GOS 916040

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120682275
Annotathon code: GOS_916040
Sample :
  • GPS :41°29'9n; 71°21'4w
  • North American East Coast: Newport Harbor, RI - USA
  • Coastal (-1m, 9.4°C, 0.1-0.8 microns)
Authors
Team : UNIL
Username : Oli
Annotated on : 2009-04-28 16:09:37
  • Emery Olivier

Synopsis

  • Taxonomy: Betaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28216
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Betaproteobacteria - Order:
    Bacteria; Proteobacteria; Betaproteobacteria;

Genomic Sequence

>JCVI_READ_1091120682275 GOS_916040 Genomic DNA
AGACAATTTCCCCAGGTTCAGCAAGTTGCGCAGCGATTTGAACCGCATTAATCAAGTCTGCGGCATCTAATATATCTACACCAGCGCCCTCAATCCCGCG
CTTAATTAATTTAGCATCCCGCCCCATCAAAACTACTACCCGTACTTTTTCACGGATATAGTCCACTAGGATCTCAAAGTTTTGTTGCTTAGACTCGCCG
CCTAATAACAAAACGCATTTTGCTGGTAACCCAGAAATTGCCGCCGCTGTCGCACCCACATTTGTAGCTTTAGAATCATTATAAAATTGAACCCCAGATA
TATCTGCGACCCACTGCATACGATGATCCAATCCTTCGTAAGAAAGCAGCCCTCTTATTGCGTCCTCATTAACGCTTACCAGTGTGCTTGATAAAGCGAG
TGCTGCCATTGCATTACACACGTTATGCATTCCAGAAACCCTTAAGTCCTCGCATCTAAAAATTTGTTGCGAGCCACAAGCTACCCACTGCTCTCCTGCA
ATCTTACTAACCCCCCAAGATCGATCGTTATCTGGAGGACTCAACCCGAATGAAACGCTATCTTCCCCGGCTATCTCATTCAAGACAATTGGTTCGTCTC
GGTTAACCACCTTTATACCTCGACCAGAATGAATACGACATTTCGATCTTAAATAAGCATCAAAATCACGATAACGATCTAGATGATCCTCGGAAACGTT
TAGAACAACTGCCGCATCACATTCAAACGAGTACGTCGTATCAATTTGGAAACTGGACATCTCTAGCACAAAGACATCTGGCATTTTGCGCGCACGCCTT
TCAATTTGCTCTAAAACCTCTAACACAGGAACCCCAATGTTACCAACTGCCACAGCATCAAGACCACATTCCTGAAGAATTCGCTCAACCATCCTAGTGA
CGGTACTTTTGCCATTA

Translation

[2 - 916/917]   indirect strand
>GOS_916040 Translation [2-916   indirect strand]
NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDTTYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRG
IKVVNRDEPIVLNEIAGEDSVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTLVSVNEDAIRGLLSYEGLDHRM
QWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLAE
PGEIV

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Almost all blast results (from pblast against SP or NR, as well as blastx) point to UDP-N-acetylmuramoylalanine--D-glutamate ligase with very significant e-values.

Interproscan revealed that UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE domain also has a ligase activity (ligase activity GO:0016874 is not listed in "molecular function", which is why I left it to "unknown").

The selected sequences from Gamma, Beta, Delta/Epsilon proteobacteria allowed to reconstruct a tree consistent with the tree of life in which the studied sequence was placed among the betaproteobacteria.

ORF finding

PROTOCOL



a) SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


The longest ORF is ORF number 1 in reading frame 2 on the reverse strand which extends from base 2 to base 916.

RAW RESULTS

a) SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code
ORF Finder results
Results for 917 residue sequence "GOS_916040 Genomic DNA (North American East Coast: Newport Harbor, RI)" starting "AGACAATTTC"

>ORF number 1 in reading frame 1 on the direct strand extends from base 607 to base 897. 
CCACCTTTATACCTCGACCAGAATGAATACGACATTTCGATCTTAAATAAGCATCAAAAT 
CACGATAACGATCTAGATGATCCTCGGAAACGTTTAGAACAACTGCCGCATCACATTCAA 
ACGAGTACGTCGTATCAATTTGGAAACTGGACATCTCTAGCACAAAGACATCTGGCATTT 
TGCGCGCACGCCTTTCAATTTGCTCTAAAACCTCTAACACAGGAACCCCAATGTTACCAA 
CTGCCACAGCATCAAGACCACATTCCTGAAGAATTCGCTCAACCATCCTAG 
>Translation of ORF number 1 in reading frame 1 on the direct strand. 
PPLYLDQNEYDISILNKHQNHDNDLDDPRKRLEQLPHHIQTSTSYQFGNWTSLAQRHLAF 
CAHAFQFALKPLTQEPQCYQLPQHQDHIPEEFAQPS* 
No ORFs were found in reading frame 2. 
>ORF number 1 in reading frame 3 on the direct strand extends from base 342 to base 632. 
GAAAGCAGCCCTCTTATTGCGTCCTCATTAACGCTTACCAGTGTGCTTGATAAAGCGAGT 
GCTGCCATTGCATTACACACGTTATGCATTCCAGAAACCCTTAAGTCCTCGCATCTAAAA 
ATTTGTTGCGAGCCACAAGCTACCCACTGCTCTCCTGCAATCTTACTAACCCCCCAAGAT 
CGATCGTTATCTGGAGGACTCAACCCGAATGAAACGCTATCTTCCCCGGCTATCTCATTC 
AAGACAATTGGTTCGTCTCGGTTAACCACCTTTATACCTCGACCAGAATGA 
>Translation of ORF number 1 in reading frame 3 on the direct strand. 
ESSPLIASSLTLTSVLDKASAAIALHTLCIPETLKSSHLKICCEPQATHCSPAILLTPQD 
RSLSGGLNPNETLSSPAISFKTIGSSRLTTFIPRPE* 
>ORF number 2 in reading frame 3 on the direct strand extends from base 687 to base 875. 
TCCTCGGAAACGTTTAGAACAACTGCCGCATCACATTCAAACGAGTACGTCGTATCAATT 
TGGAAACTGGACATCTCTAGCACAAAGACATCTGGCATTTTGCGCGCACGCCTTTCAATT 
TGCTCTAAAACCTCTAACACAGGAACCCCAATGTTACCAACTGCCACAGCATCAAGACCA 
CATTCCTGA >Translation of ORF number 2 in reading frame 3 on the direct strand. 
SSETFRTTAASHSNEYVVSIWKLDISSTKTSGILRARLSICSKTSNTGTPMLPTATASRP 
HS* 

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

ORF Finder results
Results for 917 residue sequence "GOS_916040 Genomic DNA (North American East Coast: Newport Harbor, RI)" starting "AGACAATTTC"

No ORFs were found in reading frame 1. 
>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 916. 
AATGGCAAAAGTACCGTCACTAGGATGGTTGAGCGAATTCTTCAGGAATGTGGTCTTGAT 
GCTGTGGCAGTTGGTAACATTGGGGTTCCTGTGTTAGAGGTTTTAGAGCAAATTGAAAGG 
CGTGCGCGCAAAATGCCAGATGTCTTTGTGCTAGAGATGTCCAGTTTCCAAATTGATACG 
ACGTACTCGTTTGAATGTGATGCGGCAGTTGTTCTAAACGTTTCCGAGGATCATCTAGAT 
CGTTATCGTGATTTTGATGCTTATTTAAGATCGAAATGTCGTATTCATTCTGGTCGAGGT 
ATAAAGGTGGTTAACCGAGACGAACCAATTGTCTTGAATGAGATAGCCGGGGAAGATAGC 
GTTTCATTCGGGTTGAGTCCTCCAGATAACGATCGATCTTGGGGGGTTAGTAAGATTGCA 
GGAGAGCAGTGGGTAGCTTGTGGCTCGCAACAAATTTTTAGATGCGAGGACTTAAGGGTT 
TCTGGAATGCATAACGTGTGTAATGCAATGGCAGCACTCGCTTTATCAAGCACACTGGTA 
AGCGTTAATGAGGACGCAATAAGAGGGCTGCTTTCTTACGAAGGATTGGATCATCGTATG 
CAGTGGGTCGCAGATATATCTGGGGTTCAATTTTATAATGATTCTAAAGCTACAAATGTG 
GGTGCGACAGCGGCGGCAATTTCTGGGTTACCAGCAAAATGCGTTTTGTTATTAGGCGGC 
GAGTCTAAGCAACAAAACTTTGAGATCCTAGTGGACTATATCCGTGAAAAAGTACGGGTA 
GTAGTTTTGATGGGGCGGGATGCTAAATTAATTAAGCGCGGGATTGAGGGCGCTGGTGTA 
GATATATTAGATGCCGCAGACTTGATTAATGCGGTTCAAATCGCTGCGCAACTTGCTGAA 
CCTGGGGAAATTGTC 
>Translation of ORF number 1 in reading frame 2 on the reverse strand. 
NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT 
TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEIAGEDS 
VSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTLV 
SVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLGG 
ESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLAE 
PGEIV 
No ORFs were found in reading frame 3. 

Multiple Alignement

PROTOCOL

Blastp vs nr protein sequences, default NCBI parameters except "max target sequences" set to 1000.

Muscle 3.7 default parameters

Gblocks 0.91b default parameters


INPUT sequences:


REFERENCE

>GOS_916040 Translation [2-916 indirect strand]

NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDTTYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRG

IKVVNRDEPIVLNEIAGEDSVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTLVSVNEDAIRGLLSYEGLDHRM

QWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLAE

PGEIV



b-proteobacteria



>gi|91776623|ref|YP_546379.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacillus flagellatus KT]

MLQLKDKQVLVLGLGDTGLSALRWLARQGARLSVADSRALPPGLDAVRQEFPGMAIHLGPFTAAAFKEAE

LIVASPGVPVAEPQVQAAIERGVPVVGDVELFAQARSAHAKVIAITGANGKSTVTTLVGEICKAAGFKTV

VAGNIGLPVLDVINDAVDVYVLELSSFQLETTYSLAADAATVLNISADHMDRYADMQAYANAKARIFTRA

GLQVLNADDAWSRGMAAEGVAQLTFGLDAPRSAQDFGLLHDAGEAWLARGQRKLMPVADLNITGLHNAAN

ALAALALCTVLDIDEVVALQALRDFKGLPHRVQWVADIDGVSFYDDSKGTNVGATVAALHGLNRKLVLIA

GGDGKGQDFAALRAPVAKHARAVVLIGRDAGVIADALQESGVLLEYGDTLEEAVVKAFNLADRGDAVLLS

PACASLDMFRNYVHRAEVFVKAVTDLQKKEVSA


>gi|224826076|ref|ZP_03699179.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella nitroferrum 2002]

MRFANRHIVVVGLGDTGLSAARWLAAHGATVTVADSRDNPPNAATLAESLPGVALKTGAFDATTFAGAEM

LVVSPGVAVATPAIAAFRRAGGEVVGDVELFARAIAGSGSKVIAITGSNGKSTVTSLVGHLCRQAGLDTV

LAGNIGLPVLDALGEREASGKRPDVWVLELSSFQLETTTSLNADAATVLNISEDHLDRYADLLDYAHSKT

AVFNGRGVQVLNRDDALVRAMVRPGHAQRWFSLKETADYALRQDAGRYWLTVAGEAVFDCAEMSLQGLHN

AANALAALALTEAIGLPRAALLEGLKTFTGLAHRVEFVAEVHGVRYIDDSKGTNVGATEAALNGMTRPVV

LIAGGDGKGQDFSPLKPACARIARAVLLIGRDAGKIRAVLEGLPLPIVDCATLEEATREAARLAEAGDVV

LLSPACASLDMFKNYAHRAQVFIDGVRALQAGNAA


>gi|82703611|ref|YP_413177.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosospira multiformis ATCC 25196]

MNLQGRTVLVLGLGETGLSMAKWLFRRGALVRAADTRNEPPAMRAFNSLLPQAEVFTGSLAGRAFYGVDL

IAISPGLPLSEPLVQQALKEGIPVVGDMELFACAVGGTGGGMPKLVGITGSNGKTTVTAMTGAMLKKAGW

DVEVAGNIGPAVLDALMRREDTGKMPQAWVLELSSFQLETTKSLGLDAAAVLNVSEDHLDRYAGMQEYAA

AKARIFLGDSEGVQILNGDDPVVRQMTLAGRPHVTFSLATPQSADDFGLLREGGDTWLMQGDTRLMDARE

LAITGRHNCANALAALALCRALAVPFEPLLQALREFRGLPHRVEKVAAFSGITFYDDSKGTNVGATVAAL

KGLGQPVVLIAGGDGKAQNFSPLAAPIGEHGRAVVLIGRDAEKIAVAINECGVPLHRAQTMEEAVRKSFQ

LAREGDAVLMSPACASFDMFDNYVHRAEAFVAAVRSMQAARAGGNSAGVAGRH


>gi|74316135|ref|YP_313875.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thiobacillus denitrificans ATCC 25259]

MNYDALQLSGRKVLVLGLGDTGLSCARWLSVHGADVSVADSREAPPHAARLAETLPQVALFTGPFEAAHL

AAADMLVLSPGVPLSEPAVAQAVAQGVEAVGDVELFARALAVLNAQRAALPAPQAAMRVIAITGSNGKST

VTAMCGDMCRMAGLTVCVAGNIGLPVLDALHEIEQGAAPLPQVWVLELSSFQLETTSSLDATAAAVLNLS

EDHMDRYPDMAAYAAAKARIFSGNGVQVLNRDDPRTLAMAIPGRHVVSFGLDRCPTDENFGLCEDELCLG

GDMLMPLSVLAVPGLHNAANALAALALTRALDLPIEALLRGLMHFKGLPHRVEKVADIDGVTWYDDSKGT

NVGATEAALYGMGRRKAVVILGGDGKGQDFGPLKAAVAANARAVVLIGRDAVAIEAAIEDSGVASYRADT

LPDAVEQAARLAEPGDAVLLSPACASFDMFRNYVHRAEVFVDAVKKLAAQRAQV


>gi|121606308|ref|YP_983637.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Polaromonas naphthalenivorans CJ2]

MKNLAHQNILVLGLGASGLALARWCVRCGAHVTVADTRSAPPQLASLQDSVPAAKFVTSPMDGALLAGTA

FDLVLKSPGLSPASISGVLAAAQAQGIPCGNELSLFAQALADLKEDLAYAPKVVGITGTNGKTTVTSLTG

QLIERAGKSVAVAGNIGPTLLDTLTGKLDEHARDPSAALPEFWVLELSSFQLDGVTNFEPDVATVLNITQ

DHLDWHETLPAYAAAKSHVYGRSGLMLLNRNDPLVMTAVPALVKGKPGRSYLTFGGDEPKRPGDYGIETV

NGMAWLVRAAEADETIKRRKAEELVLHIQRLMPLEALRIQGRHNATNALAALGLAVAVGCPLAPMLHGLR

EYRGEPHRVESVAVLEGIEYFDDSKGTNVGATVAALAGLGSERKLVLILGGEGKGQDFSPLADPVARYVR

VVVLIGRDAPLIRAALQGSRVELLDAASMQEAVSLAAGQARPGDAVLMSPACASFDMFDNYEHRARVFCE

AVQELAVEQGAVL


>gi|30248992|ref|NP_841062.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Nitrosomonas europaea ATCC 19718]

MNYTGKKILVLGMGKTGISMVKWLSRLGAQLSVADTRTSPPNLELISRIVPGEAIFCGPLKEELFQGIDA

IAISPGVAVAEPLVQAALQQGVPVIGDIELFAVALDQYAPPGTKILAITGSNGKTTVTSMVGEMVKNAGW

DVEVAGNIGPAALDALMQRMDANKWPHLWALELSSFQLETTSSLRPDAATVLNLSEDHLDRYDSIEEYAA

AKARIFSRPHNNGCVQILNRDDARVYAMADKNSKQVTFGLSAPVSDEEFGLLPGGSDVWLAQGSTHLLKT

SELAVAGLHNAANALAALALCRAVDLPFEPLLHALRTFRGLPHRMQKVAEFNGVTFYDDSKSTNIGSAVA

ALNGFRKNVILIAGGDGKGQDFSPLEQPVSKHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQVS

FLLAEHGDVVLLSPACASLDMFNNYIHRAEVFTAAVRLIERKFVLTAQTCH



>gi|60390554|sp|Q82VS5.1|MURD_NITEU RecName: Full_UDP-N-acetylmuramoylalanine--D-glutamate ligase; AltName: Full_UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; AltName: Full_D-glutamic acid-adding enzyme

MNYTGKKILVLGMGKTGISMVKWLSRLGAQLSVADTRTSPPNLELISRIVPGEAIFCGPLKEELFQGIDA

IAISPGVAVAEPLVQAALQQGVPVIGDIELFAVALDQYAPPGTKILAITGSNGKTTVTSMVGEMVKNAGW

DVEVAGNIGPAALDALMQRMDANKWPHLWALELSSFQLETTSSLRPDAATVLNLSEDHLDRYDSIEEYAA

AKARIFSRPHNNGCVQILNRDDARVYAMADKNSKQVTFGLSAPVSDEEFGLLPGGSDVWLAQGSTHLLKT

SELAVAGLHNAANALAALALCRAVDLPFEPLLHALRTFRGLPHRMQKVAEFNGVTFYDDSKSTNIGSAVA

ALNGFRKNVILIAGGDGKGQDFSPLEQPVSKHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQVS

FLLAEHGDVVLLSPACASLDMFNNYIHRAEVFTAAVRLIERKFVLTAQTCH


>gi|225372572|ref|ZP_03749793.1| hypothetical protein NEISUBOT_00845 [Neisseria subflava NJ9703]

MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLKDALDNGFDI

LALSPGISERQPDIEAFKQNGGRVLGDIELLAGIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV

IAGNIGTPVLEAELQREGKKADMWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKI

FRGDGVQVLNADDAFCRAMKRAGREVKWFSLEHKADFWLERETGCLKQGNEDLIATQDIPLQGLHNAANV

MAAIALCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG

GMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMIDCATLEEAVQKAYAQAEAGDIVLLSP

ACASFDMFKGYAHRSEVFIEVFKAL


>gi|226941971|ref|YP_002797045.1| MurD [Laribacter hongkongensis HLHK9]

MYADLGFANKTVCVVGLGGSGLAAARFLAPRVGRLVVADSREVPPNAGQLAGVAAGAELRAGAFSAATFA

GCDVLVLSPGVPLATPAVAAFAGEVIGDVEVFARAIAPLAIPVIAITGSNGKTTVTSLAGHLVAACGRRG

VVAGNIGLAVLDALADIEASGELPECFVLELSSFQLETTTSLNAIAATTLNISEDHLDRYRDLLAYADSK

AAVFNGGGVQVLNRDDLFVRAMARPQRRHVWFSLEDAGADYALAERDGRHWLCAGGEALLPFDAMQLVGL

HNAANALAALALCEAAGLPRAGLLAGLTTFKGLAHRVEHVLTHEGVDFIDDSKGTNVGATEAALKGMTRP

VVLIAGGDGKGQDFSPLAPALARIGRAVLLIGRDAPVVRQALAGLALPLIDCATLEEATRRGFELAQPGD

VVLLSPACASFDMFRGYAHRAEVFIACARELAGVQP



>gi|218768812|ref|YP_002343324.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neisseria meningitidis Z2491]

MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLKDALSNGFDI

LALSPGISERQPDIEAFKRNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV

IAGNIGAPVLEAELQREGKKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKI

FRGDGVQVLNADDAFCRAMKRAGREVKWFSLEYEADFWLERETGRLKQGNEDLIATQDIPLQGLHNATNV

MAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG

GMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQKAYAQAEAGDIVLLSP

ACASFDMFKGYAHRSEVFIGAFKAL



>gi|119897173|ref|YP_932386.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Azoarcus sp. BH72]

MTQPSFSSSLAGRHVLVLGLGESGLAIARWCARCGARLRVADSRTTPPGLEALRAAAPQAEVITGSFGDE

VLEGIDVVAVSPGLDPRVGVIASARRRCLPITGEMALFAQALTDLGARDATRILAITGTNGKTTTTALTA

ALAQSAGLDAVAAGNISPAALDVLMARLDAGQALPQCWVLELSSFQIETAQALDADAATVLNVTDDHLDR

YADLADYAATKARIFQGRGAQVLNREDARVAAMVLSGRKVVRFGTDAPQNPADYGLVEDAGRCWLVRGGE

RLLALDELALAGRHNAANALAALALCETGLGLAPAQLLAGLRAFRGLPHRVELVAERADGVRYYDDSKGT

NVGATVAALDGLGGRVVLIAGGDGKGQDFSPLAPVLTRHARAVVLIGRDAKLIEAAVAGCGVPLEHAADL

DTAVLRANALARPGDAVMLSPACASLDMFRNYAHRAEVFIAAVRRLPEVSPR



>gi|225023739|ref|ZP_03712931.1| hypothetical protein EIKCOROL_00603 [Eikenella corrodens ATCC 23834]

MEKRMKSEWQNQKILVAGMGGSGISMLDFLSRQGAAVAAYDADFPAAKQAELQQRFPGLACHTGYLKNAL

AEGFDILALSPGVSERTPEIEAFKQAGGRVLGDVEILAHELSGKRNKIIAITGSNGKTTVTSLVGHLCRE

CGLDTVVAGNIGTPVLEAYEDRQEQSADVWVLELSSFQLENTDHLNAAAAAVLNISEDHLNRYDDLLDYA

HAKDKIFRGSGVQVINADDALCRAMKRSGREVRRFSLQQETDYWFDAASGYLKHGAETLIAAADIPLQGL

HNAANVLAALALCEAIGLPREQLLRHVRTFKGLPHRVEKIGEKNGVVFIDDSKGTNVGATEAAIAGLQSP

LFLIAGGQGKGQDFTPLKNVLPGKARAVLLIGEDAPQIRRDLAGCGVEMMDCASLQEAVQTAYRLAEPGD

IVLLSPACASFDMFKGYAHRSQVFIEAFEAL


>gi|114330275|ref|YP_746497.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosomonas eutropha C91]

MNYADKKILVLGMGKTGISMVKWLSRAGARVSVADTRTTPPNLELLSQIVPLETIFCGPFKAELFKDIDA

IAISPGVAIAEPLVQAALQQGVSVIGDIELFAIALDQHAPPGTKILAITGSNGKTTVATMVGEMARNTGW

DVEVAGNIGLAALDALMQRIDTGKWPHLWVLELSSFQLETTSSLRPNAAVVLNLSEDHLDRYRIIEEYAA

AKARIFPDPHNSCVQVLNREDARVYAMAHENSKQLTFGLSAPAFDDEFGVLPSGSDLWLAQGTTRLMKVS

ELAVAGLHNAANALAALALCRAIDLPFEPLLHALHIFKGLPHRMQKIAEFNGVTFYDDSKSTNVGSAVAA

LNGFRKNVILIAGGDGKGQDFSPLEQPVSKHTRGVVLLGRDAEKISQAIQGCNVPVHRVATMDEAVRVSF

LLAERGDSVLLSPACASLDMFNNYIHRAEVFTTAVQGIEHKFILTAQTCH



>gi|161870654|ref|YP_001599827.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neisseria meningitidis 053442]

MTFQNKKILVAGLGGTGISMIAYLRKNGVEVAAYDAELKPERVAQIGKMFDGLVFYTGRLKDALDNGFDI

LALSPGISERQPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV

IAGNIGTPVLEAEWQREGKKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKDKI

FRGDGVQVLNADDAFCRAMKRAGREVKWFSLEYEADFWLERETGRLKQGNEDLIATQDIPLQGLHNATNV

MAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG

GMGKGQDFTPLRDALAGKAKGVFLIGVDALQIRRDLDGCDLNMTDCATLEEAVQKAYAQAEAGDIVLLSP

ACASFDMFKGYAHRSEVFIGAFKAL


>gi|34499800|ref|NP_904015.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Chromobacterium violaceum ATCC 12472]

