene info
gi|41017984|sp|Q83ET0|RPOC_COXBU  DNA-directed RNA polymerase ...  44.7    4e-04
gi|41018069|sp|Q8NT25|RPOC_CORGL  DNA-directed RNA polymerase ...  44.7    4e-04
gi|32699687|sp|Q9MTM4|RPOC1_OENHO  DNA-directed RNA polymerase...  44.7    4e-04  Gene info
gi|37154599|sp|P42076|RPOC1_PROMA  DNA-directed RNA polymerase...  44.7    4e-04
gi|68053263|sp|Q589B9|RPOC1_SILLA  DNA-directed RNA polymerase...  44.7    4e-04
gi|41017992|sp|Q85WS8|RPOC1_PINKO  DNA-directed RNA polymerase...  44.7    4e-04  Gene info
gi|41017928|sp|Q7V007|RPOC1_PROMP  DNA-directed RNA polymerase...  44.7    4e-04  Gene info
gi|133438|sp|P11705|RPOC1_SPIOL  DNA-directed RNA polymerase b...  44.7    4e-04  Gene info
gi|1710672|sp|P52733|RPOC1_PINTH  DNA-directed RNA polymerase ...  44.7    4e-04  Gene info
gi|90111030|sp|Q4FQH4|RPOC_PSYAR  DNA-directed RNA polymerase ...  44.7    5e-04
gi|109893843|sp|Q1Q8Q0|RPOC_PSYCK  DNA-directed RNA polymerase...  44.7    5e-04
gi|109893839|sp|Q2GD91|RPOC_NEOSM  DNA-directed RNA polymerase...  44.3    5e-04
gi|41018042|sp|Q8EK73|RPOC_SHEON  DNA-directed RNA polymerase ...  44.3    5e-04
gi|60390370|sp|Q6AP77|RPOC_DESPS  DNA-directed RNA polymerase ...  44.3    5e-04
gi|41018088|sp|Q8UE09|RPOC_AGRT5  DNA-directed RNA polymerase ...  44.3    5e-04  Gene info
gi|41018105|sp|Q92QH6|RPOC_RHIME  DNA-directed RNA polymerase ...  44.3    6e-04
gi|90110997|sp|Q49L07|RPOC1_EUCGG  DNA-directed RNA polymerase...  44.3    6e-04
gi|41017894|sp|P60287|RPOC1_AMBTC  DNA-directed RNA polymerase...  44.3    6e-04  Gene info
gi|12644278|sp|P46819|RPOC1_SINAL  DNA-directed RNA polymerase...  44.3    6e-04
gi|6685904|sp|P56763|RPOC1_ARATH  DNA-directed RNA polymerase ...  44.3    6e-04  Gene info
gi|2500623|sp|P74177|RPOC1_SYNY3  DNA-directed RNA polymerase ...  44.3    6e-04  Gene info
gi|90111000|sp|Q68S15|RPOC1_PANGI  DNA-directed RNA polymerase...  44.3    6e-04
gi|41017945|sp|Q7YJX9|RPOC1_CALFE  DNA-directed RNA polymerase...  44.3    6e-04  Gene info
gi|41017750|sp|Q8HUH0|RPC2B_CHLRE  DNA-directed RNA polymerase...  43.9    6e-04  Gene info
gi|92090946|sp|Q5QA71|RPOC1_ACOGR  DNA-directed RNA polymerase...  43.9    6e-04
gi|90110994|sp|Q3V543|RPOC1_ACOCL  DNA-directed RNA polymerase...  43.9    6e-04
gi|81612870|sp|Q6F0L8|RPOC_MESFL  DNA-directed RNA polymerase ...  43.9    6e-04
gi|81565114|sp|Q6YQW2|RPOC_ONYPE  DNA-directed RNA polymerase ...  43.9    7e-04
gi|109893828|sp|Q2SU20|RPOC_BURTA  DNA-directed RNA polymerase...  43.9    7e-04
gi|109893825|sp|Q2NJ16|RPOC_AYWBP  DNA-directed RNA polymerase...  43.9    7e-04
gi|41017991|sp|Q85FR6|RPOC_CYAME  Bifunctional DNA-directed RN...  43.9    8e-04
gi|6647772|sp|O84316|RPOC_CHLTR  DNA-directed RNA polymerase b...  43.9    8e-04
gi|68053274|sp|Q5SCX9|RPOC1_HUPLU  DNA-directed RNA polymerase...  43.9    8e-04
gi|90111001|sp|Q3BAQ1|RPOC1_PHAAO  DNA-directed RNA polymerase...  43.5    0.001
gi|41018093|sp|Q8XUZ9|RPOC_RALSO  DNA-directed RNA polymerase ...  43.5    0.001
gi|68053295|sp|Q6ENX2|RPOC1_SACOF  DNA-directed RNA polymerase...  43.5    0.001
gi|60390474|sp|Q6NJF6|RPOC_CORDI  DNA-directed RNA polymerase ...  43.5    0.001
gi|133431|sp|P16024|RPOC1_MAIZE  DNA-directed RNA polymerase b...  43.5    0.001  Gene info
gi|133435|sp|P12092|RPOC1_ORYSA  DNA-directed RNA polymerase b...  43.5    0.001
gi|15214265|sp|Q9XPS8|RPOC1_WHEAT  DNA-directed RNA polymerase...  43.1    0.001  Gene info
gi|1350854|sp|P49467|RPOC1_ODOSI  DNA-directed RNA polymerase ...  43.1    0.001  Gene info
gi|41017977|sp|Q82T76|RPOC_NITEU  DNA-directed RNA polymerase ...  43.1    0.001
gi|90110999|sp|Q33C47|RPOC1_NICTO  DNA-directed RNA polymerase...  43.1    0.001
gi|90110998|sp|Q3C1G8|RPOC1_NICSY  DNA-directed RNA polymerase...  43.1    0.001
gi|41018086|sp|Q8S8Y0|RPOC1_ATRBE  DNA-directed RNA polymerase...  43.1    0.001
gi|6094126|sp|O78484|RPOC1_GUITH  DNA-directed RNA polymerase ...  42.7    0.001  Gene info
gi|133440|sp|P12116|RPOC1_TOBAC  DNA-directed RNA polymerase b...  42.7    0.001
gi|41017926|sp|Q7URW4|RPOC_RHOBA  DNA-directed RNA polymerase ...  42.7    0.002
gi|133432|sp|P06273|RPOC1_MARPO  DNA-directed RNA polymerase b...  42.7    0.002  Gene info
gi|81604180|sp|Q62GJ7|RPOC_BURMA  DNA-directed RNA polymerase ...  42.4    0.002
gi|41017895|sp|P60288|RPOC1_PHYPA  DNA-directed RNA polymerase...  42.4    0.002
gi|41019482|sp|P19176|RPOC_PSEPU  DNA-directed RNA polymerase ...  42.4    0.002
gi|41018053|sp|Q8FS96|RPOC_COREF  DNA-directed RNA polymerase ...  42.4    0.002
gi|41018068|sp|Q8MA11|RPOC1_CHAGL  DNA-directed RNA polymerase...  42.4    0.002  Gene info
gi|41017814|sp|Q9ZK23|RPOBC_HELPJ  Bifunctional DNA-directed R...  42.0    0.002  Gene info
gi|41017590|sp|O25806|RPOBC_HELPY  Bifunctional DNA-directed R...  42.0    0.002
gi|13633856|sp|Q9PK79|RPOC_CHLMU  DNA-directed RNA polymerase ...  42.0    0.003
gi|109893856|sp|Q31IY8|RPOC_THICR  DNA-directed RNA polymerase...  41.6    0.003  Gene info
gi|90111020|sp|Q4JT33|RPOC_CORJK  DNA-directed RNA polymerase ...  41.6    0.003  Gene info
gi|90110996|sp|Q4G3A6|RPOC1_EMIHU  DNA-directed RNA polymerase...  41.6    0.003
gi|81602390|sp|Q5YPE1|RPOC_NOCFA  DNA-directed RNA polymerase ...  41.6    0.003
gi|13432232|sp|P30761|RPOC_MYCLE  DNA-directed RNA polymerase ...  41.6    0.003
gi|81607668|sp|Q63Q04|RPOC_BURPS  DNA-directed RNA polymerase ...  41.6    0.003
gi|41017912|sp|Q7N9A3|RPOC_PHOLL  DNA-directed RNA polymerase ...  41.6    0.004
gi|41018089|sp|Q8WI25|RPOC1_PSINU  DNA-directed RNA polymerase...  41.6    0.004  Gene info
gi|90111016|sp|Q39KH4|RPOC_BURS3  DNA-directed RNA polymerase ...  41.2    0.004  Gene info
gi|41017624|sp|Q7MA56|RPOBC_WOLSU  Bifunctional DNA-directed R...  41.2    0.004
gi|81646552|sp|Q6DAM9|RPOC_ERWCT  DNA-directed RNA polymerase ...  41.2    0.004
gi|61234266|sp|P0A674|RPOC_MYCTU  DNA-directed RNA polymerase ...  41.2    0.005
gi|60390510|sp|Q73SE3|RPOC_MYCPA  DNA-directed RNA polymerase ...  41.2    0.005
gi|90111004|sp|Q32RY3|RPOC1_STAPU  DNA-directed RNA polymerase...  41.2    0.005  Gene info
gi|109893836|sp|Q2W2I2|RPOC_MAGMM  DNA-directed RNA polymerase...  40.8    0.005
gi|81611189|sp|Q6A6K7|RPOC_PROAC  DNA-directed RNA polymerase ...  40.8    0.006
gi|14195188|sp|Q9PQV5|RPOC_UREPA  DNA-directed RNA polymerase ...  40.8    0.006
gi|90110995|sp|Q4VZP2|RPOC1_CUCSA  DNA-directed RNA polymerase...  40.8    0.006
gi|41017973|sp|Q822J2|RPOC_CHLCV  DNA-directed RNA polymerase ...  40.8    0.007
gi|90111003|sp|Q2VEI5|RPOC1_SOLTU  DNA-directed RNA polymerase...  40.4    0.007
gi|9789791|sp|Q9PI30|RPOC_CAMJE  DNA-directed RNA polymerase b...  40.4    0.008
gi|41018119|sp|Q98Q24|RPOC_MYCPU  DNA-directed RNA polymerase ...  40.0    0.009
gi|90111005|sp|Q32RG1|RPOC1_ZYGCR  DNA-directed RNA polymerase...  40.0    0.010  Gene info
gi|81614306|sp|Q6KI08|RPOC_MYCMO  DNA-directed RNA polymerase ...  40.0    0.010
gi|81557564|sp|Q5HVY8|RPOC_CAMJR  DNA-directed RNA polymerase ...  40.0    0.010
gi|109893845|sp|Q21SF8|RPOC_RHOFD  DNA-directed RNA polymerase...  40.0    0.011
gi|60393877|sp|Q85FM8|RPOC1_ADICA  DNA-directed RNA polymerase...  39.7    0.014
gi|109893850|sp|Q21M92|RPOC_SACD2  DNA-directed RNA polymerase...  39.7    0.014
gi|3024562|sp|P56300|RPOC1_CHLVU  DNA-directed RNA polymerase ...  39.3    0.016  Gene info
gi|109893826|sp|Q2L2L3|RPOC_BORA1  DNA-directed RNA polymerase...  39.3    0.018
gi|41018153|sp|Q9RVW0|RPOC_DEIRA  DNA-directed RNA polymerase ...  39.3    0.020
gi|109893829|sp|Q255E5|RPOC_CHLFF  DNA-directed RNA polymerase...  38.9    0.023
gi|81312571|sp|Q5L5I4|RPOC_CHLAB  DNA-directed RNA polymerase ...  38.9    0.023
gi|41017940|sp|Q7W0R8|RPOC_BORPE  DNA-directed RNA polymerase ...  38.5    0.028
gi|90111024|sp|Q4A5S8|RPOC_MYCS5  DNA-directed RNA polymerase ...  38.1    0.034  Gene info
gi|41017988|sp|Q85CL6|RPOC1_ANTFO  DNA-directed RNA polymerase...  38.1    0.034  Gene info
gi|12644501|sp|Q9Z999|RPOC_CHLPN  DNA-directed RNA polymerase ...  38.1    0.034
gi|20139788|sp|Q9KWU6|RPOC_THEAQ  DNA-directed RNA polymerase ...  37.7    0.047
gi|41018084|sp|Q8RQE8|RPOC_THET8  DNA-directed RNA polymerase ...  37.7    0.047  Gene info
gi|60390493|sp|Q72HM6|RPOC_THET2  DNA-directed RNA polymerase ...  37.7    0.047  Gene info
gi|33860206|sp|P47716|RPOC_MYCGA  DNA-directed RNA polymerase ...  37.4    0.061
gi|2500615|sp|P75271|RPOC_MYCPN  DNA-directed RNA polymerase b...  35.0    0.34 
gi|81627410|sp|Q6MDM0|RPOC_PARUW  DNA-directed RNA polymerase ...  35.0    0.35 
gi|90111007|sp|Q4G3A5|RPOC2_EMIHU  DNA-directed RNA polymerase...  34.7    0.43 
gi|1350852|sp|P47582|RPOC_MYCGE  DNA-directed RNA polymerase b...  34.7    0.44 
gi|137071|sp|P26929|URE1_LACFE  Urease alpha subunit (Urea amidoh  34.7    0.45 
gi|90111013|sp|Q3ZJ90|RPOC2_PSEAK  DNA-directed RNA polymerase...  33.5    1.0    Gene info
gi|41017664|sp|Q7VJ82|RPOBC_HELHP  Bifunctional DNA-directed R...  32.0    2.5  
gi|133442|sp|P23581|RPOC2_EUGGR  DNA-directed RNA polymerase b...  31.2    4.5    Gene info
gi|81561184|sp|Q5MZ21|RPOC2_SYNP6  DNA-directed RNA polymerase...  30.8    6.4  
gi|22654053|sp|Q8RGX3|RNC_FUSNN  Ribonuclease III (RNase III)      30.8    6.9  
gi|21363086|sp|Q9XIK4|U202A_ARATH  UPF0202 protein At1g10490       30.4    7.3  
gi|120673|sp|P26520|G3PC_PETHY  Glyceraldehyde-3-phosphate dehydr  30.0    9.9