MDYANRHVTVVGLGGSGLAAARYLAAHGARVRVADANPSAERLAELERCLPGVEVMVGAFDDATFAGAEL

LVVSPGVPLANPAIAAFRRAGGEVVGDIEILARAIQGDGSKVIAITGSNGKSTVTSLVGHLCEAAGLDTV

VAGNIGLAVLEALLAREQSGKRPDVWVLELSSFQLESTFSLAADAATVLNISEDHLDRYADLLDYAHAKT

RVFNGKGVQVLNKDDALVRAMVRPGHPVKWFSLNGAADYALARNGGYWLKVDGEKVFDCADMQLQGLHNA

ANALAALGLCQGIGLPLEKLLDGLKTFRGLAHRVELVDEFDGIAFIDDSKGTNVGATEAALNGMTRQVVL

IAGGDGKGQDFAPLKPACQRIARAVLLIGRDAGRIEAALEDSGLALERCDTLEEATRRAAALARPGDVVL

LSPACASLDMFKNYAHRAQVFIDTVAAVKAARA



>gi|152980553|ref|YP_001354707.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Janthinobacterium sp. Marseille]

MNYAGKHVLVLGLGESGLAMAQWLVHCGASLRVADTREQPDRLPQLRGIAPQAEFVGGPFDASLLDGVDF

VAVSPGLMPARELAEIIPAAAEKEIPVWGEIELFAQALAALKEDKGYAPKVIAITGTNGKTTVTSLVGLL

CQRAGLTVQVAGNISPAALDKLHQVLTDDQLPQVWVLELSSFQLHTTYSLQADVATVLNLTQDHLDWHGD

MAAYADDKARIFGSNTIRVLNRDDALVMQMSSPLSKVITFGADEAEQADCFGLVDENGMRWLSVAVEEEE

PQKKRRKKDNVELAVSTNKLMPVDALKIRGQHNAINALSALALCRAIGLPFAQLLHGLRDYHGEPHRVEH

VMTIGGVDYYDDSKGTNVGATVAALNGLGASQDGASNHLVLIAGGDGKGQDFSPLADPVAKYARAVILIG

KDADNIRAALQATGVDMINCTTLEEATQKAAELAQSGDAVLLSPACASLDMFKNYAHRAQVFVDEVREIG

LSRGEVSA



>gi|73542665|ref|YP_297185.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ralstonia eutropha JMP134]

MFGELQKPHVLVLGLGESGLAMARWCGLNGCAVRVADTREAPANLVFLQAELMSAEFVGGPFAESLLDGI

GLVAISPGLSPLEANTGELLAAARQRGIPVWGEIELFARALAHLQAESGYAPKVLAITGTNGKTTTTALT

GRLVERAGKSVAVAGNISPSALDKLSACIASATLPDVWVLELSSFQLETTHTLAPHAATVLNVTQDHLDW

HGSMEAYAASKARIFGPAGTACVQVLNRNDRLTMDMARPGTAPVTFGTDLPETPGSFGVLREGGMPWLVL

AEPDSEAEGEGKPRRRKADATAQEAVPVRHKRLMPADALHIRGMHNATNAMAALALCRAIDLPLNALLHG

LREYRGEPHRVEWVATIDEVEYFDDSKGTNVGATVAALSGLDKRVVLIAGGEGKGQDFSPLAAPVAQYAR

AVVLIGRAAGELRDALQGSGASLVDAATLEEAVNKAAELAEGGDVVLLSPACASLDMFRNYVHRAEVFRS

AVEELALSRGIMP



>gi|225364676|ref|ZP_03744534.1| hypothetical protein NEICINOT_00641 [Neisseria cinerea ATCC 14685]

MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLKDALDNGFDI

LALSPGISERQPDIEAFKQNGGCVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV

IAGNIGTPVLEAELQREGKKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKI

FRGDGVQVLNADDAFCRAMKRAGREVKWFSLEHEADFWLERETGCLKQGDEDLIATQDIPLQGLHNAANV

MAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG

GMGKGQDFTPLRDALKDKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEAVQTAYTQAEAGDIVLLSP

ACASFDMFKGYAHRSEVFIEAFKAL



>gi|194290815|ref|YP_002006722.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cupriavidus taiwanensis]

MRRGFIVTGNQGQEIEVFGELQKPHVLVLGLGESGLAMARWCGLNGCAVRVADTREAPANLVFLQAELTS

AEFVGGPFAEGLLDGIGLVAISPGLSPLEAATGALLAAAQARGIPVWGEIELFVRALRHLEAESGYAPKL

LAITGTNGKTTTTALTGRLVERAGKSVAVAGNISPSALDKLSACIASASLPEVWVLELSSFQLETTHTLA

PHAATVLNVTQDHLDWHGSMEAYAASKARIFGPAGHACVQVLNRNDRLTLDMARPGSTPVTFGIDLPEVP

GSFGILREGGMPWLVLAEPDPDAEGEGKPRGRKAAEAVQEAVPVRHKRLMPADALHIRGMHNATNAMAAL

ALCRAIDLPMNALLHGLREYRGEPHRVEWVATIDDVEYFDDSKGTNVGATVAALSGLDKRVVLIAGGEGK

GQDFSPLAAPVAQYARAVVLIGRAAAELRDALQGSGATLVDAATLEEAVTQAAGLAEAGDAVLLSPACAS

LDMFRNYVHRAEVFRGAVEELALSRGILP


>gi|226727514|ref|YP_002792437.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Neisseria gonorrhoeae 1291]

MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGKMFDGLVFYTGRLKDALDNGFDI

LALSPGISERQSDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV

IAGNIGTPVLEAELQREGKKADVWVLELSSFQLENTESLRPTAATVMNISEDHLDRYDDLLDYAHTKAKI

FRGDGVQVLNADDVFCRAMKRAGREVKRFSLEHEADFWLERGTGCLKQGNEDLISTQDIPLQGLHNAANV

MAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG

GMGKGQDFTPLRDALKDKAKGVFLIGVDAPQIRRDLDGCGLNLTDCVTLEEAVQTAYAQAEAGDIVLLSP

ACASFDMFKGYAHRSEVFIEAFKAL



GAMMAPROTEOBACTERIA


>gi|114321344|ref|YP_743027.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alkalilimnicola ehrlichei MLHE-1]

MQAVKRQAGYRAVVGLGRTGLACVRFLAARGLDVCVTDSRDEPPEQATLQREWPQVPVRAGGFDAALLAG

AGEIIVSPGVSLREPALETARRAGVPLIGEIELFARHADAPVAAITGSNGKSTVTTLVGRMAEAAGRRVA

VGGNLGTPALALLDGETRPDAYILELSSFQLETTHSLAPRVAAVLNISADHMDRHGSVSAYAGIKARIFH

GAGVQVLNLDDPVVAAMAQPGRTVLGFSLASNPRRGAGVADHRGAPWLHLNGEPVLPAADLRLPGLHNRA

NALAALCLGQGLGLPVAAMAEALRRFTGLPHRTEWVAEHAGVRWYNDSKGTNVGAAVAAIRGLAGPVVLI

AGGDGKGADFLPLADALREKGRAAVLIGRDAPRLAQVLSGVVPVERAADMRDAVRRAANLARSGDAVLLS

PACASFDMFRGFEHRGEAFRDAVREVAHG


>gi|226711953|sp|A3M1C6.2|MURD_ACIBT RecName: Full_UDP-N-acetylmuramoylalanine--D-glutamate ligase; AltName: Full_UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; AltName: Full_D-glutamic acid-adding enzyme

MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELLLQAEEII

LSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNL

GRPALDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVF

NRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLACGLQRLIKSSDLYIQGMHNVANALACL

ALGEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVAL

ILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQAEDVVLL

SPACASFDMFKSYNDRGQQFVACVNSLV


>gi|169634628|ref|YP_001708364.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobacter baumannii SDF]

MINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELL

LQAEEIILSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKK

VAVGGNLGRPALDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQ

GAKKVVFNRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNV

ANALACLALGEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIEV

KKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQ

AEDVVLLSPACASFDMFKSYNDRGQQFVACVNSLV



>gi|184156588|ref|YP_001844927.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobacter baumannii ACICU]

MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELLLQAEEII

LSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNL

GRPALDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVF

NRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNVANALACL

ALGEAIGLPMESMLETLKRFKGLEHRCEYVKTVRDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVAL

ILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQAEDVVLL

SPACASFDMFKSYNDRGQQFVACVNSLV


>gi|213155698|ref|YP_002317743.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acinetobacter baumannii AB0057]

MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELLLQAEEII

LSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNL

GRPALDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVF

NRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNVANALACL

ALGEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVAL

ILGGQGKGQDFGPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQAEDVVLL

SPACASFDMFKSYNDRGQQFVACVNSLV



>gi|215484924|ref|YP_002327163.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acinetobacter baumannii AB307-0294]

MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELLLQAEEII

LSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNL

GRPALDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVF

NRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNVANALACL

ALGEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVAL

ILGGQGKGQDFGPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQAEDVVLL

SPACASFDMFKSYNDRGQQFVACVNSLV



>gi|169797488|ref|YP_001715281.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobacter baumannii AYE]

MINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELL

LQAEEIILSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKK

VAVGGNLGRPALDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQ

GAKKVVFNRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNV

ANALACLALGEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIEV

KKGKVALILGGQGKGQDFGPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQ

AEDVVLLSPACASFDMFKSYNDRGQQFVACVNSLV



>gi|226951755|ref|ZP_03822219.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobacter sp. ATCC 27244]

MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRETPPGHDQIPENIKKSFGKLDLDLLLQAEEII

LSPGLAPQLPEIQQALEKGIPVISDIQLLRRATDVPIVAITGSNAKSTVTTLFGLMAKDAGKKVAVGGNL

GRPALDLLKDQPELIVLELSSFQLETTSHLNAEVAVLLNMSEDHLDRHGDMLGYHKAKHRIFQGVKKVVY

NRDDSLSRPLVPDVTPMQSFGLNAPDMNQYGVLREADGSMWLARGRERLIKTSDLYIQGMHNVANALACL

ALGEAIGLPTQSMLETLQQFKGLEHRCEYVQTVDQVRYYNDSKGTNVGATLAAIEGLGAAIEAKHGKLAL

ILGGQGKGQDFKPLRNAIQKYVKTVILIGEDAAMIEQALHNTTQIQHASSLKQAVDIAHQATQAEDVVLL

SPACASFDMFKSYNDRGHQFVACVHALNGNKN



>gi|160872723|ref|ZP_02062855.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsiella grylli]

MILGLGKTGLSCARHLKRFNLPFIIFDNRLNPPKLSHFKKEFPDVGCYLGSLKPNLFKRCTKLIVSPGID

LNETTIRTIIEQHTLKPLGDIELFAQHARAPIIAITGSNAKGTVTSLIGKMIQRAHLNVAVGGNIGKPAL

DLLNEPVPDFYVLEISSFQLETTYSLRPKLASILNISPDHLDRHKTLTAYINAKQRIYHQADIALWNRDD

LNTFPQARTKKIISFGLTTTTPHAHEFYLYNSHQKNFIAKGHDRLLPVDALFIQGRHNWANAIAALTIGH

AIGLPTKAMLTALCEFKGLPHRCQWVKEFKGVTWYNDSKATNVGATLAALNGLGPSISGKIILIAGGLSK

NADFSLLHNPVKHYVKKIILIGRDAALLKNTLEKSTAIQTVSDLRHAVNLAHETARRGDIVLLSPACASL

DMFKNYEERGDVFMRLARGIH



>gi|62900496|sp|Q604V5.1|MURD_METCA RecName: Full_UDP-N-acetylmuramoylalanine--D-glutamate ligase; AltName: Full_UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; AltName: Full_D-glutamic acid-adding enzyme

MHDRLIDENPTCGFVRLGLDVRSRVIVLGLGATGLSTVRFLRCHGFECAVMDSRLAPPGLQDLREAFPDV

PLFLGDFSRSALAAATHLVVSPGLSLDLAEIRESHRCGVRVFGDLDLFACCVRAPVVAITGANGKSTVTT

LVGLMAKAAGVNAAVGGNLGTPMLDLLDAAAELYVLELSSFQLERSELFEADVATVLNISPDHMDRYPDL

ASYAEAKRRVFRGEGLMVLNQDDPLVAAMYRPGRRAVRFGLGSGDELDYSLARWEGRAWLLAKGVPLLPA

DEVRIKGRHNLANALAAVAIADACGFDRQAMVGVLRTFPGLDHRMQWVADIGGVAYVNDSKATNVGACIA

ALSGLEGKVVLIAGGDGKGADFSSLVPVAAEKLRAAVLMGRDGPLIDEVLKGVVPTIRVKTMFEAVRAAR

GVAQSGDTVLLAPACASLDQYEDYQERGRDFAATVRSLA



DELTAPROTEOBACTERIA


>gi|162449933|ref|YP_001612300.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Sorangium cellulosum 'So ce 56']

MMDVRGRTVIVVGLGRSGVAAARLLNARGARVIANDGAPRERLSAAAAALEGEGVVLAPGGHDPALFDGA

DLVVVSPGVPSFPALDAVARSGREVIGELELASRFVSAPVVLVGGTNGKSTTTALTGAMLERAGLRTFVG

GNFGTPLAEVVDQTWDVLVLEISSFQAERVPTLHARAHALLNITDDHLDRYASFAAYADAKGNPFERMTP

DDVAVVPFGDELVARQAARGRARVVTFSARDARADVSAAGGAIVDRVTGARYPLDRVRLAGAHNLANACA

SAALAAALGAPAAAIGDALSSFEGLAHRTALVADVDGVRYYDDSKGTNVGASVAALSGLLEAKAVLIAGG

RDKLGDYAPLVSALRERGRALVVLGEAADRIAAAAAGVLPIARAGSMAEAVLAARSLARPGDAVLLSPAC

SSFDMFRDYKDRGDAFVRAVRELQGAAGGAAGEVAS


>gi|51246751|ref|YP_066635.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Desulfotalea psychrophila LSv54]

MLKKNPYIDAHTTFAIIGLGVSGKAALRYALGFGAHLLVSDRRDEEALLAQLVALAGDVVVDYEAGGHTF

QFLSQADVIFVSPGFADGELLARLRRAGVQVLGELALAAPVLDRPVVAITGTNGKTTVTSLVGDLLRASG

KRVFVGGNIGVPLLDLLSSGDEVDVIVLEVSSFQLELAGDFSPHIALLLNLSPDHLDRHGDLAGYRAAKM

HLFQKQGMTDIAIVSGDDPLCLLSDGCGEASRYLFGFSAASDISVAAGHFEFDFAGQREIYSLRDSALDN

RTGWLNAAPAAFIARSLACAKADIERGIAAFTLDAHRMEPVASIAGVQYYNDSKATNTGAVISALQQLVR

VILIAGGRDKGDNYRLLREAVAGHVRTLICIGEATPLLVAALEDVVQVYRATSLAEAVSLAASFAEEGDS

VLLSPACASFDMFANYQDRGEQFRRQVLQLQDVGSK



>gi|62900515|sp|Q6AJ52.1|MURD_DESPS RecName: Full_UDP-N-acetylmuramoylalanine--D-glutamate ligase; AltName: Full_UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; AltName: Full_D-glutamic acid-adding enzyme

MLKKNPYIDAHTTFAIIGLGVSGKAALRYALGFGAHLLVSDRRDEEALLAQLVALAGDVVVDYEAGGHTF

QFLSQADVIFVSPGFADGELLARLRRAGVQVLGELALAAPVLDRPVVAITGTNGKTTVTSLVGDLLRASG

KRVFVGGNIGVPLLDLLSSGDEVDVIVLEVSSFQLELAGDFSPHIALLLNLSPDHLDRHGDLAGYRAAKM

HLFQKQGMTDIAIVSGDDPLCLLSDGCGEASRYLFGFSAASDISVAAGHFEFDFAGQREIYSLRDSALDN

RTGWLNAAPAAFIARSLACAKADIERGIAAFTLDAHRMEPVASIAGVQYYNDSKATNTGAVISALQQLVR

VILIAGGRDKGDNYRLLREAVAGHVRTLICIGEATPLLVAALEDVVQVYRATSLAEAVSLAASFAEEGDS

VLLSPACASFDMFANYQDRGEQFRRQVLQLQDVGSK


>gi|222053879|ref|YP_002536241.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacter sp. FRC-32]

MEIKGKKILVVGLARTGVAVARFLASRGAKVTVTDMKEESELADYLLQLEDLDLNLELGRHDKHTFLMSD

LIVVSPGVPMDISPLLMAKAQRRVVISEIELAAAFIKAPMVAITGTNGKTTTTTLAGEIFKACGVETFVG

GNIGNPLIELVTSGNDVAQVVVELSSFQLEGIQRFRPKVAVLLNITEDHLDRYASYQDYIDAKLRIFENQ

TVDDFAVLNVDDPLVAACAATVKSRVFPFSQRKELAEGIFCSKGIIVYRWQGSELRFDTAAFKLKGVHNI

ENIMAALASTLLSGADPIKAGRAVESFKGLRHRMEFIREVGGVAYYEDSKGTNVGSVVKSLESFDKGITL

IAGGKDKGGSYAPLADLVRERVKHLILIGEAKERIEAELGNLTDTHKAATLEDAVAIAHRLAKAGEVVLF

SPACSSFDMFKDYAERAERFNAAVRALAGGDCR


>gi|94269090|ref|ZP_01291365.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [delta proteobacterium MLMS-1]

MGNGPRTDIPPFKAGDHVLVVGLGKSGVAAARFLLSLGLRVSVSEGGRAVAPATEAVNWLQQRGVYCELD

GHSPELFAAVDAIVVSPGVPLDIPALKEAARAGVPIIGELALAPAYLHTPVIAVTGTNGKSTVTTLIGEL

LQAAGYKTFVGGNLGVPLAQYLAGPQEADWVVLEVSSFQLDTAGAFRPQIGVLLNISPDHLDRYPDYQAY

AASKWRLFAHQRATDWAVLNGADPEIARLAVAAPPVARRLDFNCQPQPEGRATAIDDEITMTGGAWSAST

PAGARLLVNVYSLLKQPVTGPGERLPLPTPAAGADPIPPEVYEPGPELAVEPNLQNAQAAILAARLAGCS

SSAVVAGLRAFKSLPHRLALVASIAGVDYYDDSKATNIGAVVSALQGLAQPVILIAGGLDKGGDYKLLLP

VLKEKVRAVVLIGSARARMAAALEGSVPLTQAEDLPAAVAKAAELAAPGEAVLLSPACASFDMFSGYAQR

GEVFRQAVAELRKNLASGGGQSARGCPVMEAMVQ



>gi|77919798|ref|YP_357613.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pelobacter carbinolicus DSM 2380]

MAEYSGKHVVVVGAGCTGLGLARFFLDRGALVTLSDSRSREELVDVAELADHGLRFDCGGHDAALLAGAD

LIAISPGIPLTVPAVAGALQAGVPVQGEIEIAARELSAPMVAITGTNGKSTTTCLMGEIMRCWGRRAFVG

GNLGTPLIEATRSTDWDWIVAEISSFQLEAIDTFRPRYGMLLNLTADHLDRYAGMGEYVAAKLRLFENMT

AEDVAVVNADDALVVRSTTDLPCRKIPFSSSRVLDEGMGFDGQHIVWRHAGRQERFDVADLQLKGLHNVE

NVMAALIPPLMEGCPTDIAWKAVCGFSGLDHRMVLVREIDGVSWYDDSKGTNVGSVVKSLAGLQGPVTLI

AGGKDKGGDYAPLAGLIGEKVEHLILIGQAADRMQAAFQGMTTILRADSLEAAVQQAQQVTMAGGTVLLS

PGCSSFDMFRSYAERGEVFCRAVQALQGNG



>gi|62900554|sp|Q748D4.1|MURD_GEOSL RecName: Full_UDP-N-acetylmuramoylalanine--D-glutamate ligase; AltName: Full_UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; AltName: Full_D-glutamic acid-adding enzyme

MDLKGKNILVVGLARTGVAVARFLAAQGARVTVTDLRDEAALAGPLEQLAGHPVSYVLGRHDEADFAAAE

TVVVSPGVPQESPYLQAARRAGREVITEIELASRFITAPLVAITGTNGKTTTTTLTGELFAGCGFRTFVG

GNIGNPLIELVETGAAVDRVVVEISSFQLEWIRSFRPTVAVLLNITEDHLDRYATYQEYIDAKARIFKNQ

TASDWAVLNVDDPIVAGLAGRTCAAVFPMSRQRELGEGIFYRDGAIIFRHAGRQERFPTDRFRITGVHNI

ENIMASLAAALLLGCDADRALACVEAFGGLPHRMELVRELNGVRYFEDSKATNVGSVEKALASFNDITLI

AGGKDKGGSYAPLAGLVAERVRHMILIGEAKDRMARELGHLTDTRMAVTLEDAVELAASLTQPGGVVLFS

PACSSFDMFRDYEERAQRFRAAVDALSPGGTP



>gi|39998162|ref|NP_954113.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter sulfurreducens PCA]

MDLKGKNILVVGLARTGVAVARFLAAQGARVTVTDLRDEAALAGPLEQLAGHPVSYVLGRHDEADFAAAE

TVVVSPGVPQESPYLQAARRAGREVITEIELASRFITAPLVAITGTNGKTTTTTLTGELFAGCGFRTFVG

GNIGNPLIELVETGAAVDRVVVEISSFQLEWIRSFRPTVAVLLNITEDHLDRYATYQEYIDAKARIFKNQ

TASDWAVLNVDDPIVAGLAGRTCAAVFPMSRQRELGEGIFYRDGAIIFRHAGRQERFPTDRFRITGVHNI

ENIMASLAAALLLGCDADRALACVEAFGGLPHRMELVRELNGVRYFEDSKATNVGSVEKALASFNDITLI

AGGKDKGGSYAPLAGLVAERVRHMILIGEAKDRMARELGHLTDTRMAVTLEDAVELAASLTQPGGVVLFS

PACSSFDMFRDYEERAQRFRAAVDALSPGGTP




RESULTS ANALYSIS

RAW RESULTS

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|5124675      ------------MLKKNPYIDAHTTFAIIGLGVSGKAALRYALGFGAHLLVSD-RRDEEA
gi|6290051      ------------MLKKNPYIDAHTTFAIIGLGVSGKAALRYALGFGAHLLVSD-RRDEEA
gi|1624499      -----------------MMDVRGRTVIVVGLGRSGVAAARLLNARGARVIAND-GAPRER
gi|7791979      -----------------MAEYSGKHVVVVGAGCTGLGLARFFLDRGALVTLSD-SRSREE
gi|6290055      ------------------MDLKGKNILVVGLARTGVAVARFLAAQGARVTVTD-LRDEAA
gi|3999816      ------------------MDLKGKNILVVGLARTGVAVARFLAAQGARVTVTD-LRDEAA
gi|2220538      ------------------MEIKGKKILVVGLARTGVAVARFLASRGAKVTVTD-MKEESE
gi|9426909      --------MGNGPRTDIPPFKAGDHVLVVGLGKSGVAAARFLLSLGLRVSVSEGGRAVAP
gi|1608727      --------------------------MILGLGKTGLSCARHLKRFNLPFIIFD-NRLNPP
gi|2269517      -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRETPP
gi|1841565      -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|2267119      -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|2131556      -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|2154849      -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|1696346      ----------MINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|1697974      ----------MINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
REFERENCEG      ------------------------------------------------------------
gi|6290049      MHDRLIDENPTCGFVRLGLDVRSR-VIVLGLGATGLSTVRFLRCHGFECAVMD-SRLAPP
gi|1143213      ---------------MQAVKRQAGYRAVVGLGRTGLACVRFLAARGLDVCVTD-SRDEPP
gi|8270361      ------------------MNLQGRTVLVLGLGETGLSMAKWLFRRGALVRAAD-TRNEPP
gi|3024899      ------------------MNYTGKKILVLGMGKTGISMVKWLSRLGAQLSVAD-TRTSPP
gi|6039055      ------------------MNYTGKKILVLGMGKTGISMVKWLSRLGAQLSVAD-TRTSPP
gi|1143302      ------------------MNYADKKILVLGMGKTGISMVKWLSRAGARVSVAD-TRTTPP
gi|2250237      ------------MEKRMKSEWQNQKILVAGMGGSGISMLDFLSRQGAAVAAYD-ADFPAA
gi|2187688      ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKPE
gi|1618706      ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGVEVAAYD-AELKPE
gi|2267275      ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKAE
gi|2253725      ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKPE
gi|2253646      ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKPE
gi|9177662      -----------------MLQLKDKQVLVLGLGDTGLSALRWLARQGARLSVAD-SRALPP
gi|7431613      -------------MNYDALQLSGRKVLVLGLGDTGLSCARWLSVHGADVSVAD-SREAPP
gi|2269419      --------------MYADLGFANKTVCVVGLGGSGLAAARFLAPRVGRLVVAD-SREVPP
gi|2248260      ------------------MRFANRHIVVVGLGDTGLSAARWLAAHGATVTVAD-SRDNPP
gi|3449980      ------------------MDYANRHVTVVGLGGSGLAAARYLAAHGARVRVAD-ANPSAE
gi|1198971      -----------MTQPSFSSSLAGRHVLVLGLGESGLAIARWCARCGARLRVAD-SRTTPP
gi|1216063      -----------------MKNLAHQNILVLGLGASGLALARWCVRCGAHVTVAD-TRSAPP
gi|1529805      ------------------MNYAGKHVLVLGLGESGLAMAQWLVHCGASLRVAD-TREQPD
gi|7354266      ----------------MFGELQKPHVLVLGLGESGLAMARWCGLNGCAVRVAD-TREAPA
gi|1942908      MRRGFIVTGNQGQEIEVFGELQKPHVLVLGLGESGLAMARWCGLNGCAVRVAD-TREAPA
                                                                            

gi|5124675      LLAQLVALAGDVVVDYEAGGHTFQFLSQ--ADVIFVSPGFA-----DGELLARLRRA-GV
gi|6290051      LLAQLVALAGDVVVDYEAGGHTFQFLSQ--ADVIFVSPGFA-----DGELLARLRRA-GV
gi|1624499      LSAAAAALEGE-GVVLAPGGHDPALFDG--ADLVVVSPGVP-----SFPALDAVARS-GR
gi|7791979      LVDVAELADH--GLRFDCGGHDAALLAG--ADLIAISPGIPL----TVPAVAGALQA-GV
gi|6290055      LAGPLEQLAGH-PVSYVLGRHDEADFAA--AETVVVSPGVPQ----ESPYLQAARRA-GR
gi|3999816      LAGPLEQLAGH-PVSYVLGRHDEADFAA--AETVVVSPGVPQ----ESPYLQAARRA-GR
gi|2220538      LADYLLQLEDL-DLNLELGRHDKHTFLM--SDLIVVSPGVPM----DISPLLMAKAQ-RR
gi|9426909      ATEAVNWLQQR-GVYCELDGHSPELFAA--VDAIVVSPGVPL----DIPALKEAARA-GV
gi|1608727      KLSHFKKEFP--DVGCYLGSLKPNLFKR--CTKLIVSPGIDL----NETTIRTIIEQHTL
gi|2269517      GHDQIPE-----NIKKSFGKLDLDLLLQ--AEEIILSPGLAP----QLPEIQQALEK-GI
gi|1841565      GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|2267119      GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|2131556      GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|2154849      GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|1696346      GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|1697974      GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
REFERENCEG      ------------------------------------------------------------
gi|6290049      GLQDLREAFP--DVPLFLGDFSRSALAA--ATHLVVSPGLSL----DLAEIRESHRC-GV
gi|1143213      EQATLQREWP--QVPVRAGGFDAALLAG--AGEIIVSPGVSL----REPALETARRA-GV
gi|8270361      AMRAFNSLLP--QAEVFTGSLAGRAFYG--VDLIAISPGLPL----SEPLVQQALKE-GI
gi|3024899      NLELISRIVP--GEAIFCGPLKEELFQG--IDAIAISPGVAV----AEPLVQAALQQ-GV
gi|6039055      NLELISRIVP--GEAIFCGPLKEELFQG--IDAIAISPGVAV----AEPLVQAALQQ-GV
gi|1143302      NLELLSQIVP--LETIFCGPFKAELFKD--IDAIAISPGVAI----AEPLVQAALQQ-GV
gi|2250237      KQAELQQRFP--GLACHTGYLKNALAEG--FDILALSPGVSE----RTPEIEAFKQA-GG
gi|2187688      RVSQIGKMFD--GLVFYTGRLKDALSNG--FDILALSPGISE----RQPDIEAFKRN-GG
gi|1618706      RVAQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQPDIEAFKQN-GG
gi|2267275      RVAQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQSDIEAFKQN-GG
gi|2253725      RVSQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQPDIEAFKQN-GG
gi|2253646      RVSQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQPDIEAFKQN-GG
gi|9177662      GLDAVRQEFP--GMAIHLGPFTAAAFKE--AELIVASPGVPV----AEPQVQAAIER-GV
gi|7431613      HAARLAETLP--QVALFTGPFEAAHLAA--ADMLVLSPGVPL----SEPAVAQAVAQ-GV
gi|2269419      NAGQLAGVAA--GAELRAGAFSAATFAG--CDVLVLSPGVPL----ATPAVAAF----AG
gi|2248260      NAATLAESLP--GVALKTGAFDATTFAG--AEMLVVSPGVAV----ATPAIAAFRRA-GG
gi|3449980      RLAELERCLP--GVEVMVGAFDDATFAG--AELLVVSPGVPL----ANPAIAAFRRA-GG
gi|1198971      GLEALRAAAP--QAEVITGSFGDEVLEG--IDVVAVSPGLDP----RVGVIASARRR-CL
gi|1216063      QLASLQDSVP--AAKFVTSPMDGALLAGTAFDLVLKSPGLSP--ASISGVLAAAQAQ-GI
gi|1529805      RLPQLRGIAP--QAEFVGGPFDASLLDG--VDFVAVSPGLMP-ARELAEIIPAAAEK-EI
gi|7354266      NLVFLQAELM--SAEFVGGPFAESLLDG--IGLVAISPGLSPLEANTGELLAAARQR-GI
gi|1942908      NLVFLQAELT--SAEFVGGPFAEGLLDG--IGLVAISPGLSPLEAATGALLAAAQAR-GI
                                                                            

gi|5124675      QVLGELALAAPVLD---------------RPVVAITGTNGKTTVTSLVGDLLRASGKRVF
gi|6290051      QVLGELALAAPVLD---------------RPVVAITGTNGKTTVTSLVGDLLRASGKRVF
gi|1624499      EVIGELELASRFVS---------------APVVLVGGTNGKSTTTALTGAMLERAGLRTF
gi|7791979      PVQGEIEIAARELS---------------APMVAITGTNGKSTTTCLMGEIMRCWGRRAF
gi|6290055      EVITEIELASRFIT---------------APLVAITGTNGKTTTTTLTGELFAGCGFRTF
gi|3999816      EVITEIELASRFIT---------------APLVAITGTNGKTTTTTLTGELFAGCGFRTF
gi|2220538      VVISEIELAAAFIK---------------APMVAITGTNGKTTTTTLAGEIFKACGVETF
gi|9426909      PIIGELALAPAYLH---------------TPVIAVTGTNGKSTVTTLIGELLQAAGYKTF
gi|1608727      KPLGDIELFAQHAR---------------APIIAITGSNAKGTVTSLIGKMIQRAHLNVA
gi|2269517      PVISDIQLLRRATD---------------VPIVAITGSNAKSTVTTLFGLMAKDAGKKVA
gi|1841565      SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|2267119      SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|2131556      SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|2154849      SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|1696346      SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|1697974      SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
REFERENCEG      --------------------------------------NGKSTVTRMVERILQECGLDAV
gi|6290049      RVFGDLDLFACCVR---------------APVVAITGANGKSTVTTLVGLMAKAAGVNAA
gi|1143213      PLIGEIELFARHAD---------------APVAAITGSNGKSTVTTLVGRMAEAAGRRVA
gi|8270361      PVVGDMELFACAVG---GTG------GGMPKLVGITGSNGKTTVTAMTGAMLKKAGWDVE
gi|3024899      PVIGDIELFAVALD---QYA------PPGTKILAITGSNGKTTVTSMVGEMVKNAGWDVE
gi|6039055      PVIGDIELFAVALD---QYA------PPGTKILAITGSNGKTTVTSMVGEMVKNAGWDVE
gi|1143302      SVIGDIELFAIALD---QHA------PPGTKILAITGSNGKTTVATMVGEMARNTGWDVE
gi|2250237      RVLGDVEILAHELS------------GKRNKIIAITGSNGKTTVTSLVGHLCRECGLDTV
gi|2187688      RVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|1618706      RVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|2267275      RVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|2253725      RVLGDIELLAGIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|2253646      CVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|9177662      PVVGDVELFAQARS-------------AHAKVIAITGANGKSTVTTLVGEICKAAGFKTV
gi|7431613      EAVGDVELFARALAVLNAQRAALPAPQAAMRVIAITGSNGKSTVTAMCGDMCRMAGLTVC
gi|2269419      EVIGDVEVFARAIA------------PLAIPVIAITGSNGKTTVTSLAGHLVAACGRRGV
gi|2248260      EVVGDVELFARAIA------------GSGSKVIAITGSNGKSTVTSLVGHLCRQAGLDTV
gi|3449980      EVVGDIEILARAIQ------------GDGSKVIAITGSNGKSTVTSLVGHLCEAAGLDTV
gi|1198971      PITGEMALFAQALTDLGA--------RDATRILAITGTNGKTTTTALTAALAQSAGLDAV
gi|1216063      PCGNELSLFAQALADLKEDL------AYAPKVVGITGTNGKTTVTSLTGQLIERAGKSVA
gi|1529805      PVWGEIELFAQALAALKEDK------GYAPKVIAITGTNGKTTVTSLVGLLCQRAGLTVQ
gi|7354266      PVWGEIELFARALAHLQAES------GYAPKVLAITGTNGKTTTTALTGRLVERAGKSVA
gi|1942908      PVWGEIELFVRALRHLEAES------GYAPKLLAITGTNGKTTTTALTGRLVERAGKSVA
                                                      *.* *.: :   :         

gi|5124675      VGGNIGVPLLDLLS----------SGDEVDVIVLEVSSFQLELAGDFSPHIALLLNLSPD
gi|6290051      VGGNIGVPLLDLLS----------SGDEVDVIVLEVSSFQLELAGDFSPHIALLLNLSPD
gi|1624499      VGGNFGTPLAEVVDQT------------WDVLVLEISSFQAERVPTLHARAHALLNITDD
gi|7791979      VGGNLGTPLIEATRSTD-----------WDWIVAEISSFQLEAIDTFRPRYGMLLNLTAD
gi|6290055      VGGNIGNPLIELVE----------TGAAVDRVVVEISSFQLEWIRSFRPTVAVLLNITED
gi|3999816      VGGNIGNPLIELVE----------TGAAVDRVVVEISSFQLEWIRSFRPTVAVLLNITED
gi|2220538      VGGNIGNPLIELVT----------SGNDVAQVVVELSSFQLEGIQRFRPKVAVLLNITED
gi|9426909      VGGNLGVPLAQYLAGP----------QEADWVVLEVSSFQLDTAGAFRPQIGVLLNISPD
gi|1608727      VGGNIGKPALDLLNEPV-----------PDFYVLEISSFQLETTYSLRPKLASILNISPD
gi|2269517      VGGNLGRPALDLLKDQ------------PELIVLELSSFQLETTSHLNAEVAVLLNMSED
gi|1841565      VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|2267119      VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|2131556      VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|2154849      VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|1696346      VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|1697974      VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
REFERENCEG      AVGNIGVPVLEVLEQIE-----RRARKMPDVFVLEMSSFQIDTTYSFECDAAVVLNVSED
gi|6290049      VGGNLGTPMLDLLDAA------------AELYVLELSSFQLERSELFEADVATVLNISPD
gi|1143213      VGGNLGTPALALLDGE----------TRPDAYILELSSFQLETTHSLAPRVAAVLNISAD
gi|8270361      VAGNIGPAVLDALMRRE------DTGKMPQAWVLELSSFQLETTKSLGLDAAAVLNVSED
gi|3024899      VAGNIGPAALDALMQRM------DANKWPHLWALELSSFQLETTSSLRPDAATVLNLSED
gi|6039055      VAGNIGPAALDALMQRM------DANKWPHLWALELSSFQLETTSSLRPDAATVLNLSED
gi|1143302      VAGNIGLAALDALMQRI------DTGKWPHLWVLELSSFQLETTSSLRPNAAVVLNLSED
gi|2250237      VAGNIGTPVLEAYEDR--------QEQSADVWVLELSSFQLENTDHLNAAAAAVLNISED
gi|2187688      IAGNIGAPVLEAELQR--------EGKKADVWVLELSSFQLENTESLRPTAATVLNISED
gi|1618706      IAGNIGTPVLEAEWQR--------EGKKADVWVLELSSFQLENTESLRPTAATVLNISED
gi|2267275      IAGNIGTPVLEAELQR--------EGKKADVWVLELSSFQLENTESLRPTAATVMNISED
gi|2253725      IAGNIGTPVLEAELQR--------EGKKADMWVLELSSFQLENTESLRPTAATVLNISED
gi|2253646      IAGNIGTPVLEAELQR--------EGKKADVWVLELSSFQLENTESLRPTAATVLNISED
gi|9177662      VAGNIGLPVLDVINDA------------VDVYVLELSSFQLETTYSLAADAATVLNISAD
gi|7431613      VAGNIGLPVLDALHEIE-----QGAAPLPQVWVLELSSFQLETTSSLDATAAAVLNLSED
gi|2269419      VAGNIGLAVLDALADIE------ASGELPECFVLELSSFQLETTTSLNAIAATTLNISED
gi|2248260      LAGNIGLPVLDALGERE------ASGKRPDVWVLELSSFQLETTTSLNADAATVLNISED
gi|3449980      VAGNIGLAVLEALLARE------QSGKRPDVWVLELSSFQLESTFSLAADAATVLNISED
gi|1198971      AAGNISPAALDVLMARL-----DAGQALPQCWVLELSSFQIETAQALDADAATVLNVTDD
gi|1216063      VAGNIGPTLLDTLTGKLDEHARDPSAALPEFWVLELSSFQLDGVTNFEPDVATVLNITQD
gi|1529805      VAGNISPAALDKLHQVL------TDDQLPQVWVLELSSFQLHTTYSLQADVATVLNLTQD
gi|7354266      VAGNISPSALDKLSACI------ASATLPDVWVLELSSFQLETTHTLAPHAATVLNVTQD
gi|1942908      VAGNISPSALDKLSACI------ASASLPEVWVLELSSFQLETTHTLAPHAATVLNVTQD
                  **:. .                          *:****      :       :*:: *

gi|5124675      HLDRHGDLAGYRAAKMHLFQKQGMTD-IAIVSGDDPLCLLS------DGCGEASRYLFGF
gi|6290051      HLDRHGDLAGYRAAKMHLFQKQGMTD-IAIVSGDDPLCLLS------DGCGEASRYLFGF
gi|1624499      HLDRYASFAAYADAKGNPFERMTPDD-VAVVPFGDELVARQ------AARGRARVVTFSA
gi|7791979      HLDRYAGMGEYVAAKLRLFENMTAED-VAVVNADDALVVRS------TTDLPCRKIPFSS
gi|6290055      HLDRYATYQEYIDAKARIFKNQTASD-WAVLNVDDPIVAGL------AGRTCAAVFPMSR
gi|3999816      HLDRYATYQEYIDAKARIFKNQTASD-WAVLNVDDPIVAGL------AGRTCAAVFPMSR
gi|2220538      HLDRYASYQDYIDAKLRIFENQTVDD-FAVLNVDDPLVAAC------AATVKSRVFPFSQ
gi|9426909      HLDRYPDYQAYAASKWRLFAHQRATD-WAVLNGADPEIARLAV----AAPPVARRLDFNC
gi|1608727      HLDRHKTLTAYINAKQRIY---HQAD-IALWNRDDLNTFPQ-------ARTKKIIS-FGL
gi|2269517      HLDRHGDMLGYHKAKHRIF---QGVK-KVVYNRDDSLSRPL------VPDVTPMQS-FGL
gi|1841565      HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|2267119      HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|2131556      HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|2154849      HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|1696346      HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|1697974      HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
REFERENCEG      HLDRYRDFDAYLRSKCRIH---SGRG-IKVVNRDEPIVLNE-------IAGEDSVS-FGL
gi|6290049      HMDRYPDLASYAEAKRRVF---RGEG-LMVLNQDDPLVAAM------YRPGRRAVR-FGL
gi|1143213      HMDRHGSVSAYAGIKARIF---HGAG-VQVLNLDDPVVAAM------AQPGRTVLG-FSL
gi|8270361      HLDRYAGMQEYAAAKARIFLG-DSEG-VQILNGDDPVVRQM------TLAGRPHVT-FSL
gi|3024899      HLDRYDSIEEYAAAKARIFSRPHNNGCVQILNRDDARVYAM------ADKNSKQVT-FGL
gi|6039055      HLDRYDSIEEYAAAKARIFSRPHNNGCVQILNRDDARVYAM------ADKNSKQVT-FGL
gi|1143302      HLDRYRIIEEYAAAKARIFPDPHNSC-VQVLNREDARVYAM------AHENSKQLT-FGL
gi|2250237      HLNRYDDLLDYAHAKDKIF---RGSG-VQVINADDALCRAM------KRSGREVRR-FSL
gi|2187688      HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|1618706      HLDRYDDLLDYAHTKDKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|2267275      HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDVFCRAM------KRAGREVKR-FSL
gi|2253725      HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|2253646      HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|9177662      HMDRYADMQAYANAKARIF---TRAG-LQVLNADDAWSRGM------AAEGVAQLT-FGL
gi|7431613      HMDRYPDMAAYAAAKARIF---SGNG-VQVLNRDDPRTLAM------AIPGRHVVS-FGL
gi|2269419      HLDRYRDLLAYADSKAAVF---NGGG-VQVLNRDDLFVRAM------ARPQRRHVW-FSL
gi|2248260      HLDRYADLLDYAHSKTAVF---NGRG-VQVLNRDDALVRAM------VRPGHAQRW-FSL
gi|3449980      HLDRYADLLDYAHAKTRVF---NGKG-VQVLNKDDALVRAM------VRPGHPVKW-FSL
gi|1198971      HLDRYADLADYAATKARIF---QGRG-AQVLNREDARVAAM------VLSGRKVVR-FGT
gi|1216063      HLDWHETLPAYAAAKSHVY---GRSG-LMLLNRNDPLVMTAVPALVKGKPGRSYLT-FGG
gi|1529805      HLDWHGDMAAYADDKARIF---GSNT-IRVLNRDDALVMQM------SSPLSKVIT-FGA
gi|7354266      HLDWHGSMEAYAASKARIFGPAGTAC-VQVLNRNDRLTMDM------ARPGTAPVT-FGT
gi|1942908      HLDWHGSMEAYAASKARIFGPAGHAC-VQVLNRNDRLTLDM------ARPGSTPVT-FGI
                *::.:     *   *   .          :    :                      :. 

gi|5124675      -S---A-----------ASDISVAA--GHFEFDFAG------------------------
gi|6290051      -S---A-----------ASDISVAA--GHFEFDFAG------------------------
gi|1624499      -----R-----------DARADVSAAGGAIVDRVTG------------------------
gi|7791979      -S---R-----------VLDEGMGFDGQHIVWRHAG------------------------
gi|6290055      -Q---R-----------ELGEGIFYRDGAIIFRHAG------------------------
gi|3999816      -Q---R-----------ELGEGIFYRDGAIIFRHAG------------------------
gi|2220538      -R---K-----------ELAEGIFCSKGIIVYRWQG------------------------
gi|9426909      QPQPEGRATAIDDEITMTGGAWSASTPAGARLLVNVYSLLKQPVTGPGERLPLPTPAAGA
gi|1608727      TTTTPH-----------AHEFYLYNS-HQKNFIAKG------------------------
gi|2269517      -NAP-D-----------MNQYGVLREADGSMWLARG------------------------
gi|1841565      -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|2267119      -NAP-D-----------LNQYGVLRDADGTLWLACG------------------------
gi|2131556      -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|2154849      -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|1696346      -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|1697974      -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
REFERENCEG      -SPPDN-----------DRSWGVSKI-AGEQWVACG------------------------
gi|6290049      -GSG-D-----------ELDYSLARW-EGRAWLLAK------------------------
gi|1143213      -ASNPR-----------RG-AGVADH-RGAPWLHLN------------------------
gi|8270361      -ATPQS-----------ADDFGLLRE-GGDTWLMQG------------------------
gi|3024899      -SAPVS-----------DEEFGLLPG-GSDVWLAQG------------------------
gi|6039055      -SAPVS-----------DEEFGLLPG-GSDVWLAQG------------------------
gi|1143302      -SAPAF-----------DDEFGVLPS-GSDLWLAQG------------------------
gi|2250237      -Q---Q-----------ETDYWFDAASG---YLKHG------------------------
gi|2187688      -E---Y-----------EADFWLERETGR---LKQG------------------------
gi|1618706      -E---Y-----------EADFWLERETGR---LKQG------------------------
gi|2267275      -E---H-----------EADFWLERGTGC---LKQG------------------------
gi|2253725      -E---H-----------KADFWLERETGC---LKQG------------------------
gi|2253646      -E---H-----------EADFWLERETGC---LKQG------------------------
gi|9177662      -DAPRS-----------AQDFGLLHD-AGEAWLARG------------------------
gi|7431613      -DRCPT-----------DENFGLCED-E----LCLG------------------------
gi|2269419      ED---A-----------GADYALAER-DGRHWLCAG------------------------
gi|2248260      -K---E-----------TADYALRQD-AGRYWLTVA------------------------
gi|3449980      -N---G-----------AADYALARN-GG-YWLKVD------------------------
gi|1198971      -DAPQN-----------PADYGLVED-AGRCWLVRG------------------------
gi|1216063      -DEPKR-----------PGDYGIETV-NGMAWLVRA-----AEADETIKRRKAEE-----
gi|1529805      -DEAEQ-----------ADCFGLVDE-NGMRWLSVA-----VEEEEPQKKRRKKDNVE--
gi|7354266      -DLPET-----------PGSFGVLRE-GGMPWLVLAEPDSEAEGEGKPRRRKADATAQEA
gi|1942908      -DLPEV-----------PGSFGILRE-GGMPWLVLAEPDPDAEGEGKPRGRKAAEAVQEA
                                                                            