Alignements 2 à 2

gi|73920763|sp|P11512|RPOA1_SULAC  DNA-directed RNA polymerase subunit A'
Length=880

 Score =  249 bits (637),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  LM V   +I+PR+GGPIIGG +D+I+GAYLL+   T L+ +E 
Sbjct  462  MNLHVPQSEEAIAEARELMLVHKNIITPRYGGPIIGGGQDYISGAYLLSVKTTLLTVEEV  521

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
            A +  +  F G+L +P     +  YTGKQ+ SLFLP+DFN+   +  SKG +  + ++  
Sbjct  522  ATILGVTDFVGELGEPAILAPKPYYTGKQVISLFLPKDFNFHGPANISKGPRACKDEICP  581

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV DK +IG ++PES+LH   ++YG E  K  +++   +  +F+  
Sbjct  582  HDSFIVIKNGLLLEGVFDKKAIGNQQPESMLHWSIREYGTEYGKWLMDNVFKMFIRFLEM  641

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P++ +  I    ++ Y ++ + I++  +G L+PI G T +E+LE+YI+
Sbjct  642  RGFTMTLEDITIPDEAQNEITTKIKEGYSQVDEYIRKFNEGQLEPIPGRTIEESLESYIL  701

Query  233  SNLGKLRDRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L KLR  A   A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  702  DTLDKLRKVAGEIATKYLDPFNNVYIMAITGARGSELNITQMTALLGQQSVRGERIRRGY  761

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L+ F+  +  P+A G
Sbjct  762  RERTLSLFKYGDIAPEARG  780


>gi|17368575|sp|Q980R2|RPOA1_SULSO  DNA-directed RNA polymerase subunit A'
Length=880

 Score =  233 bits (594),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 133/319 (41%), Positives = 193/319 (60%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  +M V   +I+PR+GGPIIG  +D+I+GAYLLT   T L+ +E 
Sbjct  462  MNLHVPQSEEAIAEAKEIMLVHKNIITPRYGGPIIGAAQDYISGAYLLTVKTTLLTKEEA  521

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKD---  116
              +  +      L +P        YTGKQ+ S FLP+DFN+   +  S G +  + +   
Sbjct  522  QQILGVADVKIDLGEPAILAPREYYTGKQVISAFLPKDFNFHGQANVSSGPRLCKNEDCP  581

Query  117  ----VVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                VVIKNG L+ GV DK +IG ++PES+LH + K+Y +E  K  +++   +  +FV  
Sbjct  582  HDSYVVIKNGILLEGVFDKKAIGNQQPESILHWLIKEYSDEYGKWLMDNLFRVFIRFVEL  641

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ + +  ++ I ++  +   E+ +LIQ+ K G L+PI G T +E+LE YI+
Sbjct  642  QGFTMRLEDVSLGDDVKKEIYNEIDRAKVEVDNLIQKYKNGELEPIPGRTLEESLENYIL  701

Query  233  SNLGKLRDRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L KLR  A + A+  LD  N   +MA TGARGS LN+ QMA  LGQQ+ RG R+ +GY
Sbjct  702  DTLDKLRSTAGDIASKYLDPFNFAYVMARTGARGSVLNITQMAAMLGQQSVRGERIKRGY  761

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L HF+ ++  P+A G
Sbjct  762  MTRTLPHFKPYDISPEARG  780


>gi|47117321|sp|Q9HM79|RPOA1_HALSA  DNA-directed RNA polymerase subunit A'
Length=971

 Score =  228 bits (580),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 129/314 (41%), Positives = 188/314 (59%), Gaps = 12/314 (3%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MN+H  Q+EEAR+EA +LMRVQ+Q++SPRFG  IIG ++D I+G YLLT D    +  + 
Sbjct  533  MNMHALQNEEARAEARVLMRVQEQILSPRFGENIIGAIQDHISGTYLLTNDNPRFNETQA  592

Query  61   ANLAMLGGFTGKLPDPENKKEN---LYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV  117
            ++L +      +LP      E+    +TG Q+FS  LP+D +   T     GT G    V
Sbjct  593  SDL-LRQTRIDELPAAAGTDEDGDQYWTGHQIFSELLPDDLSLEFT-----GTTGDT--V  644

Query  118  VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHYGFSY  177
            VI++GQL+ G I    +G E    ++  I K +GN +A++F+N    +  + + H+GFS 
Sbjct  645  VIEDGQLLEGTIADDEVG-EYGSEIVDTITKVHGNTRARIFINEVASLAMRSIMHFGFSI  703

Query  178  GYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMSNLGK  237
            G  D  V  + R+ I +  Q  YD + +LI+  + G L+ + G T  ETLE  IM  LGK
Sbjct  704  GIDDETVSTEARERIDEAIQSAYDRVQELIETYENGDLESLPGRTVDETLEMKIMQTLGK  763

Query  238  LRDRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGYNNRVL  297
             RD A + A  + D+DN   +MA +GARGS LN+ QMAG +GQQA RG R+N+GY +R L
Sbjct  764  ARDSAGDVAEENFDEDNPAVVMANSGARGSMLNLTQMAGCVGQQAVRGERINRGYEDRTL  823

Query  298  THFEEHENDPDAHG  311
            +HF  ++   +AHG
Sbjct  824  SHFAPNDLSSEAHG  837


>gi|6685898|sp|O27125|RPOA1_METTH Gene info DNA-directed RNA polymerase subunit A'
Length=870

 Score =  228 bits (580),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 129/319 (40%), Positives = 194/319 (60%), Gaps = 14/319 (4%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MN+HV Q+EE+R+EA  LMRVQ+ ++SPRFGGPIIGG+ D I+GAYLLT+     S ++ 
Sbjct  457  MNMHVFQTEESRAEAKTLMRVQEHILSPRFGGPIIGGIHDHISGAYLLTRKSAVFSEEKV  516

Query  61   ANLAMLGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKD----  116
              +    G    LP P+++  + +TGK++FS+ LP+D N V  ++  +  +   +     
Sbjct  517  FQILKKAG----LPLPDSRGRD-WTGKEIFSMVLPDDLNMVYRAEVCRKCEECLEMECEN  571

Query  117  ---VVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHY  173
               VVI+NGQLISGVID+ + GA   + +L  I K+YG + A+ FL+S   +    + H 
Sbjct  572  DAYVVIENGQLISGVIDEKAYGAFAGK-ILDHIVKEYGTDAAREFLDSATKLAIAGIMHA  630

Query  174  GFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMS  233
            GF+    D E+PE+ R+ I    +     +  LI+  + G L+P+ G + +ETLE  IM 
Sbjct  631  GFTTSTNDEEIPEEARERIEAHLRNAEARVDQLIEAYENGELEPLPGRSLEETLEMKIMQ  690

Query  234  NLGKLRDRAANAANLSLD-DDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
             LG+ RD++   A    D D+N   IMA TGARGS LN+ Q+   +GQQ+ RG R+++GY
Sbjct  691  VLGEARDKSGEIAESYFDMDENHAVIMALTGARGSMLNLTQITACVGQQSVRGGRISRGY  750

Query  293  NNRVLTHFEEHENDPDAHG  311
            +NR L HF++ E    + G
Sbjct  751  DNRTLPHFKKGELGAKSRG  769


>gi|1173129|sp|P41556|RPOA1_METVA  DNA-directed RNA polymerase subunit A'
Length=889

 Score =  226 bits (575),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 130/320 (40%), Positives = 188/320 (58%), Gaps = 12/320 (3%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MN+HVPQSEEAR+EA  LM V+  +ISPR+GGPIIG + DF++GAY+LT   +     E 
Sbjct  472  MNVHVPQSEEARAEAETLMLVEKHIISPRYGGPIIGAIHDFVSGAYVLTS--SNFIKDEA  529

Query  61   ANLAMLGGFTGKLPDPENKKENL--YTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKD--  116
              L    GF  +L +P+  +  +  Y+GK LFS  LP+  N    +K  K     +++  
Sbjct  530  LTLLKSSGFGSELGEPDFVENGIEYYSGKSLFSKTLPKGLNLQYKAKVCKKCVQCKREEC  589

Query  117  -----VVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVT  171
                 V+I+NG+L+ GVIDK+  GAE    VL+ I KD+G+E A+ FL+S   +  + + 
Sbjct  590  ENDAFVIIRNGRLVQGVIDKNGFGAET-GVVLNTIVKDFGSEDARTFLDSATKMSVKSMM  648

Query  172  HYGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYI  231
              GF+ G  D ++P +  Q I D   K   ++ +++++ + GTL P+ G   +E+ EAYI
Sbjct  649  LRGFTTGIDDEDIPSEAIQEIQDLLDKAESDVQEIVERYEGGTLDPLPGRGIEESREAYI  708

Query  232  MSNLGKLRDRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKG  291
            M  LGK RD     A   L  +N   +MA TGARGS LN+  MA ++GQQ+ RG R+ +G
Sbjct  709  MQILGKARDDTGKVAEKYLSKENHAALMARTGARGSLLNITMMAASVGQQSVRGGRVFRG  768

Query  292  YNNRVLTHFEEHENDPDAHG  311
            Y  R L HF E   D  +HG
Sbjct  769  YRGRTLPHFGEGSLDAKSHG  788





Blast P contr NR


Query=  Translation of ORF number 1 in reading frame 1 on the direct strand.
Length=311