gi|5124675      ----QREIYSLRDSALDNRTGWLNAAPAAFIAR-SLACAKADIERGIAAFTLDAHRMEPV
gi|6290051      ----QREIYSLRDSALDNRTGWLNAAPAAFIAR-SLACAKADIERGIAAFTLDAHRMEPV
gi|1624499      ------ARYPLDRVRLAGAHNLANACASAALAA-ALGAPAAAIGDALSSFEGLAHRTALV
gi|7791979      ----RQERFDVADLQLKGLHNVENVMAALIPPL-MEGCPTDIAWKAVCGFSGLDHRMVLV
gi|6290055      ----RQERFPTDRFRITGVHNIENIMASLAAAL-LLGCDADRALACVEAFGGLPHRMELV
gi|3999816      ----RQERFPTDRFRITGVHNIENIMASLAAAL-LLGCDADRALACVEAFGGLPHRMELV
gi|2220538      ----SELRFDTAAFKLKGVHNIENIMAALASTL-LSGADPIKAGRAVESFKGLRHRMEFI
gi|9426909      DPIPPEVYEPGPELAVE--PNLQNAQAAILAAR-LAGCSSSAVVAGLRAFKSLPHRLALV
gi|1608727      ----HDRLLPVDALFIQGRHNWANAIAALTIGH-AIGLPTKAMLTALCEFKGLPHRCQWV
gi|2269517      ----RERLIKTSDLYIQGMHNVANALACLALGE-AIGLPTQSMLETLQQFKGLEHRCEYV
gi|1841565      ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKRFKGLEHRCEYV
gi|2267119      ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|2131556      ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|2154849      ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|1696346      ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|1697974      ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
REFERENCEG      ----SQQIFRCEDLRVSGMHNVCNAMAALALSS-TLVSVNEDAIRGLLSYEGLDHRMQWV
gi|6290049      ----GVPLLPADEVRIKGRHNLANALAAVAIAD-ACGFDRQAMVGVLRTFPGLDHRMQWV
gi|1143213      ----GEPVLPAADLRLPGLHNRANALAALCLGQ-GLGLPVAAMAEALRRFTGLPHRTEWV
gi|8270361      ----DTRLMDARELAITGRHNCANALAALALCR-ALAVPFEPLLQALREFRGLPHRVEKV
gi|3024899      ----STHLLKTSELAVAGLHNAANALAALALCR-AVDLPFEPLLHALRTFRGLPHRMQKV
gi|6039055      ----STHLLKTSELAVAGLHNAANALAALALCR-AVDLPFEPLLHALRTFRGLPHRMQKV
gi|1143302      ----TTRLMKVSELAVAGLHNAANALAALALCR-AIDLPFEPLLHALHIFKGLPHRMQKI
gi|2250237      ----AETLIAAADIPLQGLHNAANVLAALALCE-AIGLPREQLLRHVRTFKGLPHRVEKI
gi|2187688      ----NEDLIATQDIPLQGLHNATNVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|1618706      ----NEDLIATQDIPLQGLHNATNVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|2267275      ----NEDLISTQDIPLQGLHNAANVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|2253725      ----NEDLIATQDIPLQGLHNAANVMAAIALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|2253646      ----DEDLIATQDIPLQGLHNAANVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|9177662      ----QRKLMPVADLNITGLHNAANALAALALCT-VLDIDEVVALQALRDFKGLPHRVQWV
gi|7431613      ----GDMLMPLSVLAVPGLHNAANALAALALTR-ALDLPIEALLRGLMHFKGLPHRVEKV
gi|2269419      ----GEALLPFDAMQLVGLHNAANALAALALCE-AAGLPRAGLLAGLTTFKGLAHRVEHV
gi|2248260      ----GEAVFDCAEMSLQGLHNAANALAALALTE-AIGLPRAALLEGLKTFTGLAHRVEFV
gi|3449980      ----GEKVFDCADMQLQGLHNAANALAALGLCQ-GIGLPLEKLLDGLKTFRGLAHRVELV
gi|1198971      ----GERLLALDELALAGRHNAANALAALALCETGLGLAPAQLLAGLRAFRGLPHRVELV
gi|1216063      LVLHIQRLMPLEALRIQGRHNATNALAALGLAV-AVGCPLAPMLHGLREYRGEPHRVESV
gi|1529805      LAVSTNKLMPVDALKIRGQHNAINALSALALCR-AIGLPFAQLLHGLRDYHGEPHRVEHV
gi|7354266      VPVRHKRLMPADALHIRGMHNATNAMAALALCR-AIDLPLNALLHGLREYRGEPHRVEWV
gi|1942908      VPVRHKRLMPADALHIRGMHNATNAMAALALCR-AIDLPMNALLHGLREYRGEPHRVEWV
                               :    .  *  ..                  :  :    **   :

gi|5124675      AS-IAGVQYYNDSKATNTGAVISALQQL--------VRVILIAGGRDKGDNYRLLREAVA
gi|6290051      AS-IAGVQYYNDSKATNTGAVISALQQL--------VRVILIAGGRDKGDNYRLLREAVA
gi|1624499      AD-VDGVRYYDDSKGTNVGASVAALSGLL------EAKAVLIAGGRDKLGDYAPLVSALR
gi|7791979      RE-IDGVSWYDDSKGTNVGSVVKSLAGL-------QGPVTLIAGGKDKGGDYAPLAGLIG
gi|6290055      RE-LNGVRYFEDSKATNVGSVEKALASF--------NDITLIAGGKDKGGSYAPLAGLVA
gi|3999816      RE-LNGVRYFEDSKATNVGSVEKALASF--------NDITLIAGGKDKGGSYAPLAGLVA
gi|2220538      RE-VGGVAYYEDSKGTNVGSVVKSLESF-------DKGITLIAGGKDKGGSYAPLADLVR
gi|9426909      AS-IAGVDYYDDSKATNIGAVVSALQGL-------AQPVILIAGGLDKGGDYKLLLPVLK
gi|1608727      KE-FKGVTWYNDSKATNVGATLAALNGLGPSI---SGKIILIAGGLSKNADFSLLHNPVK
gi|2269517      QT-VDQVRYYNDSKGTNVGATLAAIEGLGAAIEAKHGKLALILGGQGKGQDFKPLRNAIQ
gi|1841565      KT-VRDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIE
gi|2267119      KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIE
gi|2131556      KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFGPLRSSIE
gi|2154849      KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFGPLRSSIE
gi|1696346      KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIE
gi|1697974      KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFGPLRSSIE
REFERENCEG      AD-ISGVQFYNDSKATNVGATAAAISGL-------PAKCVLLLGGESKQQNFEILVDYIR
gi|6290049      AD-IGGVAYVNDSKATNVGACIAALSGL-------EGKVVLIAGGDGKGADFSSLVPVAA
gi|1143213      AE-HAGVRWYNDSKGTNVGAAVAAIRGL-------AGPVVLIAGGDGKGADFLPLADALR
gi|8270361      AA-FSGITFYDDSKGTNVGATVAALKGL-------GQPVVLIAGGDGKAQNFSPLAAPIG
gi|3024899      AE-FNGVTFYDDSKSTNIGSAVAALNGF-------RKNVILIAGGDGKGQDFSPLEQPVS
gi|6039055      AE-FNGVTFYDDSKSTNIGSAVAALNGF-------RKNVILIAGGDGKGQDFSPLEQPVS
gi|1143302      AE-FNGVTFYDDSKSTNVGSAVAALNGF-------RKNVILIAGGDGKGQDFSPLEQPVS
gi|2250237      GE-KNGVVFIDDSKGTNVGATEAAIAGL-------QSPLFLIAGGQGKGQDFTPLKNVLP
gi|2187688      GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALA
gi|1618706      GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALA
gi|2267275      GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALK
gi|2253725      GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALA
gi|2253646      GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALK
gi|9177662      AD-IDGVSFYDDSKGTNVGATVAALHGL-------NRKLVLIAGGDGKGQDFAALRAPVA
gi|7431613      AD-IDGVTWYDDSKGTNVGATEAALYGMG------RRKAVVILGGDGKGQDFGPLKAAVA
gi|2269419      LT-HEGVDFIDDSKGTNVGATEAALKGM-------TRPVVLIAGGDGKGQDFSPLAPALA
gi|2248260      AE-VHGVRYIDDSKGTNVGATEAALNGM-------TRPVVLIAGGDGKGQDFSPLKPACA
gi|3449980      DE-FDGIAFIDDSKGTNVGATEAALNGM-------TRQVVLIAGGDGKGQDFAPLKPACQ
gi|1198971      AERADGVRYYDDSKGTNVGATVAALDGL-------GGRVVLIAGGDGKGQDFSPLAPVLT
gi|1216063      AV-LEGIEYFDDSKGTNVGATVAALAGLGS-----ERKLVLILGGEGKGQDFSPLADPVA
gi|1529805      MT-IGGVDYYDDSKGTNVGATVAALNGLGASQDGASNHLVLIAGGDGKGQDFSPLADPVA
gi|7354266      AT-IDEVEYFDDSKGTNVGATVAALSGL-------DKRVVLIAGGEGKGQDFSPLAAPVA
gi|1942908      AT-IDDVEYFDDSKGTNVGATVAALSGL-------DKRVVLIAGGEGKGQDFSPLAAPVA
                      : : :***.** *:   ::  :            :: ** .*  .:  *     

gi|5124675      GHVRTLICIGEATPLLVAALEDV-VQVYRATSLAEAVSLAASFAEEGDSVLLSPACASFD
gi|6290051      GHVRTLICIGEATPLLVAALEDV-VQVYRATSLAEAVSLAASFAEEGDSVLLSPACASFD
gi|1624499      ERGRALVVLGEAADRIAAAAAGV-LPIARAGSMAEAVLAARSLARPGDAVLLSPACSSFD
gi|7791979      EKVEHLILIGQAADRMQAAFQGM-TTILRADSLEAAVQQAQQVTMAGGTVLLSPGCSSFD
gi|6290055      ERVRHMILIGEAKDRMARELGHL-TDTRMAVTLEDAVELAASLTQPGGVVLFSPACSSFD
gi|3999816      ERVRHMILIGEAKDRMARELGHL-TDTRMAVTLEDAVELAASLTQPGGVVLFSPACSSFD
gi|2220538      ERVKHLILIGEAKERIEAELGNL-TDTHKAATLEDAVAIAHRLAKAGEVVLFSPACSSFD
gi|9426909      EKVRAVVLIGSARARMAAALEGS-VPLTQAEDLPAAVAKAAELAAPGEAVLLSPACASFD
gi|1608727      HYVKKIILIGRDAALLKNTLEKS-TAIQTVSDLRHAVNLAHETARRGDIVLLSPACASLD
gi|2269517      KYVKTVILIGEDAAMIEQALHNT-TQIQHASSLKQAVDIAHQATQAEDVVLLSPACASFD
gi|1841565      KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|2267119      KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|2131556      KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|2154849      KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|1696346      KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|1697974      KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
REFERENCEG      EKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLAEPGEIV----------
gi|6290049      EKLRAAVLMGRDGPLIDEVLKGV-VPTIRVKTMFEAVRAARGVAQSGDTVLLAPACASLD
gi|1143213      EKGRAAVLIGRDAPRLAQVLSGV-VPVERAADMRDAVRRAANLARSGDAVLLSPACASFD
gi|8270361      EHGRAVVLIGRDAEKIAVAINECGVPLHRAQTMEEAVRKSFQLAREGDAVLMSPACASFD
gi|3024899      KHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQVSFLLAEHGDVVLLSPACASLD
gi|6039055      KHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQVSFLLAEHGDVVLLSPACASLD
gi|1143302      KHTRGVVLLGRDAEKISQAIQGCNVPVHRVATMDEAVRVSFLLAERGDSVLLSPACASLD
gi|2250237      GKARAVLLIGEDAPQIRRDLAGCGVEMMDCASLQEAVQTAYRLAEPGDIVLLSPACASFD
gi|2187688      GKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQKAYAQAEAGDIVLLSPACASFD
gi|1618706      GKAKGVFLIGVDALQIRRDLDGCDLNMTDCATLEEAVQKAYAQAEAGDIVLLSPACASFD
gi|2267275      DKAKGVFLIGVDAPQIRRDLDGCGLNLTDCVTLEEAVQTAYAQAEAGDIVLLSPACASFD
gi|2253725      GKAKGVFLIGVDAPQIRRDLDGCGLNMIDCATLEEAVQKAYAQAEAGDIVLLSPACASFD
gi|2253646      DKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEAVQTAYTQAEAGDIVLLSPACASFD
gi|9177662      KHARAVVLIGRDAGVIADALQESGVLLEYGDTLEEAVVKAFNLADRGDAVLLSPACASLD
gi|7431613      ANARAVVLIGRDAVAIEAAIEDSGVASYRADTLPDAVEQAARLAEPGDAVLLSPACASFD
gi|2269419      RIGRAVLLIGRDAPVVRQALAGLALPLIDCATLEEATRRGFELAQPGDVVLLSPACASFD
gi|2248260      RIARAVLLIGRDAGKIRAVLEGLPLPIVDCATLEEATREAARLAEAGDVVLLSPACASLD
gi|3449980      RIARAVLLIGRDAGRIEAALEDSGLALERCDTLEEATRRAAALARPGDVVLLSPACASLD
gi|1198971      RHARAVVLIGRDAKLIEAAVAGCGVPLEHAADLDTAVLRANALARPGDAVMLSPACASLD
gi|1216063      RYVRVVVLIGRDAPLIRAALQGSRVELLDAASMQEAVSLAAGQARPGDAVLMSPACASFD
gi|1529805      KYARAVILIGKDADNIRAALQATGVDMINCTTLEEATQKAAELAQSGDAVLLSPACASLD
gi|7354266      QYARAVVLIGRAAGELRDALQGSGASLVDAATLEEAVNKAAELAEGGDVVLLSPACASLD
gi|1942908      QYARAVVLIGRAAAELRDALQGSGATLVDAATLEEAVTQAAGLAEAGDAVLLSPACASLD
                      . :*     :                :  *.      :     *          

gi|5124675      MFANYQDRGEQFRRQVLQLQDVGSK-----------------
gi|6290051      MFANYQDRGEQFRRQVLQLQDVGSK-----------------
gi|1624499      MFRDYKDRGDAFVRAVRELQGAAGGAAGEVAS----------
gi|7791979      MFRSYAERGEVFCRAVQALQGNG-------------------
gi|6290055      MFRDYEERAQRFRAAVDALSPGGTP-----------------
gi|3999816      MFRDYEERAQRFRAAVDALSPGGTP-----------------
gi|2220538      MFKDYAERAERFNAAVRALAGGDCR-----------------
gi|9426909      MFSGYAQRGEVFRQAVAELRKNLASGGGQSARGCPVMEAMVQ
gi|1608727      MFKNYEERGDVFMRLARGIH----------------------
gi|2269517      MFKSYNDRGHQFVACVHALNGNKN------------------
gi|1841565      MFKSYNDRGQQFVACVNSLV----------------------
gi|2267119      MFKSYNDRGQQFVACVNSLV----------------------
gi|2131556      MFKSYNDRGQQFVACVNSLV----------------------
gi|2154849      MFKSYNDRGQQFVACVNSLV----------------------
gi|1696346      MFKSYNDRGQQFVACVNSLV----------------------
gi|1697974      MFKSYNDRGQQFVACVNSLV----------------------
REFERENCEG      ------------------------------------------
gi|6290049      QYEDYQERGRDFAATVRSLA----------------------
gi|1143213      MFRGFEHRGEAFRDAVREVAHG--------------------
gi|8270361      MFDNYVHRAEAFVAAVRSMQAARAGGNSAGVAGRH-------
gi|3024899      MFNNYIHRAEVFTAAVRLIERKFVLTAQTCH-----------
gi|6039055      MFNNYIHRAEVFTAAVRLIERKFVLTAQTCH-----------
gi|1143302      MFNNYIHRAEVFTTAVQGIEHKFILTAQTCH-----------
gi|2250237      MFKGYAHRSQVFIEAFEAL-----------------------
gi|2187688      MFKGYAHRSEVFIGAFKAL-----------------------
gi|1618706      MFKGYAHRSEVFIGAFKAL-----------------------
gi|2267275      MFKGYAHRSEVFIEAFKAL-----------------------
gi|2253725      MFKGYAHRSEVFIEVFKAL-----------------------
gi|2253646      MFKGYAHRSEVFIEAFKAL-----------------------
gi|9177662      MFRNYVHRAEVFVKAVTDLQKKEVSA----------------
gi|7431613      MFRNYVHRAEVFVDAVKKLAAQRAQV----------------
gi|2269419      MFRGYAHRAEVFIACARELAGVQP------------------
gi|2248260      MFKNYAHRAQVFIDGVRALQAGNAA-----------------
gi|3449980      MFKNYAHRAQVFIDTVAAVKAARA------------------
gi|1198971      MFRNYAHRAEVFIAAVRRLPEVSPR-----------------
gi|1216063      MFDNYEHRARVFCEAVQELAVEQGAVL---------------
gi|1529805      MFKNYAHRAQVFVDEVREIGLSRGEVSA--------------
gi|7354266      MFRNYVHRAEVFRSAVEELALSRGIMP---------------
gi|1942908      MFRNYVHRAEVFRGAVEELALSRGILP---------------
                                                          





Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 39
Alignment assumed to be: Protein
New number of positions: 202 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  ------------MLKKNPYIDAHTTFAIIGLGVSGKAALRYALGFGAHLLVSD-RRDEEA
gi|62900515|sp|  ------------MLKKNPYIDAHTTFAIIGLGVSGKAALRYALGFGAHLLVSD-RRDEEA
gi|162449933|re  -----------------MMDVRGRTVIVVGLGRSGVAAARLLNARGARVIAND-GAPRER
gi|77919798|ref  -----------------MAEYSGKHVVVVGAGCTGLGLARFFLDRGALVTLSD-SRSREE
gi|62900554|sp|  ------------------MDLKGKNILVVGLARTGVAVARFLAAQGARVTVTD-LRDEAA
gi|39998162|ref  ------------------MDLKGKNILVVGLARTGVAVARFLAAQGARVTVTD-LRDEAA
gi|222053879|re  ------------------MEIKGKKILVVGLARTGVAVARFLASRGAKVTVTD-MKEESE
gi|94269090|ref  --------MGNGPRTDIPPFKAGDHVLVVGLGKSGVAAARFLLSLGLRVSVSEGGRAVAP
gi|160872723|re  --------------------------MILGLGKTGLSCARHLKRFNLPFIIFD-NRLNPP
gi|226951755|re  -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRETPP
gi|184156588|re  -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|226711953|sp  -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|213155698|re  -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|215484924|re  -----------------MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|169634628|re  ----------MINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
gi|169797488|re  ----------MINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTD-SRPTPP
REFERENCEGOS_91  ------------------------------------------------------------
gi|62900496|sp|  MHDRLIDENPTCGFVRLGLDVRSR-VIVLGLGATGLSTVRFLRCHGFECAVMD-SRLAPP
gi|114321344|re  ---------------MQAVKRQAGYRAVVGLGRTGLACVRFLAARGLDVCVTD-SRDEPP
gi|82703611|ref  ------------------MNLQGRTVLVLGLGETGLSMAKWLFRRGALVRAAD-TRNEPP
gi|30248992|ref  ------------------MNYTGKKILVLGMGKTGISMVKWLSRLGAQLSVAD-TRTSPP
gi|60390554|sp|  ------------------MNYTGKKILVLGMGKTGISMVKWLSRLGAQLSVAD-TRTSPP
gi|114330275|re  ------------------MNYADKKILVLGMGKTGISMVKWLSRAGARVSVAD-TRTTPP
gi|225023739|re  ------------MEKRMKSEWQNQKILVAGMGGSGISMLDFLSRQGAAVAAYD-ADFPAA
gi|218768812|re  ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKPE
gi|161870654|re  ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGVEVAAYD-AELKPE
gi|226727514|re  ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKAE
gi|225372572|re  ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKPE
gi|225364676|re  ------------------MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYD-AELKPE
gi|91776623|ref  -----------------MLQLKDKQVLVLGLGDTGLSALRWLARQGARLSVAD-SRALPP
gi|74316135|ref  -------------MNYDALQLSGRKVLVLGLGDTGLSCARWLSVHGADVSVAD-SREAPP
gi|226941971|re  --------------MYADLGFANKTVCVVGLGGSGLAAARFLAPRVGRLVVAD-SREVPP
gi|224826076|re  ------------------MRFANRHIVVVGLGDTGLSAARWLAAHGATVTVAD-SRDNPP
gi|34499800|ref  ------------------MDYANRHVTVVGLGGSGLAAARYLAAHGARVRVAD-ANPSAE
gi|119897173|re  -----------MTQPSFSSSLAGRHVLVLGLGESGLAIARWCARCGARLRVAD-SRTTPP
gi|121606308|re  -----------------MKNLAHQNILVLGLGASGLALARWCVRCGAHVTVAD-TRSAPP
gi|152980553|re  ------------------MNYAGKHVLVLGLGESGLAMAQWLVHCGASLRVAD-TREQPD
gi|73542665|ref  ----------------MFGELQKPHVLVLGLGESGLAMARWCGLNGCAVRVAD-TREAPA
gi|194290815|re  MRRGFIVTGNQGQEIEVFGELQKPHVLVLGLGESGLAMARWCGLNGCAVRVAD-TREAPA
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  LLAQLVALAGDVVVDYEAGGHTFQFLSQ--ADVIFVSPGFA-----DGELLARLRRA-GV
gi|62900515|sp|  LLAQLVALAGDVVVDYEAGGHTFQFLSQ--ADVIFVSPGFA-----DGELLARLRRA-GV
gi|162449933|re  LSAAAAALEGE-GVVLAPGGHDPALFDG--ADLVVVSPGVP-----SFPALDAVARS-GR
gi|77919798|ref  LVDVAELADH--GLRFDCGGHDAALLAG--ADLIAISPGIPL----TVPAVAGALQA-GV
gi|62900554|sp|  LAGPLEQLAGH-PVSYVLGRHDEADFAA--AETVVVSPGVPQ----ESPYLQAARRA-GR
gi|39998162|ref  LAGPLEQLAGH-PVSYVLGRHDEADFAA--AETVVVSPGVPQ----ESPYLQAARRA-GR
gi|222053879|re  LADYLLQLEDL-DLNLELGRHDKHTFLM--SDLIVVSPGVPM----DISPLLMAKAQ-RR
gi|94269090|ref  ATEAVNWLQQR-GVYCELDGHSPELFAA--VDAIVVSPGVPL----DIPALKEAARA-GV
gi|160872723|re  KLSHFKKEFP--DVGCYLGSLKPNLFKR--CTKLIVSPGIDL----NETTIRTIIEQHTL
gi|226951755|re  GHDQIPE-----NIKKSFGKLDLDLLLQ--AEEIILSPGLAP----QLPEIQQALEK-GI
gi|184156588|re  GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|226711953|sp  GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|213155698|re  GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|215484924|re  GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|169634628|re  GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
gi|169797488|re  GHDQIPA-----GVKTSFGQLDQELLLQ--AEEIILSPGLAP----QLPEIQAAIAK-GI
REFERENCEGOS_91  ------------------------------------------------------------
gi|62900496|sp|  GLQDLREAFP--DVPLFLGDFSRSALAA--ATHLVVSPGLSL----DLAEIRESHRC-GV
gi|114321344|re  EQATLQREWP--QVPVRAGGFDAALLAG--AGEIIVSPGVSL----REPALETARRA-GV
gi|82703611|ref  AMRAFNSLLP--QAEVFTGSLAGRAFYG--VDLIAISPGLPL----SEPLVQQALKE-GI
gi|30248992|ref  NLELISRIVP--GEAIFCGPLKEELFQG--IDAIAISPGVAV----AEPLVQAALQQ-GV
gi|60390554|sp|  NLELISRIVP--GEAIFCGPLKEELFQG--IDAIAISPGVAV----AEPLVQAALQQ-GV
gi|114330275|re  NLELLSQIVP--LETIFCGPFKAELFKD--IDAIAISPGVAI----AEPLVQAALQQ-GV
gi|225023739|re  KQAELQQRFP--GLACHTGYLKNALAEG--FDILALSPGVSE----RTPEIEAFKQA-GG
gi|218768812|re  RVSQIGKMFD--GLVFYTGRLKDALSNG--FDILALSPGISE----RQPDIEAFKRN-GG
gi|161870654|re  RVAQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQPDIEAFKQN-GG
gi|226727514|re  RVAQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQSDIEAFKQN-GG
gi|225372572|re  RVSQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQPDIEAFKQN-GG
gi|225364676|re  RVSQIGKMFD--GLVFYTGRLKDALDNG--FDILALSPGISE----RQPDIEAFKQN-GG
gi|91776623|ref  GLDAVRQEFP--GMAIHLGPFTAAAFKE--AELIVASPGVPV----AEPQVQAAIER-GV
gi|74316135|ref  HAARLAETLP--QVALFTGPFEAAHLAA--ADMLVLSPGVPL----SEPAVAQAVAQ-GV
gi|226941971|re  NAGQLAGVAA--GAELRAGAFSAATFAG--CDVLVLSPGVPL----ATPAVAAF----AG
gi|224826076|re  NAATLAESLP--GVALKTGAFDATTFAG--AEMLVVSPGVAV----ATPAIAAFRRA-GG
gi|34499800|ref  RLAELERCLP--GVEVMVGAFDDATFAG--AELLVVSPGVPL----ANPAIAAFRRA-GG
gi|119897173|re  GLEALRAAAP--QAEVITGSFGDEVLEG--IDVVAVSPGLDP----RVGVIASARRR-CL
gi|121606308|re  QLASLQDSVP--AAKFVTSPMDGALLAGTAFDLVLKSPGLSP--ASISGVLAAAQAQ-GI
gi|152980553|re  RLPQLRGIAP--QAEFVGGPFDASLLDG--VDFVAVSPGLMP-ARELAEIIPAAAEK-EI
gi|73542665|ref  NLVFLQAELM--SAEFVGGPFAESLLDG--IGLVAISPGLSPLEANTGELLAAARQR-GI
gi|194290815|re  NLVFLQAELT--SAEFVGGPFAEGLLDG--IGLVAISPGLSPLEAATGALLAAAQAR-GI
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  QVLGELALAAPVLD---------------RPVVAITGTNGKTTVTSLVGDLLRASGKRVF
gi|62900515|sp|  QVLGELALAAPVLD---------------RPVVAITGTNGKTTVTSLVGDLLRASGKRVF
gi|162449933|re  EVIGELELASRFVS---------------APVVLVGGTNGKSTTTALTGAMLERAGLRTF
gi|77919798|ref  PVQGEIEIAARELS---------------APMVAITGTNGKSTTTCLMGEIMRCWGRRAF
gi|62900554|sp|  EVITEIELASRFIT---------------APLVAITGTNGKTTTTTLTGELFAGCGFRTF
gi|39998162|ref  EVITEIELASRFIT---------------APLVAITGTNGKTTTTTLTGELFAGCGFRTF
gi|222053879|re  VVISEIELAAAFIK---------------APMVAITGTNGKTTTTTLAGEIFKACGVETF
gi|94269090|ref  PIIGELALAPAYLH---------------TPVIAVTGTNGKSTVTTLIGELLQAAGYKTF
gi|160872723|re  KPLGDIELFAQHAR---------------APIIAITGSNAKGTVTSLIGKMIQRAHLNVA
gi|226951755|re  PVISDIQLLRRATD---------------VPIVAITGSNAKSTVTTLFGLMAKDAGKKVA
gi|184156588|re  SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|226711953|sp  SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|213155698|re  SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|215484924|re  SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|169634628|re  SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
gi|169797488|re  SVVGDIQLLRRATD---------------VPIVAITGSNAKSTVTTLIGLMAKDAGKKVA
REFERENCEGOS_91  --------------------------------------NGKSTVTRMVERILQECGLDAV
gi|62900496|sp|  RVFGDLDLFACCVR---------------APVVAITGANGKSTVTTLVGLMAKAAGVNAA
gi|114321344|re  PLIGEIELFARHAD---------------APVAAITGSNGKSTVTTLVGRMAEAAGRRVA
gi|82703611|ref  PVVGDMELFACAVG---GTG------GGMPKLVGITGSNGKTTVTAMTGAMLKKAGWDVE
gi|30248992|ref  PVIGDIELFAVALD---QYA------PPGTKILAITGSNGKTTVTSMVGEMVKNAGWDVE
gi|60390554|sp|  PVIGDIELFAVALD---QYA------PPGTKILAITGSNGKTTVTSMVGEMVKNAGWDVE
gi|114330275|re  SVIGDIELFAIALD---QHA------PPGTKILAITGSNGKTTVATMVGEMARNTGWDVE
gi|225023739|re  RVLGDVEILAHELS------------GKRNKIIAITGSNGKTTVTSLVGHLCRECGLDTV
gi|218768812|re  RVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|161870654|re  RVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|226727514|re  RVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|225372572|re  RVLGDIELLAGIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|225364676|re  CVLGDIELLADIVN------------RRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV
gi|91776623|ref  PVVGDVELFAQARS-------------AHAKVIAITGANGKSTVTTLVGEICKAAGFKTV
gi|74316135|ref  EAVGDVELFARALAVLNAQRAALPAPQAAMRVIAITGSNGKSTVTAMCGDMCRMAGLTVC
gi|226941971|re  EVIGDVEVFARAIA------------PLAIPVIAITGSNGKTTVTSLAGHLVAACGRRGV
gi|224826076|re  EVVGDVELFARAIA------------GSGSKVIAITGSNGKSTVTSLVGHLCRQAGLDTV
gi|34499800|ref  EVVGDIEILARAIQ------------GDGSKVIAITGSNGKSTVTSLVGHLCEAAGLDTV
gi|119897173|re  PITGEMALFAQALTDLGA--------RDATRILAITGTNGKTTTTALTAALAQSAGLDAV
gi|121606308|re  PCGNELSLFAQALADLKEDL------AYAPKVVGITGTNGKTTVTSLTGQLIERAGKSVA
gi|152980553|re  PVWGEIELFAQALAALKEDK------GYAPKVIAITGTNGKTTVTSLVGLLCQRAGLTVQ
gi|73542665|ref  PVWGEIELFARALAHLQAES------GYAPKVLAITGTNGKTTTTALTGRLVERAGKSVA
gi|194290815|re  PVWGEIELFVRALRHLEAES------GYAPKLLAITGTNGKTTTTALTGRLVERAGKSVA
                                                       ######################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  VGGNIGVPLLDLLS----------SGDEVDVIVLEVSSFQLELAGDFSPHIALLLNLSPD
gi|62900515|sp|  VGGNIGVPLLDLLS----------SGDEVDVIVLEVSSFQLELAGDFSPHIALLLNLSPD
gi|162449933|re  VGGNFGTPLAEVVDQT------------WDVLVLEISSFQAERVPTLHARAHALLNITDD
gi|77919798|ref  VGGNLGTPLIEATRSTD-----------WDWIVAEISSFQLEAIDTFRPRYGMLLNLTAD
gi|62900554|sp|  VGGNIGNPLIELVE----------TGAAVDRVVVEISSFQLEWIRSFRPTVAVLLNITED
gi|39998162|ref  VGGNIGNPLIELVE----------TGAAVDRVVVEISSFQLEWIRSFRPTVAVLLNITED
gi|222053879|re  VGGNIGNPLIELVT----------SGNDVAQVVVELSSFQLEGIQRFRPKVAVLLNITED
gi|94269090|ref  VGGNLGVPLAQYLAGP----------QEADWVVLEVSSFQLDTAGAFRPQIGVLLNISPD
gi|160872723|re  VGGNIGKPALDLLNEPV-----------PDFYVLEISSFQLETTYSLRPKLASILNISPD
gi|226951755|re  VGGNLGRPALDLLKDQ------------PELIVLELSSFQLETTSHLNAEVAVLLNMSED
gi|184156588|re  VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|226711953|sp  VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|213155698|re  VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|215484924|re  VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|169634628|re  VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
gi|169797488|re  VGGNLGRPALDLLKDQ------------PELLVLELSSFQLETTSHLNAEVAVVLNMSED
REFERENCEGOS_91  AVGNIGVPVLEVLEQIE-----RRARKMPDVFVLEMSSFQIDTTYSFECDAAVVLNVSED
gi|62900496|sp|  VGGNLGTPMLDLLDAA------------AELYVLELSSFQLERSELFEADVATVLNISPD
gi|114321344|re  VGGNLGTPALALLDGE----------TRPDAYILELSSFQLETTHSLAPRVAAVLNISAD
gi|82703611|ref  VAGNIGPAVLDALMRRE------DTGKMPQAWVLELSSFQLETTKSLGLDAAAVLNVSED
gi|30248992|ref  VAGNIGPAALDALMQRM------DANKWPHLWALELSSFQLETTSSLRPDAATVLNLSED
gi|60390554|sp|  VAGNIGPAALDALMQRM------DANKWPHLWALELSSFQLETTSSLRPDAATVLNLSED
gi|114330275|re  VAGNIGLAALDALMQRI------DTGKWPHLWVLELSSFQLETTSSLRPNAAVVLNLSED
gi|225023739|re  VAGNIGTPVLEAYEDR--------QEQSADVWVLELSSFQLENTDHLNAAAAAVLNISED
gi|218768812|re  IAGNIGAPVLEAELQR--------EGKKADVWVLELSSFQLENTESLRPTAATVLNISED
gi|161870654|re  IAGNIGTPVLEAEWQR--------EGKKADVWVLELSSFQLENTESLRPTAATVLNISED
gi|226727514|re  IAGNIGTPVLEAELQR--------EGKKADVWVLELSSFQLENTESLRPTAATVMNISED
gi|225372572|re  IAGNIGTPVLEAELQR--------EGKKADMWVLELSSFQLENTESLRPTAATVLNISED
gi|225364676|re  IAGNIGTPVLEAELQR--------EGKKADVWVLELSSFQLENTESLRPTAATVLNISED
gi|91776623|ref  VAGNIGLPVLDVINDA------------VDVYVLELSSFQLETTYSLAADAATVLNISAD
gi|74316135|ref  VAGNIGLPVLDALHEIE-----QGAAPLPQVWVLELSSFQLETTSSLDATAAAVLNLSED
gi|226941971|re  VAGNIGLAVLDALADIE------ASGELPECFVLELSSFQLETTTSLNAIAATTLNISED
gi|224826076|re  LAGNIGLPVLDALGERE------ASGKRPDVWVLELSSFQLETTTSLNADAATVLNISED
gi|34499800|ref  VAGNIGLAVLEALLARE------QSGKRPDVWVLELSSFQLESTFSLAADAATVLNISED
gi|119897173|re  AAGNISPAALDVLMARL-----DAGQALPQCWVLELSSFQIETAQALDADAATVLNVTDD
gi|121606308|re  VAGNIGPTLLDTLTGKLDEHARDPSAALPEFWVLELSSFQLDGVTNFEPDVATVLNITQD
gi|152980553|re  VAGNISPAALDKLHQVL------TDDQLPQVWVLELSSFQLHTTYSLQADVATVLNLTQD
gi|73542665|ref  VAGNISPSALDKLSACI------ASATLPDVWVLELSSFQLETTHTLAPHAATVLNVTQD
gi|194290815|re  VAGNISPSALDKLSACI------ASASLPEVWVLELSSFQLETTHTLAPHAATVLNVTQD
                 ##########                      ############################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  HLDRHGDLAGYRAAKMHLFQKQGMTD-IAIVSGDDPLCLLS------DGCGEASRYLFGF
gi|62900515|sp|  HLDRHGDLAGYRAAKMHLFQKQGMTD-IAIVSGDDPLCLLS------DGCGEASRYLFGF
gi|162449933|re  HLDRYASFAAYADAKGNPFERMTPDD-VAVVPFGDELVARQ------AARGRARVVTFSA
gi|77919798|ref  HLDRYAGMGEYVAAKLRLFENMTAED-VAVVNADDALVVRS------TTDLPCRKIPFSS
gi|62900554|sp|  HLDRYATYQEYIDAKARIFKNQTASD-WAVLNVDDPIVAGL------AGRTCAAVFPMSR
gi|39998162|ref  HLDRYATYQEYIDAKARIFKNQTASD-WAVLNVDDPIVAGL------AGRTCAAVFPMSR
gi|222053879|re  HLDRYASYQDYIDAKLRIFENQTVDD-FAVLNVDDPLVAAC------AATVKSRVFPFSQ
gi|94269090|ref  HLDRYPDYQAYAASKWRLFAHQRATD-WAVLNGADPEIARLAV----AAPPVARRLDFNC
gi|160872723|re  HLDRHKTLTAYINAKQRIY---HQAD-IALWNRDDLNTFPQ-------ARTKKIIS-FGL
gi|226951755|re  HLDRHGDMLGYHKAKHRIF---QGVK-KVVYNRDDSLSRPL------VPDVTPMQS-FGL
gi|184156588|re  HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|226711953|sp  HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|213155698|re  HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|215484924|re  HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|169634628|re  HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
gi|169797488|re  HLDRHGNMLGYHQAKHRIF---QGAK-KVVFNRDDALSRPL------VPDTTPMQS-FGL
REFERENCEGOS_91  HLDRYRDFDAYLRSKCRIH---SGRG-IKVVNRDEPIVLNE-------IAGEDSVS-FGL
gi|62900496|sp|  HMDRYPDLASYAEAKRRVF---RGEG-LMVLNQDDPLVAAM------YRPGRRAVR-FGL
gi|114321344|re  HMDRHGSVSAYAGIKARIF---HGAG-VQVLNLDDPVVAAM------AQPGRTVLG-FSL
gi|82703611|ref  HLDRYAGMQEYAAAKARIFLG-DSEG-VQILNGDDPVVRQM------TLAGRPHVT-FSL
gi|30248992|ref  HLDRYDSIEEYAAAKARIFSRPHNNGCVQILNRDDARVYAM------ADKNSKQVT-FGL
gi|60390554|sp|  HLDRYDSIEEYAAAKARIFSRPHNNGCVQILNRDDARVYAM------ADKNSKQVT-FGL
gi|114330275|re  HLDRYRIIEEYAAAKARIFPDPHNSC-VQVLNREDARVYAM------AHENSKQLT-FGL
gi|225023739|re  HLNRYDDLLDYAHAKDKIF---RGSG-VQVINADDALCRAM------KRSGREVRR-FSL
gi|218768812|re  HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|161870654|re  HLDRYDDLLDYAHTKDKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|226727514|re  HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDVFCRAM------KRAGREVKR-FSL
gi|225372572|re  HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|225364676|re  HLDRYDDLLDYAHTKAKIF---RGDG-VQVLNADDAFCRAM------KRAGREVKW-FSL
gi|91776623|ref  HMDRYADMQAYANAKARIF---TRAG-LQVLNADDAWSRGM------AAEGVAQLT-FGL
gi|74316135|ref  HMDRYPDMAAYAAAKARIF---SGNG-VQVLNRDDPRTLAM------AIPGRHVVS-FGL
gi|226941971|re  HLDRYRDLLAYADSKAAVF---NGGG-VQVLNRDDLFVRAM------ARPQRRHVW-FSL
gi|224826076|re  HLDRYADLLDYAHSKTAVF---NGRG-VQVLNRDDALVRAM------VRPGHAQRW-FSL
gi|34499800|ref  HLDRYADLLDYAHAKTRVF---NGKG-VQVLNKDDALVRAM------VRPGHPVKW-FSL
gi|119897173|re  HLDRYADLADYAATKARIF---QGRG-AQVLNREDARVAAM------VLSGRKVVR-FGT
gi|121606308|re  HLDWHETLPAYAAAKSHVY---GRSG-LMLLNRNDPLVMTAVPALVKGKPGRSYLT-FGG
gi|152980553|re  HLDWHGDMAAYADDKARIF---GSNT-IRVLNRDDALVMQM------SSPLSKVIT-FGA
gi|73542665|ref  HLDWHGSMEAYAASKARIFGPAGTAC-VQVLNRNDRLTMDM------ARPGTAPVT-FGT
gi|194290815|re  HLDWHGSMEAYAASKARIFGPAGHAC-VQVLNRNDRLTLDM------ARPGSTPVT-FGI
                 ###################                                         


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  -S---A-----------ASDISVAA--GHFEFDFAG------------------------
gi|62900515|sp|  -S---A-----------ASDISVAA--GHFEFDFAG------------------------
gi|162449933|re  -----R-----------DARADVSAAGGAIVDRVTG------------------------
gi|77919798|ref  -S---R-----------VLDEGMGFDGQHIVWRHAG------------------------
gi|62900554|sp|  -Q---R-----------ELGEGIFYRDGAIIFRHAG------------------------
gi|39998162|ref  -Q---R-----------ELGEGIFYRDGAIIFRHAG------------------------
gi|222053879|re  -R---K-----------ELAEGIFCSKGIIVYRWQG------------------------
gi|94269090|ref  QPQPEGRATAIDDEITMTGGAWSASTPAGARLLVNVYSLLKQPVTGPGERLPLPTPAAGA
gi|160872723|re  TTTTPH-----------AHEFYLYNS-HQKNFIAKG------------------------
gi|226951755|re  -NAP-D-----------MNQYGVLREADGSMWLARG------------------------
gi|184156588|re  -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|226711953|sp  -NAP-D-----------LNQYGVLRDADGTLWLACG------------------------
gi|213155698|re  -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|215484924|re  -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|169634628|re  -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
gi|169797488|re  -NAP-D-----------LNQYGVLRDADGTLWLARG------------------------
REFERENCEGOS_91  -SPPDN-----------DRSWGVSKI-AGEQWVACG------------------------
gi|62900496|sp|  -GSG-D-----------ELDYSLARW-EGRAWLLAK------------------------
gi|114321344|re  -ASNPR-----------RG-AGVADH-RGAPWLHLN------------------------
gi|82703611|ref  -ATPQS-----------ADDFGLLRE-GGDTWLMQG------------------------
gi|30248992|ref  -SAPVS-----------DEEFGLLPG-GSDVWLAQG------------------------
gi|60390554|sp|  -SAPVS-----------DEEFGLLPG-GSDVWLAQG------------------------
gi|114330275|re  -SAPAF-----------DDEFGVLPS-GSDLWLAQG------------------------
gi|225023739|re  -Q---Q-----------ETDYWFDAASG---YLKHG------------------------
gi|218768812|re  -E---Y-----------EADFWLERETGR---LKQG------------------------
gi|161870654|re  -E---Y-----------EADFWLERETGR---LKQG------------------------
gi|226727514|re  -E---H-----------EADFWLERGTGC---LKQG------------------------
gi|225372572|re  -E---H-----------KADFWLERETGC---LKQG------------------------
gi|225364676|re  -E---H-----------EADFWLERETGC---LKQG------------------------
gi|91776623|ref  -DAPRS-----------AQDFGLLHD-AGEAWLARG------------------------
gi|74316135|ref  -DRCPT-----------DENFGLCED-E----LCLG------------------------
gi|226941971|re  ED---A-----------GADYALAER-DGRHWLCAG------------------------
gi|224826076|re  -K---E-----------TADYALRQD-AGRYWLTVA------------------------
gi|34499800|ref  -N---G-----------AADYALARN-GG-YWLKVD------------------------
gi|119897173|re  -DAPQN-----------PADYGLVED-AGRCWLVRG------------------------
gi|121606308|re  -DEPKR-----------PGDYGIETV-NGMAWLVRA-----AEADETIKRRKAEE-----
gi|152980553|re  -DEAEQ-----------ADCFGLVDE-NGMRWLSVA-----VEEEEPQKKRRKKDNVE--
gi|73542665|ref  -DLPET-----------PGSFGVLRE-GGMPWLVLAEPDSEAEGEGKPRRRKADATAQEA
gi|194290815|re  -DLPEV-----------PGSFGILRE-GGMPWLVLAEPDPDAEGEGKPRGRKAAEAVQEA
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  ----QREIYSLRDSALDNRTGWLNAAPAAFIAR-SLACAKADIERGIAAFTLDAHRMEPV
gi|62900515|sp|  ----QREIYSLRDSALDNRTGWLNAAPAAFIAR-SLACAKADIERGIAAFTLDAHRMEPV
gi|162449933|re  ------ARYPLDRVRLAGAHNLANACASAALAA-ALGAPAAAIGDALSSFEGLAHRTALV
gi|77919798|ref  ----RQERFDVADLQLKGLHNVENVMAALIPPL-MEGCPTDIAWKAVCGFSGLDHRMVLV
gi|62900554|sp|  ----RQERFPTDRFRITGVHNIENIMASLAAAL-LLGCDADRALACVEAFGGLPHRMELV
gi|39998162|ref  ----RQERFPTDRFRITGVHNIENIMASLAAAL-LLGCDADRALACVEAFGGLPHRMELV
gi|222053879|re  ----SELRFDTAAFKLKGVHNIENIMAALASTL-LSGADPIKAGRAVESFKGLRHRMEFI
gi|94269090|ref  DPIPPEVYEPGPELAVE--PNLQNAQAAILAAR-LAGCSSSAVVAGLRAFKSLPHRLALV
gi|160872723|re  ----HDRLLPVDALFIQGRHNWANAIAALTIGH-AIGLPTKAMLTALCEFKGLPHRCQWV
gi|226951755|re  ----RERLIKTSDLYIQGMHNVANALACLALGE-AIGLPTQSMLETLQQFKGLEHRCEYV
gi|184156588|re  ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKRFKGLEHRCEYV
gi|226711953|sp  ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|213155698|re  ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|215484924|re  ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|169634628|re  ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
gi|169797488|re  ----LQRLIKSSDLYIQGMHNVANALACLALGE-AIGLPMESMLETLKQFKGLEHRCEYV
REFERENCEGOS_91  ----SQQIFRCEDLRVSGMHNVCNAMAALALSS-TLVSVNEDAIRGLLSYEGLDHRMQWV
gi|62900496|sp|  ----GVPLLPADEVRIKGRHNLANALAAVAIAD-ACGFDRQAMVGVLRTFPGLDHRMQWV
gi|114321344|re  ----GEPVLPAADLRLPGLHNRANALAALCLGQ-GLGLPVAAMAEALRRFTGLPHRTEWV
gi|82703611|ref  ----DTRLMDARELAITGRHNCANALAALALCR-ALAVPFEPLLQALREFRGLPHRVEKV
gi|30248992|ref  ----STHLLKTSELAVAGLHNAANALAALALCR-AVDLPFEPLLHALRTFRGLPHRMQKV
gi|60390554|sp|  ----STHLLKTSELAVAGLHNAANALAALALCR-AVDLPFEPLLHALRTFRGLPHRMQKV
gi|114330275|re  ----TTRLMKVSELAVAGLHNAANALAALALCR-AIDLPFEPLLHALHIFKGLPHRMQKI
gi|225023739|re  ----AETLIAAADIPLQGLHNAANVLAALALCE-AIGLPREQLLRHVRTFKGLPHRVEKI
gi|218768812|re  ----NEDLIATQDIPLQGLHNATNVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|161870654|re  ----NEDLIATQDIPLQGLHNATNVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|226727514|re  ----NEDLISTQDIPLQGLHNAANVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|225372572|re  ----NEDLIATQDIPLQGLHNAANVMAAIALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|225364676|re  ----DEDLIATQDIPLQGLHNAANVMAAVALCE-AVGLPREALLEHVKTFQGLPHRVEKI
gi|91776623|ref  ----QRKLMPVADLNITGLHNAANALAALALCT-VLDIDEVVALQALRDFKGLPHRVQWV
gi|74316135|ref  ----GDMLMPLSVLAVPGLHNAANALAALALTR-ALDLPIEALLRGLMHFKGLPHRVEKV
gi|226941971|re  ----GEALLPFDAMQLVGLHNAANALAALALCE-AAGLPRAGLLAGLTTFKGLAHRVEHV
gi|224826076|re  ----GEAVFDCAEMSLQGLHNAANALAALALTE-AIGLPRAALLEGLKTFTGLAHRVEFV
gi|34499800|ref  ----GEKVFDCADMQLQGLHNAANALAALGLCQ-GIGLPLEKLLDGLKTFRGLAHRVELV
gi|119897173|re  ----GERLLALDELALAGRHNAANALAALALCETGLGLAPAQLLAGLRAFRGLPHRVELV
gi|121606308|re  LVLHIQRLMPLEALRIQGRHNATNALAALGLAV-AVGCPLAPMLHGLREYRGEPHRVESV
gi|152980553|re  LAVSTNKLMPVDALKIRGQHNAINALSALALCR-AIGLPFAQLLHGLRDYHGEPHRVEHV
gi|73542665|ref  VPVRHKRLMPADALHIRGMHNATNAMAALALCR-AIDLPLNALLHGLREYRGEPHRVEWV
gi|194290815|re  VPVRHKRLMPADALHIRGMHNATNAMAALALCR-AIDLPMNALLHGLREYRGEPHRVEWV
                                    ############   ##########################