Sequences producing significant alignments:                        (Bits)  Value

gi|118195268|gb|ABK78186.1|  DNA-directed RNA polymerase, beta...   440    4e-122
gi|46670|emb|CAA32925.1|  RNA polymerase subunit A (AA 1-880) [Su   234    4e-60 
gi|70606495|ref|YP_255365.1|  DNA-directed RNA polymerase subu...   234    4e-60   Gene info
gi|110605950|ref|ZP_01393996.1|  DNA-directed RNA polymerase, ...   229    1e-58 
gi|15920465|ref|NP_376134.1|  DNA-directed RNA polymerase subu...   225    2e-57   Gene info
gi|116062942|dbj|BAA80857.2|  DNA-directed RNA polymerase subunit   224    6e-57 
gi|14601674|ref|NP_148215.1|  DNA-directed RNA polymerase subunit   224    6e-57   Gene info
gi|116753354|ref|YP_842472.1|  DNA-directed RNA polymerase sub...   219    2e-55   Gene info
gi|15897171|ref|NP_341776.1|  DNA-directed RNA polymerase subu...   217    6e-55   Gene info
gi|55379095|ref|YP_136945.1|  DNA-directed RNA polymerase subu...   216    8e-55   Gene info
gi|18977935|ref|NP_579292.1|  DNA-directed RNA polymerase subu...   215    2e-54   Gene info
gi|14520831|ref|NP_126306.1|  DNA-directed RNA polymerase subu...   214    3e-54   Gene info
gi|14591328|ref|NP_143406.1|  DNA-directed RNA polymerase subu...   214    4e-54   Gene info
gi|1173129|sp|P41556|RPOA1_METVA  DNA-directed RNA polymerase ...   213    9e-54 
gi|76800712|ref|YP_325720.1|  DNA-directed RNA polymerase subu...   212    2e-53   Gene info
gi|45358926|ref|NP_988483.1|  DNA-directed RNA polymerase subu...   211    4e-53   Gene info
gi|88601371|ref|YP_501549.1|  DNA-directed RNA polymerase, sub...   210    6e-53   Gene info
gi|15679064|ref|NP_276181.1|  DNA-directed RNA polymerase subu...   210    8e-53   Gene info
gi|18312086|ref|NP_558753.1|  DNA-directed RNA polymerase subu...   209    1e-52   Gene info
gi|10582043|gb|AAG20692.1|  DNA-directed RNA polymerase subuni...   209    2e-52   Gene info
gi|16554525|ref|NP_444249.1|  DNA-directed RNA polymerase subu...   209    2e-52   Gene info
gi|57641017|ref|YP_183495.1|  DNA-directed RNA polymerase subu...   207    5e-52   Gene info
gi|43542|emb|CAA40426.1|  RNA polymerase subunit A [Halobacterium   206    1e-51 
gi|20090127|ref|NP_616202.1|  DNA-directed RNA polymerase subu...   205    2e-51   Gene info
gi|401016|sp|P31813|RPOA1_THECE  DNA-directed RNA polymerase s...   204    4e-51 
gi|110603640|ref|ZP_01391716.1|  DNA-directed RNA polymerase, ...   199    1e-49 
gi|110669268|ref|YP_659079.1|  DNA-directed RNA polymerase sub...   199    1e-49   Gene info
gi|21228373|ref|NP_634295.1|  DNA-directed RNA polymerase subu...   196    9e-49   Gene info
gi|11499472|ref|NP_070713.1|  DNA-directed RNA polymerase subu...   196    1e-48   Gene info
gi|73671120|ref|YP_307135.1|  DNA-directed RNA polymerase subu...   196    2e-48   Gene info
gi|69269081|ref|ZP_00609644.1|  DNA-directed RNA polymerase [F...   193    7e-48 
gi|91773158|ref|YP_565850.1|  DNA-directed RNA polymerase, sub...   192    2e-47   Gene info
gi|2127864|pir||A64430  DNA-directed RNA polymerase (EC 2.7.7....   191    4e-47 
gi|15669231|ref|NP_248036.1|  DNA-directed RNA polymerase subu...   191    4e-47   Gene info
gi|110620046|emb|CAJ35324.1|  DNA-directed RNA polymerase, sub...   190    9e-47 
gi|48477330|ref|YP_023036.1|  DNA-directed RNA polymerase subu...   189    1e-46   Gene info
gi|16081520|ref|NP_393871.1|  DNA-directed RNA polymerase subu...   189    1e-46   Gene info
gi|13542012|ref|NP_111700.1|  DNA-directed RNA polymerase subu...   189    2e-46   Gene info
gi|84490160|ref|YP_448392.1|  RpoA1 [Methanosphaera stadtmanae...   187    6e-46   Gene info
gi|15678327|ref|NP_275442.1|  DNA-directed RNA polymerase subu...   172    1e-41   Gene info
gi|50293727|ref|XP_449275.1|  unnamed protein product [Candida...   171    5e-41   Gene info
gi|19112298|ref|NP_595506.1|  DNA-directed RNA polymerase III ...   170    9e-41   Gene info
gi|6624245|dbj|BAA88487.1|  RNA polymerase III largest subunit [L   169    2e-40 
gi|133402|sp|P09846|RPOA1_METTW  DNA-directed RNA polymerase s...   169    2e-40 
gi|50549343|ref|XP_502142.1|  hypothetical protein [Yarrowia l...   168    3e-40   Gene info
gi|6324690|ref|NP_014759.1|  RNA polymerase III subunit C160, ...   168    3e-40   Gene info
gi|83773653|dbj|BAE63780.1|  unnamed protein product [Aspergillus   167    4e-40 
gi|85080606|ref|XP_956571.1|  hypothetical protein [Neurospora...   167    6e-40   Gene info
gi|115390328|ref|XP_001212669.1|  DNA-directed RNA polymerase ...   167    6e-40   Gene info
gi|76656730|ref|XP_593081.2|  PREDICTED: similar to polymerase...   166    1e-39   Gene info
gi|76656742|ref|XP_886259.1|  PREDICTED: similar to polymerase...   166    1e-39   Gene info
gi|67524109|ref|XP_660116.1|  hypothetical protein AN2512.2 [A...   166    1e-39   Gene info
gi|114631405|ref|XP_507865.2|  PREDICTED: polymerase (RNA) III...   166    1e-39   Gene info
gi|73953679|ref|XP_536399.2|  PREDICTED: similar to polymerase...   166    1e-39   UniGene infoGene info
gi|39725938|ref|NP_008986.2|  polymerase (RNA) III (DNA direct...   166    2e-39   UniGene infoGene info
gi|76656732|ref|XP_873057.1|  PREDICTED: similar to polymerase...   166    2e-39   Gene info
gi|3122765|sp|O14802|RPC1_HUMAN  DNA-directed RNA polymerase I...   166    2e-39   Gene info
gi|58268624|ref|XP_571468.1|  DNA-directed RNA polymerase iii ...   166    2e-39   Gene info
gi|50257395|gb|EAL20104.1|  hypothetical protein CNBF4300 [Cry...   166    2e-39 
gi|116497686|gb|EAU80581.1|  hypothetical protein CC1G_11381 [...   165    2e-39 
gi|45190855|ref|NP_985109.1|  AER252Cp [Eremothecium gossypii]...   164    4e-39   Gene info
gi|50309797|ref|XP_454912.1|  unnamed protein product [Kluyver...   164    4e-39   Gene info
gi|82953490|ref|XP_487324.2|  PREDICTED: polymerase (RNA) III ...   164    4e-39   UniGene infoGene info
gi|109503668|ref|XP_001056048.1|  PREDICTED: similar to polyme...   164    5e-39   Gene info
gi|109502980|ref|XP_341389.3|  PREDICTED: similar to polymeras...   164    5e-39   Gene info
gi|46136689|ref|XP_390036.1|  hypothetical protein FG09860.1 [...   164    6e-39   Gene info
gi|90304981|gb|EAS34612.1|  hypothetical protein CIMG_05636 [Cocc   164    7e-39 
gi|50426995|ref|XP_462102.1|  hypothetical protein DEHA0G13849...   163    1e-38   Gene info
gi|3172136|gb|AAC18417.1|  RNA polymerase II largest subunit [Aca   163    1e-38 
gi|57529842|ref|NP_001006500.1|  polymerase (RNA) III (DNA dir...   162    2e-38   UniGene infoGene info
gi|39593525|emb|CAE61817.1|  Hypothetical protein CBG05787 [Caeno   162    2e-38 
gi|76656740|ref|XP_886242.1|  PREDICTED: similar to polymerase...   161    3e-38   Gene info
gi|68481275|ref|XP_715412.1|  RNA polymerase III large subunit...   161    4e-38   Gene info
gi|68481134|ref|XP_715482.1|  RNA polymerase III large subunit...   161    4e-38   Gene info
gi|110669635|gb|ABG81912.1|  RNA polymerase II largest subunit [P   160    9e-38 
gi|33326219|gb|AAQ08519.1|  RNA polymerase II largest subunit [Ps   159    2e-37 
gi|71024147|ref|XP_762303.1|  hypothetical protein UM06156.1 [...   158    2e-37   Gene info
gi|47216067|emb|CAG04806.1|  unnamed protein product [Tetraodon n   158    3e-37 
gi|6624243|dbj|BAA88486.1|  RNA polymerase III largest subunit [E   158    3e-37 
gi|25145495|ref|NP_501127.2|  RNA Polymerase, Class III (C) fa...   158    4e-37   UniGene infoGene info
gi|70998935|ref|XP_754189.1|  DNA-directed RNA polymerase III ...   158    4e-37   Gene info
gi|116201487|ref|XP_001226555.1|  hypothetical protein CHGG_08...   157    6e-37   Gene info
gi|115462141|ref|NP_001054670.1|  Os05g0151000 [Oryza sativa (...   157    7e-37   Gene info
gi|19112465|ref|NP_595673.1|  DNA-directed RNA polymerase II l...   157    9e-37   Gene info
gi|58267574|ref|XP_570943.1|  DNA-directed RNA polymerase ii l...   156    1e-36   Gene info
gi|83320420|gb|ABC02837.1|  RNA polymerase II largest subunit [Ro   156    1e-36 
gi|54291834|gb|AAV32202.1|  putative RNA polymerase II [Oryza ...   156    2e-36   Gene info
gi|29539342|dbj|BAC67672.1|  DNA-directed RNA polymerase II la...   155    2e-36 
gi|110669650|gb|ABG81919.1|  RNA polymerase II largest subunit [L   155    2e-36 
gi|110669633|gb|ABG81911.1|  RNA polymerase II largest subunit [M   155    2e-36 
gi|45935331|gb|AAS79687.1|  RNA polymerase II large subunit [Gink   155    2e-36 
gi|83320450|gb|ABC02852.1|  RNA polymerase II largest subunit [Rh   155    3e-36 
gi|67517057|ref|XP_658413.1|  hypothetical protein AN0809.2 [A...   155    3e-36   Gene info
gi|38603409|dbj|BAD02850.1|  DNA-dependent RNA polymerase II l...   154    4e-36 
gi|33326207|gb|AAQ08513.1|  RNA polymerase II largest subunit [Pi   154    4e-36 
gi|91092426|ref|XP_968165.1|  PREDICTED: similar to polymerase...   154    5e-36   Gene info
gi|33326213|gb|AAQ08516.1|  RNA polymerase II largest subunit [Ma   154    5e-36 
gi|33326217|gb|AAQ08518.1|  RNA polymerase II largest subunit [Am   154    5e-36 
gi|83320474|gb|ABC02864.1|  RNA polymerase II largest subunit [Ol   154    6e-36 
gi|83320414|gb|ABC02834.1|  RNA polymerase II largest subunit [Co   153    8e-36 
gi|111070026|gb|EAT91146.1|  hypothetical protein SNOG_01497 [Pha   153    9e-36 
gi|83320446|gb|ABC02850.1|  RNA polymerase II largest subunit [Mo   153    1e-35 
gi|45935329|gb|AAS79686.1|  RNA polymerase II large subunit [Podo   153    1e-35 
gi|45935325|gb|AAS79684.1|  RNA polymerase II large subunit [Thuj   153    1e-35 
gi|41615286|ref|NP_963784.1|  DNA-directed RNA polymerase subu...   153    1e-35   Gene info
gi|33326211|gb|AAQ08515.1|  RNA polymerase II largest subunit [Ze   153    1e-35   UniGene infoGene info
gi|83320418|gb|ABC02836.1|  RNA polymerase II largest subunit ...   153    1e-35 
gi|68300797|gb|AAY89341.1|  RNA polymerase II largest subunit [Rh   153    1e-35 
gi|28564490|dbj|BAC57602.1|  DNA-dependent RNA polymerase II l...   153    1e-35 
gi|9955855|dbj|BAB12227.1|  RNA polymerase II largest subunit ...   153    1e-35 
gi|110669641|gb|ABG81915.1|  RNA polymerase II largest subunit [U   152    2e-35 
gi|83320428|gb|ABC02841.1|  RNA polymerase II largest subunit [Sp   152    2e-35 
gi|12642612|gb|AAK00310.1|AF315820_1  DNA-dependent RNA polyme...   152    3e-35 
gi|45935327|gb|AAS79685.1|  RNA polymerase II large subunit [Taxu   151    3e-35 
gi|1143740|gb|AAB50025.1|  RNA polymerase II [Trichomonas vaginal   151    3e-35 
gi|70996164|ref|XP_752837.1|  DNA-dependent RNA polymerase II ...   151    3e-35   Gene info
gi|16494|emb|CAA36735.1|  DNA-directed RNA polymerase [Arabidopsi   151    3e-35 
gi|15233338|ref|NP_195305.1|  NRPB1 (RNA POLYMERASE II LARGE S...   151    4e-35   UniGene infoGene info
gi|16505|emb|CAA37130.1|  RNA polymerase II [Arabidopsis thaliana   151    4e-35 
gi|77176711|gb|ABA64470.1|  DNA-dependent RNA polymerase II la...   151    5e-35 
gi|83320416|gb|ABC02835.1|  RNA polymerase II largest subunit [Ph   151    5e-35 
gi|12642616|gb|AAK00312.1|AF315822_1  DNA-dependent RNA polyme...   150    6e-35 
gi|39944990|ref|XP_362032.1|  hypothetical protein MG04477.4 [Mag   150    6e-35   Gene info
gi|110669645|gb|ABG81917.1|  RNA polymerase II largest subunit [H   150    6e-35 
gi|33326203|gb|AAQ08511.1|  RNA polymerase II largest subunit [Za   150    6e-35 
gi|110669620|gb|ABG81905.1|  RNA polymerase II largest subunit [P   150    6e-35 
gi|33326209|gb|AAQ08514.1|  RNA polymerase II largest subunit [We   150    6e-35 
gi|110669631|gb|ABG81910.1|  RNA polymerase II largest subunit [P   150    7e-35 
gi|38603401|dbj|BAD02846.1|  DNA-dependent RNA polymerase II l...   150    8e-35 
gi|110669639|gb|ABG81914.1|  RNA polymerase II largest subunit [B   150    8e-35 
gi|83320442|gb|ABC02848.1|  RNA polymerase II largest subunit [Sm   150    8e-35 
gi|83320432|gb|ABC02843.1|  RNA polymerase II largest subunit [Di   150    8e-35 
gi|33326205|gb|AAQ08512.1|  RNA polymerase II largest subunit [Cy   150    1e-34 
gi|83320436|gb|ABC02845.1|  RNA polymerase II largest subunit [En   150    1e-34 
gi|83320468|gb|ABC02861.1|  RNA polymerase II largest subunit [Or   149    1e-34 
gi|66815437|ref|XP_641735.1|  RNA polymerase II largest subuni...   149    1e-34   Gene info
gi|83320472|gb|ABC02863.1|  RNA polymerase II largest subunit [Mo   149    1e-34 
gi|90302589|gb|EAS32220.1|  hypothetical protein CIMG_03244 [Cocc   149    2e-34 
gi|110669627|gb|ABG81908.1|  RNA polymerase II largest subunit...   149    2e-34 
gi|67476290|ref|XP_653748.1|  DNA-directed RNA polymerase III ...   149    2e-34   Gene info
gi|83320424|gb|ABC02839.1|  RNA polymerase II largest subunit [Po   149    2e-34 
gi|28564502|dbj|BAC57608.1|  DNA-dependent RNA polymerase II l...   149    2e-34 
gi|111278799|gb|ABH09097.1|  RNA polymerase II largest subunit [R   149    2e-34 
gi|28564510|dbj|BAC57612.1|  DNA-dependent RNA polymerase II l...   149    2e-34 
gi|28564508|dbj|BAC57611.1|  DNA-dependent RNA polymerase II l...   149    2e-34 
gi|33326215|gb|AAQ08517.1|  RNA polymerase II largest subunit [Ny   148    3e-34 
gi|110669656|gb|ABG81922.1|  RNA polymerase II largest subunit [A   148    4e-34 
gi|78190749|gb|ABB29696.1|  DNA-directed RNA polymerase II lar...   147    5e-34 
gi|3063677|gb|AAC14137.1|  RNA polymerase II largest subunit [Dic   147    6e-34 
gi|38603397|dbj|BAD02844.1|  DNA-dependent RNA polymerase II l...   147    6e-34 
gi|45935333|gb|AAS79688.1|  RNA polymerase II large subunit [Ephe   147    6e-34 
gi|28564496|dbj|BAC57605.1|  DNA-dependent RNA polymerase II l...   147    6e-34 
gi|110669652|gb|ABG81920.1|  RNA polymerase II largest subunit [P   147    7e-34 
gi|115492277|ref|XP_001210766.1|  DNA-directed RNA polymerase ...   147    7e-34   Gene info
gi|83320448|gb|ABC02851.1|  RNA polymerase II largest subunit [Rh   147    9e-34 
gi|111278801|gb|ABH09098.1|  RNA polymerase II largest subunit [P   147    9e-34 
gi|83320426|gb|ABC02840.1|  RNA polymerase II largest subunit [Hy   147    9e-34 
gi|115459150|ref|NP_001053175.1|  Os04g0492300 [Oryza sativa (...   146    1e-33   Gene info
gi|8777343|dbj|BAA96933.1|  DNA-directed RNA polymerase II lar...   146    1e-33 
gi|83320466|gb|ABC02860.1|  RNA polymerase II largest subunit [Sy   146    2e-33 
gi|38603399|dbj|BAD02845.1|  DNA-dependent RNA polymerase II l...   146    2e-33 
gi|68300816|gb|AAY89349.1|  RNA polymerase II largest subunit [An   146    2e-33 
gi|110669637|gb|ABG81913.1|  RNA polymerase II largest subunit [L   145    2e-33 
gi|116060036|emb|CAL56095.1|  unnamed protein product [Ostreococc   145    2e-33 
gi|28564498|dbj|BAC57606.1|  DNA-dependent RNA polymerase II l...   145    2e-33 
gi|110669612|gb|ABG81901.1|  RNA polymerase II largest subunit [C   145    3e-33 
gi|83320438|gb|ABC02846.1|  RNA polymerase II largest subunit [Co   145    3e-33 
gi|110669629|gb|ABG81909.1|  RNA polymerase II largest subunit [R   144    4e-33 
gi|38603403|dbj|BAD02847.1|  DNA-dependent RNA polymerase II l...   144    5e-33 
gi|83320452|gb|ABC02853.1|  RNA polymerase II largest subunit [Um   144    5e-33 
gi|21280521|gb|AAM45153.1|AF395835_1  RNA polymerase II largest s   144    7e-33 
gi|111278791|gb|ABH09093.1|  RNA polymerase II largest subunit [S   144    7e-33 
gi|31127048|gb|AAC03137.3|  RNA polymerase II largest subunit [Ma   144    7e-33 
gi|111154414|gb|ABH07421.1|  RNA polymerase II largest subunit [P   144    7e-33 
gi|45935355|gb|AAS79699.1|  RNA polymerase III large subunit [Nym   143    1e-32 
gi|57792099|gb|AAW56766.1|  RNA polymerase II largest subunit [St   143    1e-32 
gi|83320456|gb|ABC02855.1|  RNA polymerase II largest subunit [Rh   143    1e-32 
gi|83320434|gb|ABC02844.1|  RNA polymerase II largest subunit [Ba   143    1e-32 
gi|45935345|gb|AAS79694.1|  RNA polymerase III large subunit [Pin   143    1e-32 
gi|83320478|gb|ABC02866.1|  RNA polymerase II largest subunit [Ne   143    1e-32 
gi|4092885|gb|AAD12605.1|  RNA polymerase II largest subunit [Nos   142    2e-32 
gi|1945435|gb|AAC49712.1|  RNA polymerase II largest subunit [Spi   142    2e-32 
gi|116874718|emb|CAJ75797.1|  RNA polymerase I subunit B [Geosiph   142    2e-32 
gi|3511287|gb|AAC62246.1|  DNA-dependent RNA polymerase II lar...   142    2e-32 
gi|58395824|gb|AAW72740.1|  RNA polymerase II largest subunit [Ga   142    2e-32 
gi|111278795|gb|ABH09095.1|  RNA polymerase II largest subunit [E   142    2e-32 
gi|83320454|gb|ABC02854.1|  RNA polymerase II largest subunit [Sp   142    2e-32 
gi|83320412|gb|ABC02833.1|  RNA polymerase II largest subunit [Al   142    2e-32 
gi|38603407|dbj|BAD02849.1|  DNA-dependent RNA polymerase II l...   142    2e-32 
gi|68300819|gb|AAY89350.1|  RNA polymerase II largest subunit [Ly   142    2e-32   Gene info
gi|110669618|gb|ABG81904.1|  RNA polymerase II largest subunit [S   142    3e-32 
gi|83320444|gb|ABC02849.1|  RNA polymerase II largest subunit [Co   142    3e-32 
gi|116510352|gb|EAU93247.1|  hypothetical protein CC1G_11229 [...   142    3e-32 
gi|83320476|gb|ABC02865.1|  RNA polymerase II largest subunit [Pi   141    3e-32 
gi|38603393|dbj|BAD02842.1|  DNA-dependent RNA polymerase II l...   141    4e-32 
gi|21280517|gb|AAM45151.1|AF395110_1  RNA polymerase II largest s   141    4e-32 
gi|28564506|dbj|BAC57610.1|  DNA-dependent RNA polymerase II l...   141    5e-32 
gi|28564492|dbj|BAC57603.1|  DNA-dependent RNA polymerase II l...   140    5e-32 
gi|111278789|gb|ABH09092.1|  RNA polymerase II largest subunit [E   140    6e-32 
gi|83320458|gb|ABC02856.1|  RNA polymerase II largest subunit [En   140    6e-32 
gi|83320470|gb|ABC02862.1|  RNA polymerase II largest subunit [Ph   140    7e-32 
gi|110669614|gb|ABG81902.1|  RNA polymerase II largest subunit [C   140    8e-32 
gi|38603395|dbj|BAD02843.1|  DNA-dependent RNA polymerase II l...   140    8e-32 
gi|28564512|dbj|BAC57613.1|  DNA-dependent RNA polymerase II l...   140    1e-31 
gi|28564504|dbj|BAC57609.1|  DNA-dependent RNA polymerase II larg   140    1e-31 
gi|83320430|gb|ABC02842.1|  RNA polymerase II largest subunit [Cl   140    1e-31 
gi|28564500|dbj|BAC57607.1|  DNA-dependent RNA polymerase II l...   140    1e-31 
gi|58395941|gb|AAW72761.1|  RNA polymerase II largest subunit [St   139    1e-31 
gi|38603391|dbj|BAD02841.1|  DNA-dependent RNA polymerase II l...   139    1e-31 
gi|38232433|gb|AAR15052.1|  RNA polymerase II largest subunit [Pe   139    1e-31 
gi|78190641|gb|ABB29642.1|  DNA-directed RNA polymerase II lar...   139    2e-31 
gi|110669643|gb|ABG81916.1|  RNA polymerase II largest subunit [A   139    2e-31 
gi|46108068|ref|XP_381092.1|  hypothetical protein FG00916.1 [...   139    2e-31   Gene info
gi|83320464|gb|ABC02859.1|  RNA polymerase II largest subunit [Sc   139    2e-31 
gi|45439293|gb|AAS64314.1|  DNA-dependent RNA polymerase II la...   138    3e-31 
gi|57472114|gb|AAW51135.1|  RNA polymerase II largest subunit [Ca   138    3e-31 
gi|58395849|gb|AAW72745.1|  RNA polymerase II largest subunit [Fo   138    3e-31 
gi|31127046|gb|AAC03136.3|  RNA polymerase II largest subunit [Li   138    3e-31 
gi|91095991|gb|AAW56763.2|  RNA polymerase II largest subunit [Hy   138    3e-31 
gi|31127024|gb|AAF26639.2|AF138989_1  RNA polymerase II largest s   138    4e-31 
gi|85111774|ref|XP_964097.1|  hypothetical protein [Neurospora...   138    4e-31   Gene info
gi|66818062|ref|XP_642724.1|  RNA polymerase III, largest subu...   138    4e-31   Gene info
gi|28564494|dbj|BAC57604.1|  DNA-dependent RNA polymerase II l...   138    4e-31 
gi|45935349|gb|AAS79696.1|  RNA polymerase III large subunit [Zam   137    5e-31 
gi|45935343|gb|AAS79693.1|  RNA polymerase III large subunit [Pod   137    5e-31 
gi|109113294|ref|XP_001118060.1|  PREDICTED: similar to DNA-di...   137    5e-31   Gene info
gi|73955449|ref|XP_858007.1|  PREDICTED: similar to polymerase...   137    5e-31   UniGene infoGene info
gi|73955465|ref|XP_858332.1|  PREDICTED: similar to polymerase...   137    5e-31   UniGene infoGene info
gi|73955477|ref|XP_858553.1|  PREDICTED: similar to DNA-direct...   137    5e-31   UniGene infoGene info
gi|73955447|ref|XP_857964.1|  PREDICTED: similar to DNA-direct...   137    5e-31   UniGene infoGene info
gi|45187959|ref|NP_984182.1|  ADR086Cp [Eremothecium gossypii]...   137    6e-31   Gene info
gi|73955451|ref|XP_858048.1|  PREDICTED: similar to polymerase...   137    6e-31   UniGene infoGene info
gi|73955463|ref|XP_858293.1|  PREDICTED: similar to polymerase...   137    6e-31   UniGene infoGene info
gi|73955467|ref|XP_858373.1|  PREDICTED: similar to DNA-direct...   137    6e-31   UniGene infoGene info
gi|73955471|ref|XP_858451.1|  PREDICTED: similar to polymerase...   137    6e-31   UniGene infoGene info
gi|73955475|ref|XP_858521.1|  PREDICTED: similar to DNA-direct...   137    6e-31   UniGene infoGene info
gi|76635634|ref|XP_881148.1|  PREDICTED: similar to polymerase...   137    7e-31   Gene info
gi|31127036|gb|AAF26656.2|AF139006_1  RNA polymerase II largest s   137    7e-31 
gi|73955479|ref|XP_858599.1|  PREDICTED: similar to DNA-direct...   137    7e-31   UniGene infoGene info
gi|73955453|ref|XP_536621.2|  PREDICTED: similar to DNA-direct...   137    8e-31   UniGene infoGene info
gi|73955481|ref|XP_858642.1|  PREDICTED: similar to DNA-direct...   137    8e-31   UniGene infoGene info
gi|73955441|ref|XP_857844.1|  PREDICTED: similar to DNA-direct...   137    8e-31   UniGene infoGene info
gi|73955459|ref|XP_858210.1|  PREDICTED: similar to DNA-direct...   137    8e-31   UniGene infoGene info
gi|83320422|gb|ABC02838.1|  RNA polymerase II largest subunit ...   137    8e-31 
gi|2145091|gb|AAB58418.1|  RNA polymerase II largest subunit        137    8e-31   UniGene infoGene info
gi|76635638|ref|XP_881274.1|  PREDICTED: similar to DNA-direct...   137    8e-31   Gene info
gi|76635636|ref|XP_881215.1|  PREDICTED: similar to polymerase...   137    8e-31   Gene info
gi|76635632|ref|XP_596010.2|  PREDICTED: similar to DNA-direct...   137    8e-31   Gene info