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  AS-IAGVQYYNDSKATNTGAVISALQQL--------VRVILIAGGRDKGDNYRLLREAVA
gi|62900515|sp|  AS-IAGVQYYNDSKATNTGAVISALQQL--------VRVILIAGGRDKGDNYRLLREAVA
gi|162449933|re  AD-VDGVRYYDDSKGTNVGASVAALSGLL------EAKAVLIAGGRDKLGDYAPLVSALR
gi|77919798|ref  RE-IDGVSWYDDSKGTNVGSVVKSLAGL-------QGPVTLIAGGKDKGGDYAPLAGLIG
gi|62900554|sp|  RE-LNGVRYFEDSKATNVGSVEKALASF--------NDITLIAGGKDKGGSYAPLAGLVA
gi|39998162|ref  RE-LNGVRYFEDSKATNVGSVEKALASF--------NDITLIAGGKDKGGSYAPLAGLVA
gi|222053879|re  RE-VGGVAYYEDSKGTNVGSVVKSLESF-------DKGITLIAGGKDKGGSYAPLADLVR
gi|94269090|ref  AS-IAGVDYYDDSKATNIGAVVSALQGL-------AQPVILIAGGLDKGGDYKLLLPVLK
gi|160872723|re  KE-FKGVTWYNDSKATNVGATLAALNGLGPSI---SGKIILIAGGLSKNADFSLLHNPVK
gi|226951755|re  QT-VDQVRYYNDSKGTNVGATLAAIEGLGAAIEAKHGKLALILGGQGKGQDFKPLRNAIQ
gi|184156588|re  KT-VRDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIE
gi|226711953|sp  KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIE
gi|213155698|re  KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFGPLRSSIE
gi|215484924|re  KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFGPLRSSIE
gi|169634628|re  KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIE
gi|169797488|re  KT-VHDVRYYNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFGPLRSSIE
REFERENCEGOS_91  AD-ISGVQFYNDSKATNVGATAAAISGL-------PAKCVLLLGGESKQQNFEILVDYIR
gi|62900496|sp|  AD-IGGVAYVNDSKATNVGACIAALSGL-------EGKVVLIAGGDGKGADFSSLVPVAA
gi|114321344|re  AE-HAGVRWYNDSKGTNVGAAVAAIRGL-------AGPVVLIAGGDGKGADFLPLADALR
gi|82703611|ref  AA-FSGITFYDDSKGTNVGATVAALKGL-------GQPVVLIAGGDGKAQNFSPLAAPIG
gi|30248992|ref  AE-FNGVTFYDDSKSTNIGSAVAALNGF-------RKNVILIAGGDGKGQDFSPLEQPVS
gi|60390554|sp|  AE-FNGVTFYDDSKSTNIGSAVAALNGF-------RKNVILIAGGDGKGQDFSPLEQPVS
gi|114330275|re  AE-FNGVTFYDDSKSTNVGSAVAALNGF-------RKNVILIAGGDGKGQDFSPLEQPVS
gi|225023739|re  GE-KNGVVFIDDSKGTNVGATEAAIAGL-------QSPLFLIAGGQGKGQDFTPLKNVLP
gi|218768812|re  GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALA
gi|161870654|re  GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALA
gi|226727514|re  GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALK
gi|225372572|re  GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALA
gi|225364676|re  GE-KNGVVFIDDSKGTNVGATAAAIAGL-------QNPLFVILGGMGKGQDFTPLRDALK
gi|91776623|ref  AD-IDGVSFYDDSKGTNVGATVAALHGL-------NRKLVLIAGGDGKGQDFAALRAPVA
gi|74316135|ref  AD-IDGVTWYDDSKGTNVGATEAALYGMG------RRKAVVILGGDGKGQDFGPLKAAVA
gi|226941971|re  LT-HEGVDFIDDSKGTNVGATEAALKGM-------TRPVVLIAGGDGKGQDFSPLAPALA
gi|224826076|re  AE-VHGVRYIDDSKGTNVGATEAALNGM-------TRPVVLIAGGDGKGQDFSPLKPACA
gi|34499800|ref  DE-FDGIAFIDDSKGTNVGATEAALNGM-------TRQVVLIAGGDGKGQDFAPLKPACQ
gi|119897173|re  AERADGVRYYDDSKGTNVGATVAALDGL-------GGRVVLIAGGDGKGQDFSPLAPVLT
gi|121606308|re  AV-LEGIEYFDDSKGTNVGATVAALAGLGS-----ERKLVLILGGEGKGQDFSPLADPVA
gi|152980553|re  MT-IGGVDYYDDSKGTNVGATVAALNGLGASQDGASNHLVLIAGGDGKGQDFSPLADPVA
gi|73542665|ref  AT-IDEVEYFDDSKGTNVGATVAALSGL-------DKRVVLIAGGEGKGQDFSPLAAPVA
gi|194290815|re  AT-IDDVEYFDDSKGTNVGATVAALSGL-------DKRVVLIAGGEGKGQDFSPLAAPVA
                      ######################             ####################


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
gi|51246751|ref  GHVRTLICIGEATPLLVAALEDV-VQVYRATSLAEAVSLAASFAEEGDSVLLSPACASFD
gi|62900515|sp|  GHVRTLICIGEATPLLVAALEDV-VQVYRATSLAEAVSLAASFAEEGDSVLLSPACASFD
gi|162449933|re  ERGRALVVLGEAADRIAAAAAGV-LPIARAGSMAEAVLAARSLARPGDAVLLSPACSSFD
gi|77919798|ref  EKVEHLILIGQAADRMQAAFQGM-TTILRADSLEAAVQQAQQVTMAGGTVLLSPGCSSFD
gi|62900554|sp|  ERVRHMILIGEAKDRMARELGHL-TDTRMAVTLEDAVELAASLTQPGGVVLFSPACSSFD
gi|39998162|ref  ERVRHMILIGEAKDRMARELGHL-TDTRMAVTLEDAVELAASLTQPGGVVLFSPACSSFD
gi|222053879|re  ERVKHLILIGEAKERIEAELGNL-TDTHKAATLEDAVAIAHRLAKAGEVVLFSPACSSFD
gi|94269090|ref  EKVRAVVLIGSARARMAAALEGS-VPLTQAEDLPAAVAKAAELAAPGEAVLLSPACASFD
gi|160872723|re  HYVKKIILIGRDAALLKNTLEKS-TAIQTVSDLRHAVNLAHETARRGDIVLLSPACASLD
gi|226951755|re  KYVKTVILIGEDAAMIEQALHNT-TQIQHASSLKQAVDIAHQATQAEDVVLLSPACASFD
gi|184156588|re  KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|226711953|sp  KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|213155698|re  KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|215484924|re  KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|169634628|re  KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
gi|169797488|re  KYAKVVVLIGEDAPVIEQAIQGA-TKILHAATLKEAVELCQRETQAEDVVLLSPACASFD
REFERENCEGOS_91  EKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLAEPGEIV----------
gi|62900496|sp|  EKLRAAVLMGRDGPLIDEVLKGV-VPTIRVKTMFEAVRAARGVAQSGDTVLLAPACASLD
gi|114321344|re  EKGRAAVLIGRDAPRLAQVLSGV-VPVERAADMRDAVRRAANLARSGDAVLLSPACASFD
gi|82703611|ref  EHGRAVVLIGRDAEKIAVAINECGVPLHRAQTMEEAVRKSFQLAREGDAVLMSPACASFD
gi|30248992|ref  KHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQVSFLLAEHGDVVLLSPACASLD
gi|60390554|sp|  KHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQVSFLLAEHGDVVLLSPACASLD
gi|114330275|re  KHTRGVVLLGRDAEKISQAIQGCNVPVHRVATMDEAVRVSFLLAERGDSVLLSPACASLD
gi|225023739|re  GKARAVLLIGEDAPQIRRDLAGCGVEMMDCASLQEAVQTAYRLAEPGDIVLLSPACASFD
gi|218768812|re  GKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQKAYAQAEAGDIVLLSPACASFD
gi|161870654|re  GKAKGVFLIGVDALQIRRDLDGCDLNMTDCATLEEAVQKAYAQAEAGDIVLLSPACASFD
gi|226727514|re  DKAKGVFLIGVDAPQIRRDLDGCGLNLTDCVTLEEAVQTAYAQAEAGDIVLLSPACASFD
gi|225372572|re  GKAKGVFLIGVDAPQIRRDLDGCGLNMIDCATLEEAVQKAYAQAEAGDIVLLSPACASFD
gi|225364676|re  DKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEAVQTAYTQAEAGDIVLLSPACASFD
gi|91776623|ref  KHARAVVLIGRDAGVIADALQESGVLLEYGDTLEEAVVKAFNLADRGDAVLLSPACASLD
gi|74316135|ref  ANARAVVLIGRDAVAIEAAIEDSGVASYRADTLPDAVEQAARLAEPGDAVLLSPACASFD
gi|226941971|re  RIGRAVLLIGRDAPVVRQALAGLALPLIDCATLEEATRRGFELAQPGDVVLLSPACASFD
gi|224826076|re  RIARAVLLIGRDAGKIRAVLEGLPLPIVDCATLEEATREAARLAEAGDVVLLSPACASLD
gi|34499800|ref  RIARAVLLIGRDAGRIEAALEDSGLALERCDTLEEATRRAAALARPGDVVLLSPACASLD
gi|119897173|re  RHARAVVLIGRDAKLIEAAVAGCGVPLEHAADLDTAVLRANALARPGDAVMLSPACASLD
gi|121606308|re  RYVRVVVLIGRDAPLIRAALQGSRVELLDAASMQEAVSLAAGQARPGDAVLMSPACASFD
gi|152980553|re  KYARAVILIGKDADNIRAALQATGVDMINCTTLEEATQKAAELAQSGDAVLLSPACASLD
gi|73542665|ref  QYARAVVLIGRAAGELRDALQGSGASLVDAATLEEAVNKAAELAEGGDVVLLSPACASLD
gi|194290815|re  QYARAVVLIGRAAAELRDALQGSGATLVDAATLEEAVTQAAGLAEAGDAVLLSPACASLD
                 ######################       #####################          


                        550       560       570       580
                 =========+=========+=========+=========+==
gi|51246751|ref  MFANYQDRGEQFRRQVLQLQDVGSK-----------------
gi|62900515|sp|  MFANYQDRGEQFRRQVLQLQDVGSK-----------------
gi|162449933|re  MFRDYKDRGDAFVRAVRELQGAAGGAAGEVAS----------
gi|77919798|ref  MFRSYAERGEVFCRAVQALQGNG-------------------
gi|62900554|sp|  MFRDYEERAQRFRAAVDALSPGGTP-----------------
gi|39998162|ref  MFRDYEERAQRFRAAVDALSPGGTP-----------------
gi|222053879|re  MFKDYAERAERFNAAVRALAGGDCR-----------------
gi|94269090|ref  MFSGYAQRGEVFRQAVAELRKNLASGGGQSARGCPVMEAMVQ
gi|160872723|re  MFKNYEERGDVFMRLARGIH----------------------
gi|226951755|re  MFKSYNDRGHQFVACVHALNGNKN------------------
gi|184156588|re  MFKSYNDRGQQFVACVNSLV----------------------
gi|226711953|sp  MFKSYNDRGQQFVACVNSLV----------------------
gi|213155698|re  MFKSYNDRGQQFVACVNSLV----------------------
gi|215484924|re  MFKSYNDRGQQFVACVNSLV----------------------
gi|169634628|re  MFKSYNDRGQQFVACVNSLV----------------------
gi|169797488|re  MFKSYNDRGQQFVACVNSLV----------------------
REFERENCEGOS_91  ------------------------------------------
gi|62900496|sp|  QYEDYQERGRDFAATVRSLA----------------------
gi|114321344|re  MFRGFEHRGEAFRDAVREVAHG--------------------
gi|82703611|ref  MFDNYVHRAEAFVAAVRSMQAARAGGNSAGVAGRH-------
gi|30248992|ref  MFNNYIHRAEVFTAAVRLIERKFVLTAQTCH-----------
gi|60390554|sp|  MFNNYIHRAEVFTAAVRLIERKFVLTAQTCH-----------
gi|114330275|re  MFNNYIHRAEVFTTAVQGIEHKFILTAQTCH-----------
gi|225023739|re  MFKGYAHRSQVFIEAFEAL-----------------------
gi|218768812|re  MFKGYAHRSEVFIGAFKAL-----------------------
gi|161870654|re  MFKGYAHRSEVFIGAFKAL-----------------------
gi|226727514|re  MFKGYAHRSEVFIEAFKAL-----------------------
gi|225372572|re  MFKGYAHRSEVFIEVFKAL-----------------------
gi|225364676|re  MFKGYAHRSEVFIEAFKAL-----------------------
gi|91776623|ref  MFRNYVHRAEVFVKAVTDLQKKEVSA----------------
gi|74316135|ref  MFRNYVHRAEVFVDAVKKLAAQRAQV----------------
gi|226941971|re  MFRGYAHRAEVFIACARELAGVQP------------------
gi|224826076|re  MFKNYAHRAQVFIDGVRALQAGNAA-----------------
gi|34499800|ref  MFKNYAHRAQVFIDTVAAVKAARA------------------
gi|119897173|re  MFRNYAHRAEVFIAAVRRLPEVSPR-----------------
gi|121606308|re  MFDNYEHRARVFCEAVQELAVEQGAVL---------------
gi|152980553|re  MFKNYAHRAQVFVDEVREIGLSRGEVSA--------------
gi|73542665|ref  MFRNYVHRAEVFRSAVEELALSRGIMP---------------
gi|194290815|re  MFRNYVHRAEVFRGAVEELALSRGILP---------------
                                                           






Parameters used
Minimum Number Of Sequences For A Conserved Position: 20
Minimum Number Of Sequences For A Flanking Position: 33
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 7 selected block(s)
Flanks: [159  190]  [213  259]  [380  391]  [395  420]  [426  447]  [461  502]  [510  530]  

New number of positions in input.fasta-gb:  202  (34% of the original 582 positions)




Protein Domains

PROTOCOL



a) Interproscan, default parameters.


b) Scanprosite, default parameters.


RESULTS ANALYSIS


Interproscan reveals a central catalytic domain and a C-terminal peptide-binding domain of MUR ligase.

Although it is marked as unintegrated, I am taking the UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE as main

domain since it includes the two other domains, has a low e-value (5.5e-63) and is exceedingly present in the different blast results.

RAW RESULTS

a) Interproscan

GOS_916040	662E3309CEB7C6C2	305	superfamily	SSF53623	MurD-like peptide ligases, catalytic domain	1	193	3.4e-39	T	28-Apr-2009	IPR013221	Mur ligase, central	Molecular Function: ATP binding (GO:0005524), Biological Process: biosynthetic process (GO:0009058)
GOS_916040	662E3309CEB7C6C2	305	superfamily	SSF53244	MurD-like peptide ligases, peptide-binding domain	195	305	6.7e-25	T	28-Apr-2009	IPR004101	Mur ligase, C-terminal	Molecular Function: ATP binding (GO:0005524), Biological Process: biosynthetic process (GO:0009058), Molecular Function: ligase activity (GO:0016874)
GOS_916040	662E3309CEB7C6C2	305	HMMPanther	PTHR23135:SF2	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE	1	305	5.5e-63	T	28-Apr-2009	NULL	NULL	
GOS_916040	662E3309CEB7C6C2	305	HMMPanther	PTHR23135	MUR LIGASE FAMILY MEMBER	1	305	5.5e-63	T	28-Apr-2009	NULL	NULL	
GOS_916040	662E3309CEB7C6C2	305	HMMPfam	PF08245	Mur_ligase_M	1	176	1e-38	T	28-Apr-2009	IPR013221	Mur ligase, central	Molecular Function: ATP binding (GO:0005524), Biological Process: biosynthetic process (GO:0009058)
GOS_916040	662E3309CEB7C6C2	305	HMMPfam	PF02875	Mur_ligase_C	196	271	6.7e-10	T	28-Apr-2009	IPR004101	Mur ligase, C-terminal	Molecular Function: ATP binding (GO:0005524), Biological Process: biosynthetic process (GO:0009058), Molecular Function: ligase activity (GO:0016874)
GOS_916040	662E3309CEB7C6C2	305	Gene3D	G3DSA:3.40.1190.10	no description	1	195	1.5e-38	T	28-Apr-2009	IPR013221	Mur ligase, central	Molecular Function: ATP binding (GO:0005524), Biological Process: biosynthetic process (GO:0009058)
GOS_916040	662E3309CEB7C6C2	305	Gene3D	G3DSA:3.90.190.20	no description	196	305	5.1e-24	T	28-Apr-2009	IPR004101	Mur ligase, C-terminal	Molecular Function: ATP binding (GO:0005524), Biological Process: biosynthetic process (GO:0009058), Molecular Function: ligase activity (GO:0016874)

b) Scanprosite

No hit!

Phylogeny

PROTOCOL


Phylogeny.fr, à la carte, default options (Muscle, Gblocks), except "workflow run" set to "step by step", phyML.


Ingroup: Betaproteobacteria + Gammaproteobacteria


Outgroup: Delta/epsilon proteobacteria


RESULTS ANALYSIS


The tree is consistent with the tree of life, clearly separating Betaproteobacteria from Gammaproteobacteria and Delta/Epsilon proteobacteria. The query sequence is between different Betaproteobacteriae, adjacent to Thiobacillus denitrificans.


RAW RESULTS

                                                                                                        -----0.2---
 
                                                                            +Desulfotalea_psychrophila_LSv54_gi_51246751 (DELTA/EPSILON PROTEOBACTERIA)
                                       +------------------------------------+
                                       |                                    +Desulfotalea_psychrophila_gi_62900515 (DELTA/EPSILON PROTEOBACTERIA)
                            +----------+
                            |          +-------------delta_proteobacterium_MLMS-1_gi_94269090   (DELTA/EPSILON PROTEOBACTERIA)
                            |
                      +-----+             +--------------------Pelobacter_carbinolicus_DSM_2380_gi_77919798   (DELTA/EPSILON PROTEOBACTERIA)
                      |     |             |
                      |     |             |                 +Geobacter_sulfurreducens_gi_62900554               (DELTA/EPSILON PROTEOBACTERIA)
                      |     +-------------+         +-------+
        +-------------+                   |         |       +Geobacter_sulfurreducens_PCA_gi_39998162           (DELTA/EPSILON PROTEOBACTERIA)
        |             |                   +---------+
        |             |                             +----------Geobacter_sp._FRC-32_gi_222053879                (DELTA/EPSILON PROTEOBACTERIA)
        |             |
    +---+             |
    |   |             +---------------------Sorangium_cellulosum_'So_ce_56'_gi_162449933        (DELTA/EPSILON PROTEOBACTERIA)
    |   |
    |   | +------------------------Methylococcus_capsulatus_gi_62900496                  (GAMMAPROTEOBACTERIA)
 +--+   +-+
 |  |     +--------------Alkalilimnicola_ehrlichei_MLHE-1_gi_114321344                      (GAMMAPROTEOBACTERIA)
 |  |
 |  |       +---------------------------Rickettsiella_grylli_gi_160872723                       (GAMMAPROTEOBACTERIA)
 |  |       |
 |  +-------+            +------gi_226951755_ref_ZP_03822219.1_UDP-N-acetylmuramoylalanine-D-glu     (GAMMAPROTEOBACTERIA)
 |          |            |
 |          +------------+  +Acinetobacter_baumannii_ACICU_gi_184156588      (GAMMAPROTEOBACTERIA)
 |                       |  |
 |                       +--+Acinetobacter_baumannii_SDF_gi_169634628          (GAMMAPROTEOBACTERIA)
 |                          |
 |                          |Acinetobacter_baumannii_ATCC_17978_gi_226711953      (GAMMAPROTEOBACTERIA)
 |                          |
 |                          |Acinetobacter_baumannii_AB0057_gi_213155698          (GAMMAPROTEOBACTERIA)
 |                          |
 |                          |Acinetobacter_baumannii_A307_gi_215484924            (GAMMAPROTEOBACTERIA)
 |                          |
 |                          +Acinetobacter_baumannii_AYE_gi_169797488              (GAMMAPROTEOBACTERIA)
 |
 |     +---------------Azoarcus_sp._BH72_gi_119897173          (BETAPROTEOBACTERIA)
 |     |
 |  +--+     +--------Janthinobacterium_sp._Marseille_gi_152980553     (BETAPROTEOBACTERIA)
 |  |  |     |
 |  |  +-----+
 |  |        |  +-------------Polaromonas_naphthalenivorans_CJ2_gi_121606308     (BETAPROTEOBACTERIA)
 |  |        +--+
 |  |           |      +--Ralstonia_eutropha_JMP134_gi_73542665     (BETAPROTEOBACTERIA)
 |  |           +------+
 |  |                  +-Cupriavidus_taiwanensis_gi_194290815     (BETAPROTEOBACTERIA)
 |  |
 |  |            +---Chromobacterium_sp._2002_gi_224826076          (BETAPROTEOBACTERIA)
 |  |            |
 |  |          +-+  +----------gi_226941971_ref_YP_002797045.1_MurD_Laribacter_hongkongensis_HL      (BETAPROTEOBACTERIA)
 |  |          | |  |
 +--+          | |  |          +----Eikenella_corrodens_ATCC_23834_gi_225023739                  (BETAPROTEOBACTERIA)
    |          | +--+          |
    |          |    |          |        +Neisseria_meningitidis_Z2491_gi_218768812           (BETAPROTEOBACTERIA)
    |          |    |          |        |
    |          |    +----------+        |Neisseria_meningitidis_053442_gi_161870654        (BETAPROTEOBACTERIA)
    | +--------+               |       ++
    | |        |               |       ||-Neisseria_gonorrhoeae_1291_gi_226727514         (BETAPROTEOBACTERIA)  
    | |        |               |       ||
    | |        |               +-------++-Neisseria_cinerea_ATCC_14685_gi_225364676      (BETAPROTEOBACTERIA)
    | |        |                       |
    | |        |                       +Neisseria_subflava_NJ9703_gi_225372572       (BETAPROTEOBACTERIA)
    | |        |
    +-+        +------Chromobacterium_violaceum_ATCC_12472_gi_34499800     (BETAPROTEOBACTERIA)
      |
      |
      |    +----------------------------------------REFERENCEGOS_916040_Translation_2-916_indirect_strand
      |  +-+
      |  | +----------Thiobacillus_denitrificans_ATCC_25259_gi_74316135       (BETAPROTEOBACTERIA)
      +--+
         | +-----------Methylobacillus_flagellatus_KT_gi_91776623            (BETAPROTEOBACTERIA)
         | |
         +-+      +--------Nitrosospira_multiformis_ATCC_25196_gi_82703611          (BETAPROTEOBACTERIA)
           |      |
           +------+          +Nitrosomonas_europaea_ATCC_19718_gi_30248992           (BETAPROTEOBACTERIA)
                  |        +-+
                  +--------+ +Nitrosomonas_europaea_gi_60390554                         (BETAPROTEOBACTERIA)
                           |
                           +-----Nitrosomonas_eutropha_C91_gi_114330275                   (BETAPROTEOBACTERIA)

Same tree with score (Newick format):

(((((((Nitrosomonas_eutropha_C91_gi_114330275:0.1076,(Nitrosomonas_europaea_gi_60390554:0.0,Nitrosomonas_europaea_ATCC_19718_gi_30248992:0.0)0.92:0.05618)0.99:0.1826,Nitrosospira_multiformis_ATCC_25196_gi_82703611:0.1742)0.98:0.1328,Methylobacillus_flagellatus_KT_gi_91776623:0.2192)0.63:0.05732,(Thiobacillus_denitrificans_ATCC_25259_gi_74316135:0.2124,REFERENCEGOS_916040_Translation_2-916_indirect_strand:0.8317)0.72:0.04291)0.39:0.04893,(Chromobacterium_violaceum_ATCC_12472_gi_34499800:0.1247,((((Neisseria_subflava_NJ9703_gi_225372572:0.0,((Neisseria_cinerea_ATCC_14685_gi_225364676:0.00524,Neisseria_gonorrhoeae_1291_gi_226727514:0.01063)0.94:0.01630,(Neisseria_meningitidis_053442_gi_161870654:0.01075,Neisseria_meningitidis_Z2491_gi_218768812:0.0053)0.77:0.00535)0.51:0.00525)1:0.1671,Eikenella_corrodens_ATCC_23834_gi_225023739:0.08619)1:0.2285,gi_226941971_ref_YP_002797045.1_MurD_Laribacter_hongkongensis_HL:0.2068)0.91:0.06261,Chromobacterium_sp._2002_gi_224826076:0.05242)0.81:0.0391)1:0.1877)0.78:0.04555,((((Cupriavidus_taiwanensis_gi_194290815:0.01028,Ralstonia_eutropha_JMP134_gi_73542665:0.03277)0.99:0.1444,Polaromonas_naphthalenivorans_CJ2_gi_121606308:0.2708)0.91:0.07533,Janthinobacterium_sp._Marseille_gi_152980553:0.1804)0.97:0.1209,Azoarcus_sp._BH72_gi_119897173:0.3091)0.51:0.05967)0.95:0.06195,(((((((Acinetobacter_baumannii_AYE_gi_169797488:0.0,(Acinetobacter_baumannii_A307_gi_215484924:0.0,Acinetobacter_baumannii_AB0057_gi_213155698:0.0):0.0)0.92:0.00504,Acinetobacter_baumannii_ATCC_17978_gi_226711953:0.0):0.0,Acinetobacter_baumannii_SDF_gi_169634628:0.0):0.0,Acinetobacter_baumannii_ACICU_gi_184156588:0.00505)0.85:0.0499,gi_226951755_ref_ZP_03822219.1_UDP-N-acetylmuramoylalanine-D-glu:0.1202)0.98:0.2831,Rickettsiella_grylli_gi_160872723:0.55690)0.89:0.1596,((Alkalilimnicola_ehrlichei_MLHE-1_gi_114321344:0.2869,Methylococcus_capsulatus_gi_62900496:0.4962)0.037:0.04264,(Sorangium_cellulosum_'So_ce_56'_gi_162449933:0.4363,(((Geobacter_sp._FRC-32_gi_222053879:0.2177,(Geobacter_sulfurreducens_PCA_gi_39998162:0.0,Geobacter_sulfurreducens_gi_62900554:0.0)0.98:0.17450)0.96:0.2082,Pelobacter_carbinolicus_DSM_2380_gi_77919798:0.4245)0.99:0.28650,(delta_proteobacterium_MLMS-1_gi_94269090:0.272,(Desulfotalea_psychrophila_gi_62900515:0.0,Desulfotalea_psychrophila_LSv54_gi_51246751:0.0)1:0.7681)0.96:0.2277)0.42:0.1163)0.99:0.2869)0.26:0.08986)0.95:0.06195);

Taxonomy report

PROTOCOL


From blastp vs nr, default NCBI settings except "max target sequences" set to 1000..


RESULTS ANALYSIS

RAW RESULTS

Lineage Report

root
. Bacteria           [bacteria]
. . Proteobacteria     [proteobacteria]
. . . Betaproteobacteria [b-proteobacteria]
. . . . Methylobacillus flagellatus KT -----------------------------------------  226  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobac
. . . . Lutiella nitroferrum 2002 ..............................................  224  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella ni
. . . . Nitrosospira multiformis ATCC 25196 ....................................  215  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosospi
. . . . Thiobacillus denitrificans ATCC 25259 ..................................  212  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thiobacill
. . . . Polaromonas naphthalenivorans CJ2 ......................................  212  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Polaromona
. . . . Nitrosomonas europaea ATCC 19718 .......................................  211  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Nitrosomona
. . . . Nitrosomonas europaea ..................................................  211  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Nitrosomona
. . . . Neisseria subflava NJ9703 ..............................................  209  2 hits [b-proteobacteria]       hypothetical protein NEISUBOT_00845 [Neisseria subflava NJ9
. . . . Laribacter hongkongensis HLHK9 .........................................  205  2 hits [b-proteobacteria]       MurD [Laribacter hongkongensis HLHK9] >gi|226716898|gb|ACO7
. . . . Neisseria meningitidis Z2491 ...........................................  204  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Neisseria meningitidis serogroup A .....................................  204  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Azoarcus sp. BH72 ......................................................  204  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Azoarcus sp
. . . . Eikenella corrodens ATCC 23834 .........................................  203  2 hits [b-proteobacteria]       hypothetical protein EIKCOROL_00603 [Eikenella corrodens AT
. . . . Nitrosomonas eutropha C91 ..............................................  202  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosomon
. . . . Neisseria meningitidis 053442 ..........................................  201  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Chromobacterium violaceum ATCC 12472 ...................................  201  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Chrom
. . . . Chromobacterium violaceum ..............................................  201  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Chrom
. . . . Janthinobacterium sp. Marseille ........................................  200  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Janth
. . . . Ralstonia eutropha JMP134 ..............................................  199  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ralst
. . . . Neisseria cinerea ATCC 14685 ...........................................  197  2 hits [b-proteobacteria]       hypothetical protein NEICINOT_00641 [Neisseria cinerea ATCC
. . . . Cupriavidus taiwanensis ................................................  196  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cupriavidus
. . . . Neisseria gonorrhoeae NCCP11945 ........................................  196  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria 
. . . . Neisseria gonorrhoeae 1291 .............................................  196  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Neisseria g
. . . . Neisseria gonorrhoeae FA 1090 ..........................................  194  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Ralstonia eutropha H16 .................................................  194  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ralst
. . . . Ralstonia metallidurans CH34 ...........................................  194  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ralst
. . . . Bordetella parapertussis 12822 .........................................  194  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Bordetella parapertussis ...............................................  194  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Variovorax paradoxus S110 ..............................................  194  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Variovorax 
. . . . Neisseria meningitidis MC58 ............................................  194  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Neisseria meningitidis serogroup B .....................................  194  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Bordetella bronchiseptica RB50 .........................................  193  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Bordetella bronchiseptica ..............................................  193  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Bordetella avium 197N ..................................................  193  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bordetella
. . . . Neisseria flavescens NRL30031/H210 .....................................  192  2 hits [b-proteobacteria]       hypothetical protein NEIFLAOT_02461 [Neisseria flavescens N
. . . . Bordetella pertussis Tohama I ..........................................  192  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Bordetella pertussis ...................................................  192  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Neisseria lactamica ATCC 23970 .........................................  192  2 hits [b-proteobacteria]       hypothetical protein NEILACOT_01273 [Neisseria lactamica AT
. . . . Neisseria mucosa ATCC 25996 ............................................  191  2 hits [b-proteobacteria]       hypothetical protein NEIMUCOT_01111 [Neisseria mucosa ATCC 
. . . . Neisseria meningitidis FAM18 ...........................................  190  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neiss
. . . . Herminiimonas arsenicoxydans ...........................................  189  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Hermi
. . . . Burkholderia phytofirmans PsJN .........................................  188  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Burkholderi
. . . . Delftia acidovorans SPH-1 ..............................................  187  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Delftia ac
. . . . Comamonas testosteroni KF-1 ............................................  186  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Comamonas t
. . . . Limnobacter sp. MED105 .................................................  184  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Limno
. . . . Ralstonia pickettii 12J ................................................  184  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Ralstonia p
. . . . Ralstonia solanacearum UW551 ...........................................  182  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ralstonia 
. . . . Ralstonia solanacearum IPO1609 .........................................  182  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ralstonia 
. . . . Acidovorax sp. JS42 ....................................................  182  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Acido
. . . . Diaphorobacter sp. TPSY ................................................  181  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Diaphorobac
. . . . Burkholderia sp. H160 ..................................................  181  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Burkholderi
. . . . Ralstonia pickettii 12D ................................................  180  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ralstonia 
. . . . Burkholderia phymatum STM815 ...........................................  177  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Aromatoleum aromaticum EbN1 ............................................  177  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Aromatoleum
. . . . Acidovorax avenae subsp. citrulli AAC00-1 ..............................  177  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acidovorax
. . . . Polaromonas sp. JS666 ..................................................  177  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Polaromona
. . . . Ralstonia solanacearum GMI1000 .........................................  177  2 hits [b-proteobacteria]       probable udp-n-acetylmuramoylalanine--d-glutamate ligase (u
. . . . Ralstonia solanacearum .................................................  176  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ralst
. . . . Burkholderia cenocepacia J2315 .........................................  175  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia dolosa AUO158 .............................................  173  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Burkholderi
. . . . Rhodoferax ferrireducens T118 ..........................................  172  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhodo
. . . . Bordetella petrii DSM 12804 ............................................  172  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Bordetella petrii ......................................................  172  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Borde
. . . . Burkholderia thailandensis E264 ........................................  172  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia thailandensis Bt4 .........................................  172  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Verminephrobacter eiseniae EF01-2 ......................................  172  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Verminephr
. . . . Burkholderia xenovorans LB400 ..........................................  171  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia vietnamiensis G4 ..........................................  171  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia sp. 383 ...................................................  169  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 305 ..........................................  168  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia graminis C4D1M ............................................  168  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Dechloromonas aromatica RCB ............................................  167  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Dechloromo
. . . . Ralstonia solanacearum MolK2 ...........................................  166  2 hits [b-proteobacteria]       udp-n-acetylmuramoylalanine--d-glutamate ligase (udp-n-acet
. . . . Burkholderia oklahomensis C6786 ........................................  165  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia ubonensis Bu ..............................................  164  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia oklahomensis EO147 ........................................  163  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia thailandensis MSMB43 ......................................  162  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia multivorans ATCC 17616 ....................................  161  5 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei K96243 .......................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia pseudomallei 1710b ........................................  161  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia thailandensis TXDOH .......................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei SAVP1 ..............................................  161  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei NCTC 10229 .........................................  161  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei NCTC 10247 .........................................  161  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 1106a ........................................  161  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 1106b ........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 1710a ........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei PRL-20 .............................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei DM98 .........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei B7210 ........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 112 ..........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei S13 ..........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 406e .........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 576 ..........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei Pakistan 9 ...................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei ..............................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 1655 .........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia mallei GB8 horse 4 ........................................  161  1 hit  [b-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Bu
. . . . Burkholderia pseudomallei 9 ............................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 668 ..........................................  161  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 7894 .........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei NCTC 13177 ...................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei ATCC 10399 .........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia pseudomallei Pasteur 52237 ................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia mallei 2002721280 .........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia pseudomallei 14 ...........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei 91 ...........................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia pseudomallei BCC215 .......................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei ATCC 23344 .........................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei FMH ................................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei ....................................................  161  1 hit  [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia mallei JHU ................................................  161  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia multivorans CGD1 ..........................................  160  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia multivorans CGD2M .........................................  159  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia multivorans CGD2 ..........................................  159  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia cenocepacia PC184 .........................................  159  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Burkholderi
. . . . Burkholderia cenocepacia AU 1054 .......................................  158  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia cenocepacia HI2424 ........................................  158  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia ambifaria AMMD ............................................  154  3 hits [b-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Burkh
. . . . Burkholderia ambifaria MC40-6 ..........................................  154  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia ambifaria IOP40-10 ........................................  153  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia cenocepacia MC0-3 .........................................  151  3 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Burkholder
. . . . Burkholderia ambifaria MEX-5 ...........................................  149  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Burkholderi
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 ..................  142  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Polynucleo
. . . . Methylibium petroleiphilum PM1 .........................................  135  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylibiu
. . . . beta proteobacterium KB13 ..............................................  135  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [beta prote
. . . . Leptothrix cholodnii SP-6 ..............................................  134  2 hits [b-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leptothrix
. . . Alkalilimnicola ehrlichei MLHE-1 -----------------------------------------  221  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alkalilimn
. . . Acinetobacter baumannii ATCC 17978 .......................................  215  3 hits [g-proteobacteria]       RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate liga
. . . Acinetobacter baumannii SDF ..............................................  209  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobact
. . . Acinetobacter baumannii ..................................................  209  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobact
. . . Acinetobacter baumannii ACICU ............................................  209  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobact
. . . Acinetobacter baumannii AB0057 ...........................................  209  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acinetobac
. . . Acinetobacter baumannii AB307-0294 .......................................  209  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acinetobac
. . . Acinetobacter baumannii AYE ..............................................  209  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobact
. . . Acinetobacter sp. ATCC 27244 .............................................  206  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobact
. . . Rickettsiella grylli .....................................................  205  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsie
. . . Methylococcus capsulatus str. Bath .......................................  204  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylococ
. . . Methylococcus capsulatus .................................................  204  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylococ
. . . Thioalkalivibrio sp. HL-EbGR7 ............................................  204  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thioalkaliv
. . . Nitrosococcus oceani ATCC 19707 ..........................................  203  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Nitrosococc
. . . Nitrosococcus oceani AFC27 ...............................................  203  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosococ
. . . Hahella chejuensis KCTC 2396 .............................................  198  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hahella ch
. . . Alcanivorax borkumensis SK2 ..............................................  198  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alcanivora
. . . Acinetobacter sp. ADP1 ...................................................  197  3 hits [g-proteobacteria]       RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate liga
. . . Shewanella pealeana ATCC 700345 ..........................................  196  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Thioalkalivibrio sp. K90mix ..............................................  193  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thioalkaliv
. . . Pseudomonas fluorescens Pf0-1 ............................................  190  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas putida KT2440 ................................................  189  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Azotobacter vinelandii DJ ................................................  189  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Azotobacte
. . . Pseudomonas entomophila L48 ..............................................  188  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Haemophilus influenzae PittEE ............................................  186  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Halothiobacillus neapolitanus c2 .........................................  186  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Halothiobac
. . . gamma proteobacterium HTCC5015 ...........................................  186  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma prot
. . . Alcanivorax sp. DG881 ....................................................  185  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alcanivora
. . . Pseudomonas putida GB-1 ..................................................  185  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas putida F1 ....................................................  184  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Shewanella sediminis HAW-EB3 .............................................  184  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Pseudomonas putida W619 ..................................................  184  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudomona
. . . Legionella pneumophila str. Corby ........................................  184  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legio
. . . Haemophilus influenzae 3655 ..............................................  184  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus influenzae PittAA ............................................  184  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus influenzae Rd KW20 ...........................................  183  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus influenzae ...................................................  183  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus influenzae R2846 .............................................  183  1 hit  [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ha
. . . Haemophilus influenzae 86-028NP ..........................................  183  3 hits [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ha
. . . Pseudoalteromonas haloplanktis TAC125 ....................................  182  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pseudoalter
. . . Haemophilus influenzae PittGG ............................................  182  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Legionella pneumophila str. Paris ........................................  182  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legio
. . . Shewanella sp. ANA-3 .....................................................  182  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Pseudomonas fluorescens Pf-5 .............................................  182  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............  182  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legio
. . . Haemophilus influenzae 22.4-21 ...........................................  182  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus influenzae R3021 .............................................  182  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Shewanella sp. MR-4 ......................................................  182  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Moritella sp. PE36 .......................................................  181  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Morit
. . . Idiomarina loihiensis L2TR ...............................................  181  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Idiomarina 
. . . Idiomarina loihiensis ....................................................  181  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Idiomarina 
. . . Shewanella violacea ......................................................  181  2 hits [g-proteobacteria]       RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate liga
. . . Shewanella sp. MR-7 ......................................................  181  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella putrefaciens CN-32 ............................................  181  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Nitrococcus mobilis Nb-231 ...............................................  181  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Nitrococcus
. . . Methylophaga thiooxidans DMS010 ..........................................  181  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylopha
. . . Methylophaga thiooxidans .................................................  181  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylopha
. . . Legionella pneumophila str. Lens .........................................  181  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legio
. . . Coxiella burnetii Dugway 5J108-111 .......................................  181  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Coxiella burnetii RSA 493 ................................................  181  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Coxiella burnetii RSA 331 ................................................  181  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Coxiella burnetii CbuG_Q212 ..............................................  181  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Coxiella burnetii ........................................................  181  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Shewanella putrefaciens 200 ..............................................  180  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella sp. W3-18-1 ...................................................  180  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella benthica KT99 .................................................  180  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Coxiella burnetii 'MSU Goat Q177' ........................................  180  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Coxiella burnetii RSA 334 ................................................  180  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Coxiella burnetii CbuK_Q154 ..............................................  180  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coxiella b
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  179  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aeromonas 
. . . Haemophilus influenzae R2866 .............................................  179  1 hit  [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ha
. . . Haemophilus influenzae 22.1-21 ...........................................  179  2 hits [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ha
. . . Haemophilus influenzae PittII ............................................  179  2 hits [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ha
. . . Bermanella marisrubri ....................................................  179  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanobact
. . . Marinobacter sp. ELB17 ...................................................  179  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Marin
. . . Shewanella oneidensis MR-1 ...............................................  178  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella oneidensis ....................................................  178  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella baltica OS155 .................................................  178  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Colwellia psychrerythraea 34H ............................................  178  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Colwellia 
. . . Neptuniibacter caesariensis ..............................................  177  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanospir
. . . Shewanella piezotolerans WP3 .............................................  177  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase (UDP-N-acet
. . . Vibrio shilonii AK1 ......................................................  177  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Shewanella baltica OS185 .................................................  177  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella baltica OS223 .................................................  177  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Shewanella 
. . . Pseudomonas aeruginosa PACS2 .............................................  177  1 hit  [g-proteobacteria]       hypothetical protein PaerPA_01001022 [Pseudomonas aeruginos
. . . Pseudomonas mendocina ymp ................................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . marine gamma proteobacterium HTCC2143 ....................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [marin
. . . Pseudomonas stutzeri A1501 ...............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Shewanella amazonensis SB2B ..............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Pseudomonas aeruginosa PAO1 ..............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas aeruginosa PA7 ...............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas aeruginosa C3719 .............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas aeruginosa 2192 ..............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas aeruginosa ...................................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas aeruginosa LESB58 ............................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudomona
. . . Shewanella halifaxensis HAW-EB4 ..........................................  176  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Shewanella loihica PV-4 ..................................................  175  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Aeromonas salmonicida subsp. salmonicida A449 ............................  174  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aeromonas 
. . . Marinobacter aquaeolei VT8 ...............................................  174  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinobact
. . . Vibrio vulnificus YJ016 ..................................................  174  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Shewanella denitrificans OS217 ...........................................  173  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Haemophilus somnus 129PT .................................................  173  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Pseudomonas aeruginosa UCBPP-PA14 ........................................  173  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Cellvibrio japonicus Ueda107 .............................................  173  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Cellvibrio
. . . Vibrio vulnificus CMCP6 ..................................................  173  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Vibrio vulnificus ........................................................  173  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  172  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
. . . Alteromonas macleodii 'Deep ecotype' .....................................  172  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alteromona
. . . Haemophilus somnus 2336 ..................................................  172  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Haemophilu
. . . Haemophilus influenzae PittHH ............................................  171  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Shewanella baltica OS195 .................................................  171  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  171  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Idiomarina baltica OS145 .................................................  171  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Idiomarina 
. . . Alteromonadales bacterium TW-7 ...........................................  171  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Alteromonad
. . . Saccharophagus degradans 2-40 ............................................  170  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Saccharoph
. . . Candidatus Vesicomyosocius okutanii HA ...................................  170  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
. . . Marinobacter algicola DG893 ..............................................  170  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Marin
. . . Actinobacillus succinogenes 130Z .........................................  170  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Actin
. . . marine gamma proteobacterium HTCC2080 ....................................  169  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [marin
. . . Pseudomonas syringae pv. syringae B728a ..................................  168  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Haemophilus parasuis 29755 ...............................................  168  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus parasuis SH0165 ..............................................  168  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Vibrio sp. Ex25 ..........................................................  168  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio sp.
. . . Pseudomonas syringae pv. tomato str. DC3000 ..............................  167  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Pseudomonas syringae pv. tomato ..........................................  167  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pseud
. . . Chromohalobacter salexigens DSM 3043 .....................................  167  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Chromohalo
. . . Pseudomonas syringae pv. tomato T1 .......................................  167  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudomona
. . . Psychrobacter arcticus 273-4 .............................................  166  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Psych
. . . Shewanella woodyi ATCC 51908 .............................................  165  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Endoriftia persephone 'Hot96_1+Hot96_2' ..................................  165  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Endoriftia
. . . Vibrio parahaemolyticus RIMD 2210633 .....................................  165  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Vibrio parahaemolyticus AQ3810 ...........................................  165  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Vibrio parahaemolyticus ..................................................  165  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Pasteurella multocida subsp. multocida str. Pm70 .........................  164  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Paste
. . . Pasteurella multocida ....................................................  164  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Paste
. . . Shewanella frigidimarina NCIMB 400 .......................................  164  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
. . . Vibrio parahaemolyticus 16 ...............................................  164  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio par
. . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ........................  163  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . Buchnera aphidicola (Baizongia pistaciae) ................................  163  1 hit  [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . Vibrio harveyi HY01 ......................................................  163  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio har
. . . Tolumonas auensis DSM 9187 ...............................................  163  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Tolumonas a
. . . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ........................  163  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ......................  163  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . Buchnera aphidicola str. APS (Acyrthosiphon pisum) .......................  163  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . Buchnera aphidicola (Acyrthosiphon pisum) ................................  163  1 hit  [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . Buchnera sp. .............................................................  163  1 hit  [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera ap
. . . gamma proteobacterium HTCC2207 ...........................................  162  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [marine gam
. . . Escherichia coli .........................................................  162 16 hits [enterobacteria]         unnamed protein product [Escherichia coli]
. . . Vibrio harveyi ATCC BAA-1116 .............................................  162  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........  162  3 hits [enterobacteria]         hypothetical protein WGLp208 [Wigglesworthia glossinidia en
. . . Erwinia tasmaniensis Et1/99 ..............................................  162  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erwinia tas
. . . Pseudoalteromonas atlantica T6c ..........................................  161  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudoalte
. . . Psychromonas ingrahamii 37 ...............................................  161  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Psychromon
. . . Buchnera aphidicola ......................................................  161  4 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera a
. . . Enterobacter sp. 638 .....................................................  160  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Enter
. . . Marinomonas sp. MED121 ...................................................  160  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinomona
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  160  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Photobacterium profundum 3TCK ............................................  160  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photo
. . . Mannheimia succiniciproducens MBEL55E ....................................  160  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Mannh
. . . Candidatus Blochmannia floridanus ........................................  159  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Candidat
. . . Pelobacter propionicus DSM 2379 ..........................................  159  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pelobacter
. . . Cronobacter sakazakii ATCC BAA-894 .......................................  159  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Enter
. . . Pseudoalteromonas tunicata D2 ............................................  159  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pseudoalter
. . . Thiomicrospira crunogena XCL-2 ...........................................  159  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thiomicros
. . . Citrobacter koseri ATCC BAA-895 ..........................................  159  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Citro
. . . Enterobacter cancerogenus ATCC 35316 .....................................  159  2 hits [enterobacteria]         hypothetical protein ENTCAN_00531 [Enterobacter cancerogenu
. . . Desulfococcus oleovorans Hxd3 ............................................  159  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Desulfococ
. . . Marinomonas sp. MWYL1 ....................................................  158  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinomona
. . . Psychrobacter sp. PRwf-1 .................................................  158  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Psych
. . . Reinekea sp. MED297 ......................................................  158  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Reine
. . . Psychromonas sp. CNPT3 ...................................................  158  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Psych
. . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  158  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photo
. . . Photorhabdus luminescens subsp. laumondii ................................  158  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photo
. . . Yersinia pestis KIM ......................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Microtus str. 91001 ...............................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis Antiqua ..................................................  157  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis Nepal516 .................................................  157  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis Pestoides F ..............................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis CA88-4125 ................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis Angola ...................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Orientalis str. F1991016 ..........................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Orientalis str. IP275 .............................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Antiqua str. E1979001 .............................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Antiqua str. B42003004 ............................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis FV-1 .....................................................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis CO92 .....................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pestis ..........................................................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Shigella flexneri 2a str. 301 ............................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Shigella flexneri ........................................................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Citrobacter youngae ATCC 29220 ...........................................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Citro
. . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica ......................................................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
. . . Yersinia pseudotuberculosis YPIII ........................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Yersinia p
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Salmonella enterica subsp. enterica serovar Typhi ........................  157  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Escherichia fergusonii ATCC 35469 ........................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Yersinia pseudotuberculosis IP 31758 .....................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . gamma proteobacterium NOR5-3 .............................................  157  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma prot
. . . Escherichia albertii TW07627 .............................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Escherichi
. . . Photobacterium profundum SS9 .............................................  157  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photo
. . . Photobacterium profundum .................................................  157  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photo
. . . Escherichia coli SMS-3-5 .................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Escherichi
. . . Escherichia coli IAI39 ...................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Escherichi
. . . Escherichia coli UMN026 ..................................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Escherichi