gi|114666505|ref|XP_511300.2|  PREDICTED: similar to DNA-direc...   137    8e-31   Gene info
gi|133327|sp|P08775|RPB1_MOUSE  DNA-directed RNA polymerase II...   137    8e-31   Gene info
gi|109488292|ref|XP_343923.3|  PREDICTED: similar to DNA-direc...   137    9e-31   Gene info
gi|73955469|ref|XP_858411.1|  PREDICTED: similar to polymerase...   137    9e-31   UniGene infoGene info
gi|38603405|dbj|BAD02848.1|  DNA-dependent RNA polymerase II l...   137    9e-31 
gi|73955461|ref|XP_858255.1|  PREDICTED: similar to DNA-direct...   137    9e-31   UniGene infoGene info
gi|73955483|ref|XP_858680.1|  PREDICTED: similar to DNA-direct...   137    9e-31   UniGene infoGene info
gi|73955439|ref|XP_849064.1|  PREDICTED: similar to DNA-direct...   137    9e-31   UniGene infoGene info
gi|73955473|ref|XP_858484.1|  PREDICTED: similar to polymerase...   137    9e-31   UniGene infoGene info
gi|2443334|dbj|BAA22376.1|  RNA polymerase II largest subunit [Cr   137    9e-31 
gi|4505939|ref|NP_000928.1|  DNA directed RNA polymerase II po...   137    9e-31   UniGene infoGene info
gi|45935353|gb|AAS79698.1|  RNA polymerase III large subunit [Psi   137    1e-30 
gi|825713|emb|CAA52862.1|  RNA polymerase II largest subunit [Hom   136    1e-30   Gene info
gi|110669625|gb|ABG81907.1|  RNA polymerase II largest subunit [E   136    1e-30 
gi|6677795|ref|NP_033115.1|  polymerase (RNA) II (DNA directed...   136    1e-30   UniGene infoGene info
gi|12642614|gb|AAK00311.1|AF315821_1  DNA-dependent RNA polyme...   136    1e-30 
gi|45935351|gb|AAS79697.1|  RNA polymerase III large subunit [Gin   136    1e-30 
gi|6624241|dbj|BAA88485.1|  RNA polymerase II largest subunit [Le   136    1e-30 
gi|73955445|ref|XP_857921.1|  PREDICTED: similar to polymerase...   136    1e-30   UniGene infoGene info
gi|73955443|ref|XP_857882.1|  PREDICTED: similar to DNA-direct...   136    1e-30   UniGene infoGene info
gi|77176709|gb|ABA64469.1|  DNA-dependent RNA polymerase II la...   136    1e-30 
gi|83320462|gb|ABC02858.1|  RNA polymerase II largest subunit [Gl   136    1e-30 
gi|31127034|gb|AAF26651.2|AF139001_1  RNA polymerase II largest s   136    1e-30 
gi|45935341|gb|AAS79692.1|  RNA polymerase III large subunit [Tax   136    2e-30 
gi|3172134|gb|AAC18416.1|  RNA polymerase II largest subunit [Bon   136    2e-30 
gi|83320460|gb|ABC02857.1|  RNA polymerase II largest subunit [Pa   136    2e-30 
gi|111278793|gb|ABH09094.1|  RNA polymerase II largest subunit [C   135    2e-30 
gi|45935347|gb|AAS79695.1|  RNA polymerase III large subunit [Cyc   135    2e-30 
gi|116182152|ref|XP_001220925.1|  DNA-directed RNA polymerase ...   135    2e-30   Gene info
gi|45935335|gb|AAS79689.1|  RNA polymerase III large subunit [Wel   135    2e-30 
gi|162223|gb|AAA30233.1|  RNA polymerase III                        135    2e-30 
gi|133355|sp|P08968|RPC1_TRYBB  DNA-directed RNA polymerase II...   135    2e-30 
gi|57634552|gb|AAW52570.1|  RNA polymerase II largest subunit [Ma   135    3e-30 
gi|71746952|ref|XP_822531.1|  DNA-directed RNA polymerase III ...   135    3e-30   Gene info
gi|68129200|emb|CAJ07737.1|  DNA-directed RNA polymerase III l...   135    3e-30 
gi|47214041|emb|CAG00699.1|  unnamed protein product [Tetraodon n   135    3e-30 
gi|12642610|gb|AAK00309.1|AF315819_1  DNA-dependent RNA polyme...   135    3e-30 
gi|68370170|ref|XP_709733.1|  PREDICTED: similar to DNA-direct...   134    4e-30   Gene info
gi|68370124|ref|XP_708380.1|  PREDICTED: similar to DNA-direct...   134    4e-30   Gene info
gi|68370114|ref|XP_708375.1|  PREDICTED: similar to DNA-direct...   134    4e-30   Gene info
gi|68370116|ref|XP_708376.1|  PREDICTED: similar to DNA-direct...   134    5e-30   Gene info
gi|68370112|ref|XP_708374.1|  PREDICTED: similar to DNA-direct...   134    5e-30   Gene info
gi|4808166|emb|CAB42797.1|  largest subunit of the RNA polymer...   134    5e-30 
gi|68370164|ref|XP_709731.1|  PREDICTED: similar to DNA-direct...   134    5e-30   Gene info
gi|31127003|gb|AAF26621.2|AF138971_1  RNA polymerase II largest s   134    5e-30 
gi|68370120|ref|XP_708378.1|  PREDICTED: similar to DNA-direct...   134    5e-30   Gene info
gi|68370126|ref|XP_708381.1|  PREDICTED: similar to DNA-direct...   134    5e-30   Gene info
gi|68370122|ref|XP_708379.1|  PREDICTED: similar to DNA-direct...   134    5e-30   Gene info
gi|4808164|emb|CAB42795.1|  largest subunit of the RNA polymer...   134    5e-30 
gi|111060144|gb|EAT81264.1|  hypothetical protein SNOG_11556 [Pha   134    6e-30 
gi|73955457|ref|XP_858173.1|  PREDICTED: similar to polymerase...   134    6e-30   UniGene infoGene info
gi|73955455|ref|XP_858132.1|  PREDICTED: similar to polymerase...   134    6e-30   UniGene infoGene info
gi|68370118|ref|XP_708377.1|  PREDICTED: similar to DNA-direct...   134    6e-30   Gene info
gi|17530899|ref|NP_511124.1|  RNA polymerase II 215kD subunit ...   134    6e-30   UniGene infoGene info
gi|19528357|gb|AAL90293.1|  LD43558p [Drosophila melanogaster]      134    6e-30   UniGene info
gi|4808162|emb|CAB42796.1|  largest subunit of the RNA polymer...   134    6e-30 
gi|9587179|gb|AAF89193.1|AF272643_1  RNA polymerase II largest...   134    6e-30 
gi|54643878|gb|EAL32621.1|  GA13798-PA [Drosophila pseudoobscura]   134    6e-30 
gi|158332|gb|AAA28868.1|  RNA polymerase II                         134    6e-30 
gi|68370138|ref|XP_708387.1|  PREDICTED: similar to DNA-direct...   134    6e-30   Gene info
gi|68370168|ref|XP_709729.1|  PREDICTED: similar to DNA-direct...   134    7e-30   Gene info
gi|68370132|ref|XP_708384.1|  PREDICTED: similar to DNA-direct...   134    7e-30   Gene info
gi|68370110|ref|XP_686374.1|  PREDICTED: similar to DNA-direct...   134    7e-30   Gene info
gi|68370128|ref|XP_708382.1|  PREDICTED: similar to DNA-direct...   134    7e-30   Gene info
gi|68370136|ref|XP_708386.1|  PREDICTED: similar to RNA polyme...   134    7e-30   Gene info
gi|68370130|ref|XP_708383.1|  PREDICTED: similar to DNA-direct...   134    7e-30   Gene info
gi|68370134|ref|XP_708385.1|  PREDICTED: similar to DNA-direct...   134    7e-30   Gene info
gi|45935339|gb|AAS79691.1|  RNA polymerase III large subunit [Thu   134    8e-30 
gi|133329|sp|P17545|RPB1_TRYBB  DNA-directed RNA polymerase II...   133    9e-30 
gi|133332|sp|P17546|RPB2_TRYBB  DNA-directed RNA polymerase II...   133    9e-30 
gi|162221|gb|AAA30232.1|  RNA polymerase IIB largest subunit        133    1e-29 
gi|162215|gb|AAA30229.1|  RNA polymerase IIA largest subunit        133    1e-29 
gi|71753629|ref|XP_826454.1|  RNA polymerase IIA largest subun...   133    1e-29   Gene info
gi|71849732|ref|XP_822161.1|  RNA polymerase IIA largest subun...   133    1e-29   Gene info
gi|50310581|ref|XP_455310.1|  unnamed protein product [Kluyver...   133    1e-29   Gene info
gi|22002086|gb|AAK97604.2|AF372503_1  RNA polymerase II largest s   132    2e-29 
gi|23345055|gb|AAN17722.1|  RNA polymerase II largest subunit [Tr   132    2e-29 
gi|71423780|ref|XP_812569.1|  RNA polymerase IIA largest subun...   132    2e-29   Gene info
gi|60393735|sp|P35074|RPB1_CAEBR  DNA-directed RNA polymerase ...   132    2e-29 
gi|116061779|emb|CAL52497.1|  unnamed protein product [Ostreococc   132    2e-29 
gi|13274170|emb|CAC33866.1|  RNA polymerase II largest subunit [S   132    2e-29 
gi|31127032|gb|AAF26647.2|AF138997_1  RNA polymerase II largest s   132    2e-29 
gi|50557434|ref|XP_501909.1|  hypothetical protein [Yarrowia l...   132    2e-29   Gene info
gi|31127052|gb|AAC03140.2|  RNA polymerase II largest subunit [Pe   132    2e-29 
gi|520517|gb|AAA50229.1|  RNA polymerase II, largest subunit        132    2e-29 
gi|45935337|gb|AAS79690.1|  RNA polymerase III large subunit [Eph   132    3e-29 
gi|68473217|ref|XP_719414.1|  RNA polymerase II large subunit ...   132    3e-29   Gene info
gi|91085731|ref|XP_973470.1|  PREDICTED: similar to DNA-direct...   132    3e-29   UniGene infoGene info
gi|116123421|gb|EAA12308.3|  ENSANGP00000010305 [Anopheles gambia   131    3e-29 
gi|58390394|ref|XP_317690.2|  ENSANGP00000010305 [Anopheles gambi   131    3e-29   Gene info
gi|38232371|gb|AAR15021.1|  RNA polymerase II largest subunit [Sc   131    3e-29 
gi|3169691|gb|AAC17924.1|  RNA polymerase II largest subunit [Por   131    4e-29 
gi|67597591|ref|XP_666157.1|  DNA-directed RNA polymerase (EC ...   131    4e-29   Gene info
gi|66359288|ref|XP_626822.1|  putative DNA-directed RNA polyme...   131    4e-29   Gene info
gi|48249473|gb|AAT40981.1|  RNA polymerase II largest subunit [En   131    4e-29 
gi|57634548|gb|AAW52568.1|  RNA polymerase II largest subunit [Ly   131    5e-29 
gi|67471738|ref|XP_651781.1|  DNA-directed RNA polymerase II l...   131    5e-29   Gene info
gi|83320440|gb|ABC02847.1|  RNA polymerase II largest subunit [Gl   131    5e-29 
gi|12642618|gb|AAK00313.1|AF315823_1  DNA-dependent RNA polyme...   131    5e-29 
gi|37963485|gb|AAR05866.1|  RNA polymerase II largest subunit [Ar   130    7e-29 
gi|72187100|gb|AAC03141.2|  RNA polymerase II largest subunit [Sc   130    7e-29 
gi|71665443|ref|XP_819691.1|  DNA-directed RNA polymerase III ...   130    7e-29   Gene info
gi|50409953|ref|XP_456921.1|  hypothetical protein DEHA0A14036...   130    7e-29   Gene info
gi|156405|gb|AAA28126.1|  RNA polymerase II                         130    8e-29   UniGene info
gi|71987878|ref|NP_500523.3|  AMAnitin resistant family member...   130    8e-29   UniGene infoGene info
gi|7494579|pir||T29959  DNA-directed RNA polymerase II large s...   130    8e-29 
gi|31126986|gb|AAK11870.2|  RNA polymerase II largest subunit [Ab   130    9e-29 
gi|520513|gb|AAA50227.1|  RNA polymerase II, largest subunit        130    9e-29 
gi|58395891|gb|AAW72753.1|  RNA polymerase II largest subunit [Gr   130    9e-29 
gi|66536933|ref|XP_623281.1|  PREDICTED: similar to DNA-direct...   130    1e-28   Gene info
gi|71027119|ref|XP_763203.1|  DNA-directed RNA polymerase II l...   129    1e-28   Gene info
gi|520503|gb|AAC83397.1|  RNA polymerase II, largest subunit [Art   129    1e-28 
gi|6624239|dbj|BAA88484.1|  RNA polymerase II largest subunit [Ep   129    1e-28 
gi|78190535|gb|ABB29589.1|  DNA-directed RNA polymerase II lar...   129    2e-28 
gi|85000327|ref|XP_954882.1|  DNA-directed RNA polymerase II l...   129    2e-28   Gene info
gi|31127010|gb|AAF26623.2|AF138973_1  RNA polymerase II largest s   129    2e-28 
gi|31127038|gb|AAF26658.2|AF139008_1  RNA polymerase II largest s   129    2e-28 
gi|57157185|dbj|BAD83622.1|  RNA polymerase II subunit Rpb1 [Enta   129    2e-28 
gi|39945340|ref|XP_362207.1|  hypothetical protein MG04652.4 [Mag   129    3e-28   UniGene infoGene info
gi|31127030|gb|AAF26646.2|AF138996_1  RNA polymerase II largest s   128    3e-28 
gi|78190699|gb|ABB29671.1|  DNA-directed RNA polymerase II lar...   128    3e-28 
gi|71019559|ref|XP_760010.1|  hypothetical protein UM03863.1 [...   128    3e-28   Gene info
gi|19172989|ref|NP_597540.1|  DNA-DIRECTED RNA POLYMERASE II [...   128    3e-28   Gene info
gi|78714210|gb|ABB51087.1|  RNA polymerase II largest subunit [Bo   128    4e-28 
gi|115742384|ref|XP_001176260.1|  PREDICTED: similar to DNA-di...   128    4e-28   Gene info
gi|115742388|ref|XP_001175967.1|  PREDICTED: similar to DNA-di...   128    4e-28   Gene info
gi|115742386|ref|XP_001176115.1|  PREDICTED: similar to DNA-di...   128    4e-28   Gene info
gi|6320061|ref|NP_010141.1|  RNA polymerase II largest subunit...   127    7e-28   Gene info
gi|4398|emb|CAA26904.1|  put. RNA polymerase II largest subuni...   127    7e-28 
gi|13310932|gb|AAF36438.2|AF126254_1  RNA polymerase II largest s   127    8e-28 
gi|37963481|gb|AAR05864.1|  RNA polymerase II largest subunit [Ma   127    8e-28 
gi|68128319|emb|CAJ08467.1|  RNA polymerase ii largest subunit [L   127    9e-28 
gi|37963491|gb|AAR05869.1|  RNA polymerase II largest subunit [Ze   126    1e-27 
gi|5263288|gb|AAC47792.2|  RNA polymerase II large subunit [Leish   125    2e-27 
gi|37963483|gb|AAR05865.1|  RNA polymerase II largest subunit [Gi   125    2e-27 
gi|37963479|gb|AAR05863.1|  RNA polymerase II largest subunit [Cy   125    2e-27 
gi|31127008|gb|AAK11873.2|  RNA polymerase II largest subunit [Bo   125    3e-27 
gi|31127042|gb|AAF26663.2|AF139013_1  RNA polymerase II largest s   125    3e-27 
gi|38232323|gb|AAR14997.1|  RNA polymerase II largest subunit [Ne   125    3e-27 
gi|43621|emb|CAA40431.1|  A subunit [Halococcus morrhuae]           124    5e-27 
gi|50289967|ref|XP_447415.1|  hypothetical protein CAGL0I03828...   124    5e-27   Gene info
gi|133399|sp|P15349|RPOA1_HALMO  DNA-directed RNA polymerase subu   124    5e-27 
gi|520509|gb|AAA50225.1|  RNA polymerase II, largest subunit        123    9e-27 
gi|37963489|gb|AAR05868.1|  RNA polymerase II largest subunit [Ny   123    1e-26 
gi|13183799|gb|AAK15346.1|AF338253_1  RNA polymerase II largest s   122    2e-26 
gi|13274160|emb|CAC33863.1|  RNA polymerase II largest subunit [P   122    3e-26 
gi|67612875|ref|XP_667260.1|  DNA-directed RNA polymerase II/I...   121    4e-26   Gene info
gi|21280519|gb|AAM45152.1|AF395111_1  RNA polymerase II largest s   121    4e-26 
gi|66475716|ref|XP_627674.1|  DNA-directed RNA polymerase III ...   121    4e-26   Gene info
gi|13812416|ref|NP_113534.1|  DNA-directed RNA polymerase II l...   121    5e-26   Gene info
gi|32398906|emb|CAD98371.1|  DNA-directed RNA polymerase II/II...   121    5e-26 
gi|37726869|gb|AAO38801.1|  DNA-dependent RNA polymerase II la...   120    6e-26 
gi|19074431|ref|NP_585937.1|  DNA-DIRECTED RNA POLYMERASE III ...   120    9e-26   Gene info
gi|37963487|gb|AAR05867.1|  RNA polymerase II largest subunit [Ep   120    1e-25 
gi|74830400|emb|CAI39062.1|  DNA-directed RNA polymerase III l...   119    1e-25 
gi|20159751|gb|AAM12030.1|  RNA polymerase III subunit RPC155-B [   119    1e-25   UniGene infoGene info
gi|23619219|ref|NP_705181.1|  DNA-directed RNA polymerase 3 la...   119    2e-25   GeoGene info
gi|13274097|emb|CAC33855.1|  RNA polymerase II largest subunit...   117    8e-25 
gi|68070079|ref|XP_676951.1|  DNA-directed RNA polymerase 3 la...   116    1e-24   Gene info
gi|4001824|gb|AAD12604.1|  largest subunit of RNA polymerase I...   116    1e-24 
gi|133354|sp|P27625|RPC1_PLAFA  DNA-directed RNA polymerase II...   116    2e-24 
gi|323135|pir||A45597  DNA-directed RNA polymerase (EC 2.7.7.6...   116    2e-24 
gi|13274166|emb|CAC33858.1|  RNA polymerase II largest subunit [L   115    3e-24 
gi|31127022|gb|AAF26634.2|AF138984_1  RNA polymerase II largest s   114    5e-24 
gi|82794246|ref|XP_728359.1|  RNA polymerase A/beta'/A'' subun...   114    6e-24   Gene info
gi|13274162|emb|CAC33859.1|  RNA polymerase II largest subunit [N   114    9e-24 
gi|102174|pir||S22812  DNA-directed RNA polymerase (EC 2.7.7.6...   110    6e-23 
gi|71078866|ref|XP_778518.1|  DNA-directed RNA polymerase III ...   110    6e-23   Gene info
gi|13274099|emb|CAC33856.1|  RNA polymerase II largest subunit [G   110    8e-23 
gi|72255755|gb|AAK12725.2|  RNA polymerase II largest subunit [Ha   109    1e-22 
gi|118348890|ref|XP_001007918.1|  RNA polymerase Rpb1, domain ...   109    1e-22   Gene info
gi|72255752|gb|AAK12730.2|  RNA polymerase II largest subunit [He   108    2e-22 
gi|38232237|gb|AAR14954.1|  RNA polymerase II largest subunit [Ar   107    6e-22 
gi|38232285|gb|AAR14978.1|  RNA polymerase II largest subunit [Li   107    9e-22 
gi|31127040|gb|AAF26661.2|AF139011_1  RNA polymerase II largest s   106    1e-21 
gi|71029280|ref|XP_764283.1|  DNA-directed RNA polymerase III ...   105    2e-21   Gene info
gi|38232417|gb|AAR15044.1|  RNA polymerase II largest subunit [Ma   105    3e-21 
gi|13274168|emb|CAC33860.1|  RNA polymerase II largest subunit [H   105    3e-21 
gi|38232241|gb|AAR14956.1|  RNA polymerase II largest subunit [Ch   105    3e-21 
gi|78100246|gb|ABB20924.1|  RNA polymerase II largest subunit [Ti   105    4e-21 
gi|31127012|gb|AAF26625.2|AF138975_1  RNA polymerase II larges...   104    5e-21 
gi|55819787|ref|YP_142855.1|  DNA directed RNA polymerase subu...   104    6e-21   Gene info
gi|118346269|ref|XP_977135.1|  RNA polymerase Rpb1, domain 2 f...   103    7e-21   Gene info
gi|38232373|gb|AAR15022.1|  RNA polymerase II largest subunit [Sk   103    8e-21 
gi|31127020|gb|AAF26631.2|AF138981_1  RNA polymerase II largest s   103    9e-21 
gi|38232445|gb|AAR15058.1|  RNA polymerase II largest subunit [Th   103    1e-20 
gi|15238597|ref|NP_200812.1|  NRPC1; DNA binding / DNA-directe...   103    2e-20   UniGene infoGene info
gi|38232265|gb|AAR14968.1|  RNA polymerase II largest subunit [Fo   102    2e-20 
gi|38232339|gb|AAR15005.1|  RNA polymerase II largest subunit [Or   102    2e-20 
gi|34597090|gb|AAQ77120.1|  RNA polymerase II largest subunit [Na   102    3e-20 
gi|84997133|ref|XP_953288.1|  DNA-directed RNA polymerase III ...   102    3e-20   Gene info
gi|38232235|gb|AAR14953.1|  RNA polymerase II largest subunit [Ar   102    4e-20 
gi|74830406|emb|CAI39063.1|  DNA-directed RNA polymerase II la...   101    4e-20 
gi|38232349|gb|AAR15010.1|  RNA polymerase II largest subunit [Po   101    5e-20 
gi|92871577|gb|ABE80522.1|  RNA polymerase Rpb1, domain 5 [Medica   100    6e-20 
gi|38232279|gb|AAR14975.1|  RNA polymerase II largest subunit [Le   100    9e-20 
gi|31127054|gb|AAC03142.2|  RNA polymerase II largest subunit [Tr   100    1e-19 
gi|38232303|gb|AAR14987.1|  RNA polymerase II largest subunit [Ly   100    1e-19 
gi|78190765|gb|ABB29704.1|  RNA polymerase I large subunit [Aphro   100    1e-19 
gi|62911625|gb|AAY21443.1|  RNA polymerase II [Melitta leporina]   99.8    2e-19 
gi|62911637|gb|AAY21449.1|  RNA polymerase II [Oxybelus sp. Oxsp8  99.4    2e-19 
gi|68490869|ref|XP_710761.1|  RNA polymerase I largest subunit...  99.4    2e-19   Gene info
gi|38232273|gb|AAR14972.1|  RNA polymerase II largest subunit [Ha  99.4    2e-19 
gi|62911589|gb|AAY21425.1|  RNA polymerase II [Holcopasites ru...  99.4    2e-19 
gi|62911553|gb|AAY21407.1|  RNA polymerase II [Centris rhodopus]   99.4    2e-19 
gi|62911725|gb|AAY21493.1|  RNA polymerase II [Meliponula erythra  99.0    2e-19 
gi|62911521|gb|AAY21391.1|  RNA polymerase II [Anthophora mont...  99.0    2e-19 
gi|62911539|gb|AAY21400.1|  RNA polymerase II [Ceratina calcarata  99.0    2e-19 
gi|38232209|gb|AAR14940.1|  RNA polymerase II largest subunit [Ac  99.0    3e-19 
gi|31127028|gb|AAF26643.2|AF138993_1  RNA polymerase II largest s  99.0    3e-19 
gi|38232333|gb|AAR15002.1|  RNA polymerase II largest subunit [Ni  99.0    3e-19 
gi|13274156|emb|CAC33868.1|  RNA polymerase II largest subunit [T  99.0    3e-19 
gi|62911525|gb|AAY21393.1|  RNA polymerase II [Andrena brooksi]    99.0    3e-19 
gi|31127026|gb|AAF26640.2|AF138990_1  RNA polymerase II largest s  98.6    3e-19 
gi|62911755|gb|AAY21508.1|  RNA polymerase II [Pseudopanurgus fra  98.6    4e-19 
gi|62911601|gb|AAY21431.1|  RNA polymerase II [Goniocolletes f...  98.6    4e-19 
gi|9628206|ref|NP_042792.1|  RNA polymerase subunit 1 [African...  98.2    4e-19   Gene info
gi|13274172|emb|CAC33862.1|  RNA polymerase II largest subunit [P  98.2    4e-19 
gi|110669622|gb|ABG81906.1|  RNA polymerase II largest subunit [D  97.8    5e-19 
gi|38232229|gb|AAR14950.1|  RNA polymerase II largest subunit [Ar  97.8    5e-19 
gi|13274174|emb|CAC33869.1|  RNA polymerase II largest subunit [V  97.8    6e-19 
gi|71480580|gb|AAZ32215.1|  RNA polymerase II large subunit [Cona  97.8    6e-19 
gi|38232379|gb|AAR15025.1|  RNA polymerase II largest subunit [Th  97.8    6e-19 
gi|73852534|ref|YP_293818.1|  putative DNA-dependent RNA polym...  97.8    6e-19   Gene info
gi|62911621|gb|AAY21441.1|  RNA polymerase II [Melitta capensis]   97.8    6e-19 
gi|62911623|gb|AAY21442.1|  RNA polymerase II [Melitta eickwor...  97.8    6e-19 
gi|62911569|gb|AAY21415.1|  RNA polymerase II [Dasypoda visnaga]   97.8    6e-19 
gi|62911641|gb|AAY21451.1|  RNA polymerase II [Plenoculus sp. Pls  97.8    7e-19 
gi|62911551|gb|AAY21406.1|  RNA polymerase II [Callomelitta antip  97.4    7e-19 
gi|38232319|gb|AAR14995.1|  RNA polymerase II largest subunit [Me  97.4    8e-19 
gi|62911657|gb|AAY21459.1|  RNA polymerase II [Rophites algiru...  97.4    8e-19 
gi|62911573|gb|AAY21417.1|  RNA polymerase II [Dufourea mulleri]   97.4    8e-19 
gi|62911527|gb|AAY21394.1|  RNA polymerase II [Anthidium oblon...  97.1    9e-19 
gi|62911533|gb|AAY21397.1|  RNA polymerase II [Calliopsis anth...  97.1    9e-19 
gi|62911563|gb|AAY21412.1|  RNA polymerase II [Ctenoplectra albol  96.7    1e-18 
gi|71480590|gb|AAZ32220.1|  RNA polymerase II large subunit [Lith  96.7    1e-18 
gi|38232295|gb|AAR14983.1|  RNA polymerase II largest subunit [Lo  96.7    1e-18 
gi|62911715|gb|AAY21488.1|  RNA polymerase II [Protandrena nan...  96.7    1e-18 
gi|62911671|gb|AAY21466.1|  RNA polymerase II [Stigmus sp. Sgsp81  96.7    1e-18 
gi|62911519|gb|AAY21390.1|  RNA polymerase II [Agapostemon tyl...  96.7    1e-18 
gi|38232223|gb|AAR14947.1|  RNA polymerase II largest subunit [Al  96.3    2e-18 
gi|38232259|gb|AAR14965.1|  RNA polymerase II largest subunit [Eu  96.3    2e-18 
gi|62911555|gb|AAY21408.1|  RNA polymerase II [Colletes inaequali  96.3    2e-18 
gi|13274158|emb|CAC33864.1|  RNA polymerase II largest subunit [P  95.9    2e-18 
gi|31127016|gb|AAF26628.2|AF138978_1  RNA polymerase II largest s  95.5    3e-18 
gi|62911737|gb|AAY21499.1|  RNA polymerase II [Protandrena mexica  95.1    4e-18 
gi|71480582|gb|AAZ32216.1|  RNA polymerase II large subunit [Syst  95.1    4e-18 
gi|62911733|gb|AAY21497.1|  RNA polymerase II [Macrotera echinoca  95.1    4e-18 
gi|62911627|gb|AAY21444.1|  RNA polymerase II [Megachile pugnata]  95.1    4e-18 
gi|71480578|gb|AAZ32214.1|  RNA polymerase II large subunit [Pseu  94.7    4e-18 
gi|71480576|gb|AAZ32213.1|  RNA polymerase II large subunit [Nomi  94.7    4e-18 
gi|13274164|emb|CAC33861.1|  RNA polymerase II largest subunit...  94.7    5e-18 


Alignements 2 à 2


gi|118195268|gb|ABK78186.1|  DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Cenarchaeum 
symbiosum]
Length=1260

 Score =  440 bits (1132),  Expect = 4e-122, Method: Composition-based stats.
 Identities = 226/311 (72%), Positives = 258/311 (82%), Gaps = 1/311 (0%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEAR+EA+LLMRVQDQLISPR+GGPIIGGLRDFITG+YLLTKD TTL+ +EF
Sbjct  465  MNLHVPQSEEARAEAMLLMRVQDQLISPRYGGPIIGGLRDFITGSYLLTKDDTTLTREEF  524

Query  61   ANLAMLGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDVVIK  120
             NLAMLG + G LP P   K  L+TGKQLFSLFLP+DFNY++TSKWSKGTKGT KDVVIK
Sbjct  525  TNLAMLGDYGGALPKP-GAKGQLFTGKQLFSLFLPKDFNYIITSKWSKGTKGTPKDVVIK  583

Query  121  NGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHYGFSYGYG  180
            NG+LISGVIDKSSIGAEEPESVLHRIAKDYGN  AK FLNS LII KQF+THYGFSYGY 
Sbjct  584  NGELISGVIDKSSIGAEEPESVLHRIAKDYGNAPAKKFLNSVLIIAKQFITHYGFSYGYA  643

Query  181  DLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMSNLGKlrd  240
            DLE+PEK R+ I DD   +YD+++  I   KKG L+  RG++  E LEAYI+S L + RD
Sbjct  644  DLELPEKARKEIFDDIGASYDKVYGYIADAKKGGLRLTRGLSPDEALEAYIVSELSRARD  703

Query  241  raanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGYNNRVLTHF  300
             A   A+ S D  NAGKIMA+TGARGSSLN+GQMAG+LGQQ+RRG RL KGYNNR L HF
Sbjct  704  TAGGIADQSFDHTNAGKIMASTGARGSSLNIGQMAGSLGQQSRRGQRLLKGYNNRALPHF  763

Query  301  EEHENDPDAHG  311
             E+++ PDAHG
Sbjct  764  RENDDSPDAHG  774


>gi|46670|emb|CAA32925.1|  RNA polymerase subunit A (AA 1-880) [Sulfolobus acidocaldarius]
Length=880

 Score =  234 bits (597),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  LM V   +I+PR+GGPIIGG +D+I+GAYLL+   T L+ +E 
Sbjct  462  MNLHVPQSEEAIAEARELMLVHKNIITPRYGGPIIGGGQDYISGAYLLSVKTTLLTVEEV  521

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
            A +  +  F G+L +P     +  YTGKQ+ SLFLP+DFN+   +  SKG +  + ++  
Sbjct  522  ATILGVTDFVGELGEPAILAPKPYYTGKQVISLFLPKDFNFHGPANISKGPRACKDEICP  581

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV DK +IG ++PES+LH   ++YG E  K  +++   +  +F+  
Sbjct  582  HDSFIVIKNGLLLEGVFDKKAIGNQQPESMLHWSIREYGTEYGKWLMDNVFKMFIRFLEM  641

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P++ +  I    ++ Y ++ + I++  +G L+PI G T +E+LE+YI+
Sbjct  642  RGFTMTLEDITIPDEAQNEITTKIKEGYSQVDEYIRKFNEGQLEPIPGRTIEESLESYIL  701

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L KLR  A   A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  702  DTLDKLRKVAGEIATKYLDPFNNVYIMAITGARGSELNITQMTALLGQQSVRGERIRRGY  761

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L+ F+  +  P+A G
Sbjct  762  RERTLSLFKYGDIAPEARG  780


>gi|70606495|ref|YP_255365.1| Gene info DNA-directed RNA polymerase subunit alpha [Sulfolobus acidocaldarius 
DSM 639]
 gi|73920763|sp|P11512|RPOA1_SULAC  DNA-directed RNA polymerase subunit A'
 gi|68567143|gb|AAY80072.1| Gene info DNA-directed RNA polymerase subunit A' [Sulfolobus acidocaldarius 
DSM 639]
Length=880

 Score =  234 bits (597),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  LM V   +I+PR+GGPIIGG +D+I+GAYLL+   T L+ +E 
Sbjct  462  MNLHVPQSEEAIAEARELMLVHKNIITPRYGGPIIGGGQDYISGAYLLSVKTTLLTVEEV  521

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
            A +  +  F G+L +P     +  YTGKQ+ SLFLP+DFN+   +  SKG +  + ++  
Sbjct  522  ATILGVTDFVGELGEPAILAPKPYYTGKQVISLFLPKDFNFHGPANISKGPRACKDEICP  581

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV DK +IG ++PES+LH   ++YG E  K  +++   +  +F+  
Sbjct  582  HDSFIVIKNGLLLEGVFDKKAIGNQQPESMLHWSIREYGTEYGKWLMDNVFKMFIRFLEM  641

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P++ +  I    ++ Y ++ + I++  +G L+PI G T +E+LE+YI+
Sbjct  642  RGFTMTLEDITIPDEAQNEITTKIKEGYSQVDEYIRKFNEGQLEPIPGRTIEESLESYIL  701

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L KLR  A   A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  702  DTLDKLRKVAGEIATKYLDPFNNVYIMAITGARGSELNITQMTALLGQQSVRGERIRRGY  761

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L+ F+  +  P+A G
Sbjct  762  RERTLSLFKYGDIAPEARG  780


>gi|110605950|ref|ZP_01393996.1|  DNA-directed RNA polymerase, subunit A' [Thermofilum pendens 
Hrk 5]
 gi|110554024|gb|EAT67167.1|  DNA-directed RNA polymerase, subunit A' [Thermofilum pendens 
Hrk 5]
Length=888

 Score =  229 bits (584),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 132/319 (41%), Positives = 191/319 (59%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEAR+EA  LM VQ+ +++PR+G PIIGGL D+I+G+YLLT+    L  +  
Sbjct  466  MNLHVPQSEEARAEARELMLVQEHIMTPRYGAPIIGGLHDYISGSYLLTRKDALLDKKSA  525

Query  61   ANLAMLGGFTGKLPDPENKKENLY-TGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKD---  116
              L  +G     L +P   K   Y TGKQ+ S+FLP+  NYV  +  +  +    ++   
Sbjct  526  LRLLYIGNNCDPLVEPAIIKPGPYWTGKQIVSMFLPKGLNYVGRASVAPASGKCDEEYCE  585

Query  117  ----VVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                V+IK+G+L+ GV DK +IGAE+  +VLH I +++G EKAK  ++    +   ++  
Sbjct  586  NDGYVLIKDGKLLLGVFDKQAIGAEKHGTVLHEIVREFGVEKAKELMDGMFKVFIAYLDM  645

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
            +GF+ G   +E+P +    I +  Q+   ++ DLI+Q + G L+P+ G T KETLE  IM
Sbjct  646  HGFTMGVDSVEIPREAEDDIREILQEAEKKVEDLIRQYESGELQPMPGKTRKETLEDLIM  705

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
            + L + R RA    +  L   N   IMA TGARGS LN+ QMA  +GQQ+ RG R+ +GY
Sbjct  706  NVLAEARTRAGEVTSKHLGLLNHAVIMAKTGARGSMLNLTQMAAVVGQQSVRGKRIERGY  765

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L HF + +  P A G
Sbjct  766  TGRALPHFVKGDLSPLAKG  784


>gi|15920465|ref|NP_376134.1| Gene info DNA-directed RNA polymerase subunit alpha [Sulfolobus tokodaii 
str. 7]
 gi|15621248|dbj|BAB65243.1| Gene info 884aa long hypothetical DNA-directed RNA polymerase subunit A' 
[Sulfolobus tokodaii str. 7]
Length=884

 Score =  225 bits (574),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 133/319 (41%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  +M V   +I+PR+GGPI+GG +D+I+GAYLLT   T L+ +E 
Sbjct  466  MNLHVPQSEEAIAEAKEIMLVHRNIITPRYGGPIMGGAQDYISGAYLLTVKTTLLTREEV  525

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
              +  +  F G++ +P        YTGKQ+ SLFLP+DFN+   +  SKG +  + +V  
Sbjct  526  TTILGVTDFMGEIGEPAILAPREYYTGKQIVSLFLPKDFNFHGQANISKGFRACKNEVCP  585

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV+DK +IG ++PES+LH + ++YG E  +  +++   +  +F+  
Sbjct  586  HDSYIVIKNGILLEGVLDKKAIGNQQPESILHWLVREYGTEYGRWVMDNVFKLFIRFIEL  645

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P +  + I +  +  Y ++ +LI+Q  +GTL+ I G T +E+LE +I+
Sbjct  646  RGFTMTLDDVTIPPQAFKEIDEQIEVAYKKVEELIKQYNEGTLELIPGRTAEESLEDHIL  705

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L +LR  A + A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  706  ETLDQLRKVAGDIATKYLDPFNNVYIMAVTGARGSELNITQMTAMLGQQSVRGERIKRGY  765

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L HF+  +  PDA G
Sbjct  766  MTRTLPHFKPGDISPDARG  784gi|118195268|gb|ABK78186.1|  DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Cenarchaeum 
symbiosum]
Length=1260

 Score =  440 bits (1132),  Expect = 4e-122, Method: Composition-based stats.
 Identities = 226/311 (72%), Positives = 258/311 (82%), Gaps = 1/311 (0%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEAR+EA+LLMRVQDQLISPR+GGPIIGGLRDFITG+YLLTKD TTL+ +EF
Sbjct  465  MNLHVPQSEEARAEAMLLMRVQDQLISPRYGGPIIGGLRDFITGSYLLTKDDTTLTREEF  524

Query  61   ANLAMLGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDVVIK  120
             NLAMLG + G LP P   K  L+TGKQLFSLFLP+DFNY++TSKWSKGTKGT KDVVIK
Sbjct  525  TNLAMLGDYGGALPKP-GAKGQLFTGKQLFSLFLPKDFNYIITSKWSKGTKGTPKDVVIK  583

Query  121  NGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHYGFSYGYG  180
            NG+LISGVIDKSSIGAEEPESVLHRIAKDYGN  AK FLNS LII KQF+THYGFSYGY 
Sbjct  584  NGELISGVIDKSSIGAEEPESVLHRIAKDYGNAPAKKFLNSVLIIAKQFITHYGFSYGYA  643

Query  181  DLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMSNLGKlrd  240
            DLE+PEK R+ I DD   +YD+++  I   KKG L+  RG++  E LEAYI+S L + RD
Sbjct  644  DLELPEKARKEIFDDIGASYDKVYGYIADAKKGGLRLTRGLSPDEALEAYIVSELSRARD  703

Query  241  raanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGYNNRVLTHF  300
             A   A+ S D  NAGKIMA+TGARGSSLN+GQMAG+LGQQ+RRG RL KGYNNR L HF
Sbjct  704  TAGGIADQSFDHTNAGKIMASTGARGSSLNIGQMAGSLGQQSRRGQRLLKGYNNRALPHF  763

Query  301  EEHENDPDAHG  311
             E+++ PDAHG
Sbjct  764  RENDDSPDAHG  774


>gi|46670|emb|CAA32925.1|  RNA polymerase subunit A (AA 1-880) [Sulfolobus acidocaldarius]
Length=880

 Score =  234 bits (597),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  LM V   +I+PR+GGPIIGG +D+I+GAYLL+   T L+ +E 
Sbjct  462  MNLHVPQSEEAIAEARELMLVHKNIITPRYGGPIIGGGQDYISGAYLLSVKTTLLTVEEV  521

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
            A +  +  F G+L +P     +  YTGKQ+ SLFLP+DFN+   +  SKG +  + ++  
Sbjct  522  ATILGVTDFVGELGEPAILAPKPYYTGKQVISLFLPKDFNFHGPANISKGPRACKDEICP  581

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV DK +IG ++PES+LH   ++YG E  K  +++   +  +F+  
Sbjct  582  HDSFIVIKNGLLLEGVFDKKAIGNQQPESMLHWSIREYGTEYGKWLMDNVFKMFIRFLEM  641

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P++ +  I    ++ Y ++ + I++  +G L+PI G T +E+LE+YI+
Sbjct  642  RGFTMTLEDITIPDEAQNEITTKIKEGYSQVDEYIRKFNEGQLEPIPGRTIEESLESYIL  701

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L KLR  A   A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  702  DTLDKLRKVAGEIATKYLDPFNNVYIMAITGARGSELNITQMTALLGQQSVRGERIRRGY  761

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L+ F+  +  P+A G
Sbjct  762  RERTLSLFKYGDIAPEARG  780


>gi|70606495|ref|YP_255365.1| Gene info DNA-directed RNA polymerase subunit alpha [Sulfolobus acidocaldarius 
DSM 639]
 gi|73920763|sp|P11512|RPOA1_SULAC  DNA-directed RNA polymerase subunit A'
 gi|68567143|gb|AAY80072.1| Gene info DNA-directed RNA polymerase subunit A' [Sulfolobus acidocaldarius 
DSM 639]
Length=880

 Score =  234 bits (597),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  LM V   +I+PR+GGPIIGG +D+I+GAYLL+   T L+ +E 
Sbjct  462  MNLHVPQSEEAIAEARELMLVHKNIITPRYGGPIIGGGQDYISGAYLLSVKTTLLTVEEV  521

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
            A +  +  F G+L +P     +  YTGKQ+ SLFLP+DFN+   +  SKG +  + ++  
Sbjct  522  ATILGVTDFVGELGEPAILAPKPYYTGKQVISLFLPKDFNFHGPANISKGPRACKDEICP  581

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV DK +IG ++PES+LH   ++YG E  K  +++   +  +F+  
Sbjct  582  HDSFIVIKNGLLLEGVFDKKAIGNQQPESMLHWSIREYGTEYGKWLMDNVFKMFIRFLEM  641

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P++ +  I    ++ Y ++ + I++  +G L+PI G T +E+LE+YI+
Sbjct  642  RGFTMTLEDITIPDEAQNEITTKIKEGYSQVDEYIRKFNEGQLEPIPGRTIEESLESYIL  701

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L KLR  A   A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  702  DTLDKLRKVAGEIATKYLDPFNNVYIMAITGARGSELNITQMTALLGQQSVRGERIRRGY  761

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L+ F+  +  P+A G
Sbjct  762  RERTLSLFKYGDIAPEARG  780


>gi|110605950|ref|ZP_01393996.1|  DNA-directed RNA polymerase, subunit A' [Thermofilum pendens 
Hrk 5]
 gi|110554024|gb|EAT67167.1|  DNA-directed RNA polymerase, subunit A' [Thermofilum pendens 
Hrk 5]
Length=888

 Score =  229 bits (584),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 132/319 (41%), Positives = 191/319 (59%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEAR+EA  LM VQ+ +++PR+G PIIGGL D+I+G+YLLT+    L  +  
Sbjct  466  MNLHVPQSEEARAEARELMLVQEHIMTPRYGAPIIGGLHDYISGSYLLTRKDALLDKKSA  525

Query  61   ANLAMLGGFTGKLPDPENKKENLY-TGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKD---  116
              L  +G     L +P   K   Y TGKQ+ S+FLP+  NYV  +  +  +    ++   
Sbjct  526  LRLLYIGNNCDPLVEPAIIKPGPYWTGKQIVSMFLPKGLNYVGRASVAPASGKCDEEYCE  585

Query  117  ----VVIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                V+IK+G+L+ GV DK +IGAE+  +VLH I +++G EKAK  ++    +   ++  
Sbjct  586  NDGYVLIKDGKLLLGVFDKQAIGAEKHGTVLHEIVREFGVEKAKELMDGMFKVFIAYLDM  645

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
            +GF+ G   +E+P +    I +  Q+   ++ DLI+Q + G L+P+ G T KETLE  IM
Sbjct  646  HGFTMGVDSVEIPREAEDDIREILQEAEKKVEDLIRQYESGELQPMPGKTRKETLEDLIM  705

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
            + L + R RA    +  L   N   IMA TGARGS LN+ QMA  +GQQ+ RG R+ +GY
Sbjct  706  NVLAEARTRAGEVTSKHLGLLNHAVIMAKTGARGSMLNLTQMAAVVGQQSVRGKRIERGY  765

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L HF + +  P A G
Sbjct  766  TGRALPHFVKGDLSPLAKG  784


>gi|15920465|ref|NP_376134.1| Gene info DNA-directed RNA polymerase subunit alpha [Sulfolobus tokodaii 
str. 7]
 gi|15621248|dbj|BAB65243.1| Gene info 884aa long hypothetical DNA-directed RNA polymerase subunit A' 
[Sulfolobus tokodaii str. 7]
Length=884

 Score =  225 bits (574),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 133/319 (41%), Positives = 197/319 (61%), Gaps = 8/319 (2%)

Query  1    MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF  60
            MNLHVPQSEEA +EA  +M V   +I+PR+GGPI+GG +D+I+GAYLLT   T L+ +E 
Sbjct  466  MNLHVPQSEEAIAEAKEIMLVHRNIITPRYGGPIMGGAQDYISGAYLLTVKTTLLTREEV  525

Query  61   ANLAMLGGFTGKLPDPEN-KKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDV--  117
              +  +  F G++ +P        YTGKQ+ SLFLP+DFN+   +  SKG +  + +V  
Sbjct  526  TTILGVTDFMGEIGEPAILAPREYYTGKQIVSLFLPKDFNFHGQANISKGFRACKNEVCP  585

Query  118  -----VIKNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTH  172
                 VIKNG L+ GV+DK +IG ++PES+LH + ++YG E  +  +++   +  +F+  
Sbjct  586  HDSYIVIKNGILLEGVLDKKAIGNQQPESILHWLVREYGTEYGRWVMDNVFKLFIRFIEL  645

Query  173  YGFSYGYGDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIM  232
             GF+    D+ +P +  + I +  +  Y ++ +LI+Q  +GTL+ I G T +E+LE +I+
Sbjct  646  RGFTMTLDDVTIPPQAFKEIDEQIEVAYKKVEELIKQYNEGTLELIPGRTAEESLEDHIL  705

Query  233  SNLGKlrdraanaanlsldddnaGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGY  292
              L +LR  A + A   LD  N   IMA TGARGS LN+ QM   LGQQ+ RG R+ +GY
Sbjct  706  ETLDQLRKVAGDIATKYLDPFNNVYIMAVTGARGSELNITQMTAMLGQQSVRGERIKRGY  765

Query  293  NNRVLTHFEEHENDPDAHG  311
              R L HF+  +  PDA G
Sbjct  766  MTRTLPHFKPGDISPDARG  784



ORF finding

Direct strand  any codon

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 936.
GAAATGAATCTTCATGTACCTCAAAGTGAAGAGGCACGTTCTGAAGCAATCCTACTAATG
AGAGTTCAAGATCAATTAATCTCTCCACGATTTGGTGGTCCAATTATTGGTGGTCTAAGA
GACTTTATCACTGGTGCTTATCTTCTCACAAAAGATGGTACTACACTTTCTAGTCAAGAA
TTTGCAAATCTAGCAATGTTAGGCGGTTTTACAGGAAAACTACCGGACCCTGAAAATAAA
AAAGAAAATCTTTACACTGGAAAACAACTTTTCTCATTATTCTTACCTGAAGATTTCAAT
TACGTAATGACATCAAAATGGTCTAAAGGAACAAAAGGTACTCAAAAAGATGTTGTAATC
AAAAACGGTCAATTGATTAGTGGAGTAATTGATAAATCATCTATCGGTGCTGAAGAACCT
GAAAGTGTTTTGCATAGAATTGCAAAGGATTATGGTAATGAAAAAGCAAAAGTTTTCTTA
AATTCCGAATTAATAATTATCAAACAATTTGTAACCCATTATGGATTTAGTTATGGTTAT
GGTGACTTAGAAGTACCTGAAAAAGATAGACAGGCAATAATAGATGATACTCAAAAGACA
TACGATGAAATTCATGATTTAATCCAACAAGAAAAGAAAGGCACACTAAAGCCAATTAGA
GGAATGACAACAAAAGAAACTCTTGAGGCATACATTATGAGTAATCTAGGAAAATTAAGA
GATAGGGCAGCAAATGCAGCAAATCTTTCATTAGATGATGATAATGCTGGAAAAATTATG
GCAACTACCGGTGCTAGAGGTTCATCTCTAAATGTAGGTCAAATGGCTGGTGCATTGGGA
CAACAAGCACGTCGTGGTAATCGTCTAAACAAAGGTTACAATAATCGTGTTTTAACTCAC
TTTGAAGAACATGAAAATGATCCCGATGCCCATGGAAT

>Translation of ORF number 1 in reading frame 1 on the direct strand.
EMNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQE
FANLAMLGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDVVI
KNGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHYGFSYGY
GDLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMSNLGKLR
DRAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGYNNRVLTH
FEEHENDPDAHG

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


Reverse strand any codon

>ORF number 1 in reading frame 1 on the reverse strand extends from base 121 to base 327.
CCTACATTTAGAGATGAACCTCTAGCACCGGTAGTTGCCATAATTTTTCCAGCATTATCA
TCATCTAATGAAAGATTTGCTGCATTTGCTGCCCTATCTCTTAATTTTCCTAGATTACTC
ATAATGTATGCCTCAAGAGTTTCTTTTGTTGTCATTCCTCTAATTGGCTTTAGTGTGCCT
TTCTTTTCTTGTTGGATTAAATCATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
PTFRDEPLAPVVAIIFPALSSSNERFAAFAALSLNFPRLLIMYASRVSFVVIPLIGFSVP
FFSCWIKS*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


Direct strand ATG + alternatifs

>ORF number 1 in reading frame 1 on the direct strand extends from base 4 to base 936.
ATGAATCTTCATGTACCTCAAAGTGAAGAGGCACGTTCTGAAGCAATCCTACTAATGAGA
GTTCAAGATCAATTAATCTCTCCACGATTTGGTGGTCCAATTATTGGTGGTCTAAGAGAC
TTTATCACTGGTGCTTATCTTCTCACAAAAGATGGTACTACACTTTCTAGTCAAGAATTT
GCAAATCTAGCAATGTTAGGCGGTTTTACAGGAAAACTACCGGACCCTGAAAATAAAAAA
GAAAATCTTTACACTGGAAAACAACTTTTCTCATTATTCTTACCTGAAGATTTCAATTAC
GTAATGACATCAAAATGGTCTAAAGGAACAAAAGGTACTCAAAAAGATGTTGTAATCAAA
AACGGTCAATTGATTAGTGGAGTAATTGATAAATCATCTATCGGTGCTGAAGAACCTGAA
AGTGTTTTGCATAGAATTGCAAAGGATTATGGTAATGAAAAAGCAAAAGTTTTCTTAAAT
TCCGAATTAATAATTATCAAACAATTTGTAACCCATTATGGATTTAGTTATGGTTATGGT
GACTTAGAAGTACCTGAAAAAGATAGACAGGCAATAATAGATGATACTCAAAAGACATAC
GATGAAATTCATGATTTAATCCAACAAGAAAAGAAAGGCACACTAAAGCCAATTAGAGGA
ATGACAACAAAAGAAACTCTTGAGGCATACATTATGAGTAATCTAGGAAAATTAAGAGAT
AGGGCAGCAAATGCAGCAAATCTTTCATTAGATGATGATAATGCTGGAAAAATTATGGCA
ACTACCGGTGCTAGAGGTTCATCTCTAAATGTAGGTCAAATGGCTGGTGCATTGGGACAA
CAAGCACGTCGTGGTAATCGTCTAAACAAAGGTTACAATAATCGTGTTTTAACTCACTTT
GAAGAACATGAAAATGATCCCGATGCCCATGGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MNLHVPQSEEARSEAILLMRVQDQLISPRFGGPIIGGLRDFITGAYLLTKDGTTLSSQEF
ANLAMLGGFTGKLPDPENKKENLYTGKQLFSLFLPEDFNYVMTSKWSKGTKGTQKDVVIK
NGQLISGVIDKSSIGAEEPESVLHRIAKDYGNEKAKVFLNSELIIIKQFVTHYGFSYGYG
DLEVPEKDRQAIIDDTQKTYDEIHDLIQQEKKGTLKPIRGMTTKETLEAYIMSNLGKLRD
RAANAANLSLDDDNAGKIMATTGARGSSLNVGQMAGALGQQARRGNRLNKGYNNRVLTHF
EEHENDPDAHG

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


Reverse strand ATG + alternatifs

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.