. . . Yersinia frederiksenii ATCC 33641 ........................................  157  1 hit  [enterobacteria]         COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ye
. . . Yersinia pseudotuberculosis IP 32953 .....................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pseudotuberculosis PB1/+ ........................................  157  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Yersinia pseudotuberculosis ..............................................  157  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Yersi
. . . Citrobacter sp. 30_2 .....................................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Citro
. . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pecto
. . . Shigella dysenteriae Sd197 ...............................................  156  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Shigella boydii CDC 3083-94 ..............................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shigella b
. . . Shigella sonnei Ss046 ....................................................  156  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Escherichia coli O157:H7 EDL933 ..........................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. Sakai ......................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4113 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4401 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4501 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4486 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4196 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4076 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC508 ......................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4024 .....................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4206 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4045 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4042 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. EC4115 .....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 str. TW14588 ....................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O157:H7 .................................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Yersinia mollaretii ATCC 43969 ...........................................  156  1 hit  [enterobacteria]         COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ye
. . . Escherichia coli B7A .....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Escherichi
. . . Shigella boydii Sb227 ....................................................  156  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Escherichia coli E22 .....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Escherichia coli E110019 .................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Escherichia coli B171 ....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Escherichia coli 55989 ...................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Escherichia coli str. K-12 substr. MG1655 ................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli str. K-12 substr. W3110 .................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli HS ......................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli ATCC 8739 ...............................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli str. K-12 substr. DH10B .................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli 53638 ...................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli 101-1 ...................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia sp. 1_1_43 ...................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli K-12 ....................................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Escheric
. . . Escherichia coli E24377A .................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli SE11 ....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli IAI1 ....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Shigella flexneri 5 str. 8401 ............................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Klebs
. . . Escherichia coli CFT073 ..................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli ED1a ....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli O6 ......................................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli 83972 ...................................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli UTI89 ...................................................  156  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli 536 .....................................................  156  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli APEC O1 .................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli F11 .....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia coli S88 .....................................................  156  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Escherichia sp. 3_2_53FAA ................................................  156  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Esche
. . . Halorhodospira halophila SL1 .............................................  156  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Halorhodos
. . . Desulfobacterium autotrophicum HRM2 ......................................  155  2 hits [d-proteobacteria]       MurD [Desulfobacterium autotrophicum HRM2] >gi|223691098|gb
. . . Escherichia coli O157:H7 str. EC869 ......................................  155  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Escherichi
. . . Klebsiella pneumoniae 342 ................................................  155  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Klebsiella
. . . Shigella flexneri 2a str. 2457T ..........................................  155  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Shige
. . . Yersinia intermedia ATCC 29909 ...........................................  155  1 hit  [enterobacteria]         COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ye
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  155  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmo
. . . Geobacter sp. M21 ........................................................  155  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter 
. . . Geobacter metallireducens GS-15 ..........................................  155  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter 
. . . Vibrio splendidus 12B01 ..................................................  155  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  155  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pecto
. . . Serratia proteamaculans 568 ..............................................  155  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Serra
. . . Desulfuromonas acetoxidans DSM 684 .......................................  154  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Desulfurom
. . . Escherichia coli O127:H6 str. E2348/69 ...................................  154  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine: D-glutamateligase [Escheric
. . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  154  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Candidat
. . . Haemophilus ducreyi 35000HP ..............................................  154  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Haemophilus ducreyi ......................................................  154  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemo
. . . Pectobacterium atrosepticum SCRI1043 .....................................  154  2 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pecto
. . . Pectobacterium atrosepticum ..............................................  154  1 hit  [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pecto
. . . Vibrio alginolyticus 12G01 ...............................................  154  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Yersinia bercovieri ATCC 43970 ...........................................  153  1 hit  [enterobacteria]         COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ye
. . . Vibrio cholerae RC385 ....................................................  153  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Desulfotalea psychrophila LSv54 ..........................................  152  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Desulfotale
. . . Desulfotalea psychrophila ................................................  152  1 hit  [d-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Desulfotale
. . . Geobacter sp. FRC-32 .....................................................  152  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacter s
. . . Aliivibrio salmonicida LFI1238 ...........................................  152  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aliivibrio
. . . Buchnera aphidicola str. Sg (Schizaphis graminum) ........................  152  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera a
. . . Buchnera aphidicola (Schizaphis graminum) ................................  152  1 hit  [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera a
. . . Vibrio cholerae MZO-3 ....................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae AM-19226 .................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae V51 ......................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae 2740-80 ..................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae MAK 757 ..................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae NCTC 8457 ................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae 623-39 ...................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae ..........................................................  152  1 hit  [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio angustum S14 ......................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Vibrio cholerae M66-2 ....................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Photobacterium sp. SKA34 .................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photo
. . . Vibrio cholerae 1587 .....................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae MZO-2 ....................................................  152  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio fischeri MJ11 .....................................................  151  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio fis
. . . Vibrio cholerae V52 ......................................................  151  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio cholerae O395 .....................................................  151  5 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cho
. . . Vibrio sp. MED222 ........................................................  150  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Psychrobacter cryohalolentis K5 ..........................................  150  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Psych
. . . Vibrionales bacterium SWAT-3 .............................................  150  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . Vibrio splendidus LGP32 ..................................................  150  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio spl
. . . Proteus mirabilis HI4320 .................................................  150  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Proteus mir
. . . Proteus mirabilis ATCC 29906 .............................................  149  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine-D-glutamate ligase [Proteus mir
. . . Vibrio fischeri ES114 ....................................................  149  3 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibri
. . . delta proteobacterium MLMS-1 .............................................  149  6 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [delta prote
. . . Proteus penneri ATCC 35198 ...............................................  148  2 hits [enterobacteria]         hypothetical protein PROPEN_02224 [Proteus penneri ATCC 351
. . . Geobacter bemidjiensis Bem ...............................................  148  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter 
. . . Mannheimia haemolytica PHL213 ............................................  148  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
. . . Congregibacter litoralis KT71 ............................................  148  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma prot
. . . gamma proteobacterium NOR51-B ............................................  147  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma prot
. . . Providencia rustigianii DSM 4541 .........................................  145  2 hits [enterobacteria]         hypothetical protein PROVRUST_01912 [Providencia rustigiani
. . . Pelobacter carbinolicus DSM 2380 .........................................  145  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pelobacter
. . . Zymomonas mobilis subsp. mobilis ZM4 .....................................  144  2 hits [a-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Zymomonas m
. . . Zymomonas mobilis ........................................................  144  1 hit  [a-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Zymomonas m
. . . Providencia alcalifaciens DSM 30120 ......................................  144  2 hits [enterobacteria]         hypothetical protein PROVALCAL_03852 [Providencia alcalifac
. . . Sodalis glossinidius str. 'morsitans' ....................................  144  3 hits [enterobacteria]         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Sodal
. . . Magnetococcus sp. MC-1 ...................................................  143  2 hits [proteobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Magnetococ
. . . Shigella dysenteriae 1012 ................................................  143  2 hits [enterobacteria]         UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shigella d
. . . Providencia stuartii ATCC 25827 ..........................................  142  2 hits [enterobacteria]         hypothetical protein PROSTU_03424 [Providencia stuartii ATC
. . . Geobacter uraniireducens Rf4 .............................................  141  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter 
. . . Acidithiobacillus ferrooxidans ATCC 53993 ................................  141  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Acidithioba
. . . Acidithiobacillus ferrooxidans ATCC 23270 ................................  141  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Acidithioba
. . . Geobacter lovleyi SZ .....................................................  140  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacter l
. . . Syntrophobacter fumaroxidans MPOB ........................................  139  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Syntrophob
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  139  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase [Actino
. . . Anaeromyxobacter dehalogenans 2CP-1 ......................................  139  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Anaeromyxob
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  139  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Actin
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  139  1 hit  [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ac
. . . Actinobacillus pleuropneumoniae L20 ......................................  139  2 hits [g-proteobacteria]       COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ac
. . . Actinobacillus minor 202 .................................................  139  2 hits [g-proteobacteria]       UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Actin
. . . Anaeromyxobacter sp. K ...................................................  139  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Anaeromyxob
. . . Geobacter sulfurreducens PCA .............................................  138  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter 
. . . Geobacter sulfurreducens .................................................  138  1 hit  [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacter 
. . . Desulfatibacillum alkenivorans AK-01 .....................................  138  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine/D-glutamate ligase [Desulfatiba
. . . Anaeromyxobacter dehalogenans 2CP-C ......................................  137  3 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Anaeromyxo
. . . Sorangium cellulosum 'So ce 56' ..........................................  137  2 hits [d-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Sorangium c
. . . Dichelobacter nodosus VCS1703A ...........................................  137  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Dichelobact
. . . marine gamma proteobacterium HTCC2148 ....................................  135  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [marine gam
. . . Baumannia cicadellinicola str. Hc (Homalodisca coagulata) ................  135  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Baumannia 
. . . Providencia rettgeri DSM 1131 ............................................  135  2 hits [enterobacteria]         hypothetical protein PROVRETT_00638 [Providencia rettgeri D
. . . Francisella novicida U112 ................................................  133  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Francisell
. . . Francisella novicida FTE .................................................  133  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Francisell
. . . Francisella novicida GA99-3548 ...........................................  133  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Francisell
. . . Francisella novicida GA99-3549 ...........................................  133  2 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine-D-glutamate ligase [Francisella
. . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................  132  3 hits [g-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Francisell
. . . Sphingomonas sp. SKA58 ...................................................  132  2 hits [a-proteobacteria]       UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomon
. . Streptococcus mutans UA159 -------------------------------------------------  161  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus mutans .......................................................  161  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Bacteroides coprophilus DSM 18228 ..........................................  159  2 hits [CFB group bacteria]     hypothetical protein BACCOPRO_01334 [Bacteroides coprophilu
. . Sphingobacterium spiritivorum ATCC 33300 ...................................  157  2 hits [CFB group bacteria]     UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Sphingo
. . Candidatus Amoebophilus asiaticus 5a2 ......................................  156  2 hits [CFB group bacteria]     hypothetical protein Aasi_0816 [Candidatus Amoebophilus asi
. . Parabacteroides merdae ATCC 43184 ..........................................  155  2 hits [CFB group bacteria]     hypothetical protein PARMER_03363 [Parabacteroides merdae A
. . Flavobacteria bacterium BAL38 ..............................................  155  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [F
. . Moorella thermoacetica ATCC 39073 ..........................................  155  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Moorella t
. . Capnocytophaga sputigena ATCC 33612 ........................................  154  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Capnocytop
. . Polaribacter irgensii 23-P .................................................  154  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [P
. . Parabacteroides johnsonii DSM 18315 ........................................  154  2 hits [CFB group bacteria]     hypothetical protein PRABACTJOHN_00231 [Parabacteroides joh
. . Denitrovibrio acetiphilus DSM 12809 ........................................  153  2 hits [bacteria]               UDP-N-acetylmuramoylalanine--D-glutamate ligase [Denitrovib
. . Bacteroides plebeius DSM 17135 .............................................  153  2 hits [CFB group bacteria]     hypothetical protein BACPLE_00454 [Bacteroides plebeius DSM
. . Bacteroides coprocola DSM 17136 ............................................  153  2 hits [CFB group bacteria]     hypothetical protein BACCOP_03622 [Bacteroides coprocola DS
. . Lactobacillus crispatus JV-V01 .............................................  152  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Bacteroides finegoldii DSM 17565 ...........................................  152  2 hits [CFB group bacteria]     hypothetical protein BACFIN_01953 [Bacteroides finegoldii D
. . Bacteroides ovatus ATCC 8483 ...............................................  151  2 hits [CFB group bacteria]     hypothetical protein BACOVA_01855 [Bacteroides ovatus ATCC 
. . Lactobacillus sakei subsp. carnosus DSM 15831 ..............................  151  4 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus ultunensis DSM 16047 .........................................  151  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Bacteroides fragilis YCH46 .................................................  151  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bacteroide
. . Bacteroides fragilis NCTC 9343 .............................................  151  3 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bacteroide
. . Bacteroides fragilis .......................................................  151  1 hit  [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bacteroide
. . Parabacteroides distasonis ATCC 8503 .......................................  150  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Parabacter
. . Bacteroides caccae ATCC 43185 ..............................................  150  2 hits [CFB group bacteria]     hypothetical protein BACCAC_03508 [Bacteroides caccae ATCC 
. . Bacteroides thetaiotaomicron ...............................................  150  1 hit  [CFB group bacteria]     RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate liga
. . Bacteroides thetaiotaomicron VPI-5482 ......................................  150  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bacteroide
. . Lactobacillus acidophilus NCFM .............................................  150  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus acidophilus ..................................................  150  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus acidophilus ATCC 4796 ........................................  150  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus helveticus DPC 4571 ..........................................  150  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Prevotella copri DSM 18205 .................................................  149  2 hits [CFB group bacteria]     hypothetical protein PREVCOP_02853 [Prevotella copri DSM 18
. . Heliobacterium modesticaldum Ice1 ..........................................  149  2 hits [firmicutes]             udp-n-acetylmuramoylalanine--d-glutamate ligase, putative [
. . Lactobacillus brevis ATCC 367 ..............................................  149  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus jensenii 1153 ................................................  149  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Carboxydothermus hydrogenoformans Z-2901 ...................................  149  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Carboxydot
. . Streptococcus thermophilus LMG 18311 .......................................  149  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus thermophilus CNRZ1066 ........................................  149  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Bacteroides uniformis ATCC 8492 ............................................  148  2 hits [CFB group bacteria]     hypothetical protein BACUNI_03868 [Bacteroides uniformis AT
. . Streptococcus equi subsp. zooepidemicus MGCS10565 ..........................  148  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD [Strep
. . Robiginitalea biformata HTCC2501 ...........................................  148  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [R
. . Bacteroides eggerthii DSM 20697 ............................................  148  2 hits [CFB group bacteria]     hypothetical protein BACEGG_03472 [Bacteroides eggerthii DS
. . Psychroflexus torquis ATCC 700755 ..........................................  148  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [P
. . Streptococcus uberis 0140J .................................................  148  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Bacteroides cellulosilyticus DSM 14838 .....................................  148  2 hits [CFB group bacteria]     hypothetical protein BACCELL_01487 [Bacteroides cellulosily
. . Anoxybacillus flavithermus WK1 .............................................  147  2 hits [firmicutes]             UDP-N-acetylmuramoylalanyl-D-glutamate ligase [Anoxybacillu
. . Pelodictyon luteolum DSM 273 ...............................................  147  3 hits [green sulfur bacteria]  UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pelodictyon
. . Bacteroides vulgatus ATCC 8482 .............................................  147  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bacteroide
. . Lactobacillus jensenii JV-V16 ..............................................  147  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Streptococcus thermophilus LMD-9 ...........................................  147  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Bacteroides dorei DSM 17855 ................................................  147  2 hits [CFB group bacteria]     hypothetical protein BACDOR_02309 [Bacteroides dorei DSM 17
. . Streptococcus gordonii str. Challis substr. CH1 ............................  147  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus gordonii str. Challis ........................................  147  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Bacteroides intestinalis DSM 17393 .........................................  147  2 hits [CFB group bacteria]     hypothetical protein BACINT_00879 [Bacteroides intestinalis
. . Streptococcus equi subsp. zooepidemicus ....................................  147  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Polaribacter sp. MED152 ....................................................  146  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine-D-glutamate ligase [Polaribacte
. . Geobacillus sp. Y412MC61 ...................................................  146  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacillus
. . Bacteroides stercoris ATCC 43183 ...........................................  146  2 hits [CFB group bacteria]     hypothetical protein BACSTE_02542 [Bacteroides stercoris AT
. . Geobacillus kaustophilus HTA426 ............................................  146  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Geoba
. . Geobacillus kaustophilus ...................................................  146  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Geoba
. . Geobacillus thermodenitrificans NG80-2 .....................................  146  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Geoba
. . Streptococcus equi subsp. equi 4047 ........................................  145  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Streptococcus sanguinis SK36 ...............................................  145  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Pedobacter sp. BAL39 .......................................................  145  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pedobacter
. . Anaerococcus lactolyticus ATCC 51172 .......................................  145  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Anaeroc
. . Paenibacillus larvae subsp. larvae BRL-230010 ..............................  145  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Paeni
. . Streptococcus agalactiae COH1 ..............................................  145  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Candidatus Desulforudis audaxviator MP104C .................................  145  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
. . Streptococcus agalactiae NEM316 ............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae 515 ...............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae serogroup III .....................................  144  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae SP9-BS68 ..........................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae SP195 .............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae 2603V/R ...........................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae A909 ..............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae 18RS21 ............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae H36B ..............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae CJB111 ............................................  144  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae serogroup V .......................................  144  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus agalactiae serogroup Ia ......................................  144  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Chlorobaculum parvum NCIB 8327 .............................................  143  3 hits [green sulfur bacteria]  UDP-N-acetylmuramoylalanine/D-glutamate ligase [Chlorobacul
. . Chryseobacterium gleum ATCC 35910 ..........................................  143  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamateligase [Chryseobact
. . Streptococcus pneumoniae SP14-BS69 .........................................  143  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae CGSP14 ............................................  143  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae CDC0288-04 ........................................  143  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Acidobacteria bacterium Ellin345 ...........................................  142  3 hits [bacteria]               UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acidobacte
. . Streptococcus pneumoniae SP19-BS75 .........................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Chlorobium ferrooxidans DSM 13031 ..........................................  142  2 hits [green sulfur bacteria]  UDP-N-acetylmuramoylalanine--D-glutamate ligase [Chlorobium
. . Geobacillus sp. Y412MC10 ...................................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacillu
. . Streptococcus pneumoniae SP6-BS73 ..........................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae SP23-BS72 .........................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Alicyclobacillus acidocaldarius LAA1 .......................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine/D-glutamate ligase [Alicyclobac
. . Streptococcus pneumoniae JJA ...............................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ..............  142  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
. . Streptococcus pneumoniae P1031 .............................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Streptococcus pneumoniae 70585 .............................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Streptococcus pneumoniae R6 ................................................  142  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae D39 ...............................................  142  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae TIGR4 .............................................  142  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae ...................................................  142  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae SP18-BS74 .........................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae CDC3059-06 ........................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Streptococcus pneumoniae ATCC 700669 .......................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Acidobacterium capsulatum ATCC 51196 .......................................  142  2 hits [bacteria]               UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Acidoba
. . Streptococcus pneumoniae SP3-BS71 ..........................................  142  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 .....................  141  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Streptococcus pneumoniae Hungary19A-6 ......................................  141  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Streptococcus pneumoniae SP11-BS70 .........................................  141  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus pneumoniae MLV-016 ...........................................  141  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ...................  141  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Flavobacteriales bacterium HTCC2170 ........................................  141  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [F
. . Streptococcus pneumoniae CDC1873-00 ........................................  141  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Thermoanaerobacter tengcongensis MB4 .......................................  140  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thermoanaer
. . Carboxydibrachium pacificum DSM 12653 ......................................  140  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thermoanaer
. . Thermoanaerobacter tengcongensis ...........................................  140  1 hit  [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thermoanaer
. . Lactobacillus gasseri JV-V03 ...............................................  140  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Gramella forsetii KT0803 ...................................................  140  3 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Gramella f
. . Cytophaga hutchinsonii ATCC 33406 ..........................................  140  3 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Cytophaga 
. . Streptococcus pneumoniae G54 ...............................................  140  4 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Persephonella marina EX-H1 .................................................  140  2 hits [aquificales]            UDP-N-acetylmuramoylalanine--D-glutamate ligase [Persephone
. . Anaerocellum thermophilum DSM 6725 .........................................  140  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine/D-glutamate ligase [Anaerocellu
. . Streptococcus infantarius subsp. infantarius ATCC BAA-102 ..................  140  2 hits [firmicutes]             hypothetical protein STRINF_00657 [Streptococcus infantariu
. . Lactobacillus gasseri ATCC 33323 ...........................................  139  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus gasseri MV-22 ................................................  139  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Caldicellulosiruptor saccharolyticus DSM 8903 ..............................  139  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Caldicellu
. . Candidatus Cloacamonas acidaminovorans .....................................  139  2 hits [bacteria]               UDP-N-acetylmuramoylalanine--D-glutamate ligase (UDP-N-acet
. . Streptococcus pneumoniae CDC1087-00 ........................................  139  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Croceibacter atlanticus HTCC2559 ...........................................  139  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [C
. . Streptococcus pneumoniae Taiwan19F-14 ......................................  138  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Streptococ
. . Pelotomaculum thermopropionicum SI .........................................  138  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pelotomacul
. . Streptococcus suis 05ZYH33 .................................................  138  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Streptococcus suis 98HAH33 .................................................  138  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Strep
. . Lactobacillus sakei subsp. sakei 23K .......................................  137  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus johnsonii NCC 533 ............................................  137  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus johnsonii ....................................................  137  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Lactobacillus johnsonii ATCC 33200 .........................................  137  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Coprothermobacter proteolyticus DSM 5265 ...................................  137  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Coprotherm
. . Kordia algicida OT-1 .......................................................  137  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [K
. . Flavobacteria bacterium MS024-2A ...........................................  136  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine/D-glutamate ligase [Flavobacter
. . Flavobacterium psychrophilum JIP02/86 ......................................  136  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamateligase [Flavobacter
. . Lactobacillus salivarius ATCC 11741 ........................................  135  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Salinibacter ruber DSM 13855 ...............................................  135  3 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salinibact
. . Chlorobium tepidum TLS .....................................................  135  2 hits [green sulfur bacteria]  UDP-N-acetylmuramoylalanine-D-glutamate ligase [Chlorobium 
. . Chlorobaculum tepidum ......................................................  135  1 hit  [green sulfur bacteria]  UDP-N-acetylmuramoylalanine-D-glutamate ligase [Chlorobium 
. . Dokdonia donghaensis MED134 ................................................  135  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [C
. . Lactobacillus salivarius UCC118 ............................................  135  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Lacto
. . Anaerococcus tetradius ATCC 35098 ..........................................  135  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Anaeroc
. . Porphyromonas gingivalis ATCC 33277 ........................................  135  3 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Porphyromo
. . Porphyromonas gingivalis W83 ...............................................  135  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Porphyromo
. . Porphyromonas gingivalis ...................................................  135  1 hit  [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Porphyromo
. . Thermoanaerobacter pseudethanolicus ATCC 33223 .............................  135  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thermoanae
. . Thermoanaerobacter sp. X514 ................................................  135  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thermoanae
. . Chlorobium limicola DSM 245 ................................................  134  3 hits [green sulfur bacteria]  UDP-N-acetylmuramoylalanine/D-glutamate ligase [Chlorobium 
. . Leeuwenhoekiella blandensis MED217 .........................................  134  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase [Flavobacte
. . Oceanobacillus iheyensis HTE831 ............................................  134  2 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ocean
. . Oceanobacillus iheyensis ...................................................  134  1 hit  [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ocean
. . Lactobacillus casei ATCC 334 ...............................................  134  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Lactobacill
. . Lactobacillus paracasei subsp. paracasei 8700:2 ............................  134  1 hit  [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Lactobacill
. . Lactobacillus paracasei subsp. paracasei ATCC 25302 ........................  134  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine-D-glutamate ligase [Lactobacill
. . Geobacillus sp. WCH70 ......................................................  134  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Geobacillu
. . Clostridium thermocellum DSM 4150 ..........................................  133  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase [Clostridiu
. . Lactobacillus casei BL23 ...................................................  133  3 hits [firmicutes]             UDP-N-acetylmuramoylalanine--D-glutamate ligase (UDP-N-acet
. . Clostridium thermocellum ATCC 27405 ........................................  133  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Clost
. . unidentified eubacterium SCB49 .............................................  133  2 hits [CFB group bacteria]     putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [u
. . Bacillus clausii KSM-K16 ...................................................  132  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bacil
. . Thermodesulfovibrio yellowstonii DSM 11347 .................................  132  2 hits [bacteria]               UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thermodesu
. . Synechococcus sp. RS9916 ...................................................  132  2 hits [cyanobacteria]          UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synec
. . Flavobacteria bacterium BBFL7 ..............................................  132  2 hits [CFB group bacteria]     UDP-N-acetylmuramoylalanine--D-glutamate ligase, Mur [Flavo
. . Streptococcus suis 89/1591 .................................................  132  2 hits [firmicutes]             UDP-N-acetylmuramoylalanine/D-glutamate ligase [Streptococc
. . Bacillus weihenstephanensis KBAB4 ..........................................  131  3 hits [firmicutes]             UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bacil
. . Bacillus subtilis subsp. sadata ............................................  131  1 hit  [firmicutes]             sporulation protein A [Bacillus subtilis subsp. sadata]
. uncultured marine microorganism HF4000_APKG2M17 ------------------------------  142  1 hit  [unclassified]           putative Mur ligase family, catalytic domain protein [uncul

BLAST

PROTOCOL


a) Blastp vs sp protein sequences, default NCBI parameters except "max target sequences" set to 1000.


b) Blastp vs nr protein sequences, default NCBI parameters except "max target sequences" set to 1000.


c) Blastx vs nr protein sequences, default NCBI settings

On genomic sequence.



RESULTS ANALYSIS


The vast majority of results point to UDP-N-acetylmuramoylalanine--D-glutamate ligase.

RAW RESULTS


a) Blastp vs sp protein sequences, default NCBI parameters except "max target sequences" set to 1000.

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q1GYZ9.1|MURD_METFK  RecName: Full=UDP-N-acetylmuramoylalan...   226    9e-59 Gene info
sp|A3M1C6.2|MURD_ACIBT  RecName: Full=UDP-N-acetylmuramoylalan...   215    3e-55
sp|Q2Y636.1|MURD_NITMU  RecName: Full=UDP-N-acetylmuramoylalan...   215    3e-55
sp|Q3SMH5.1|MURD_THIDA  RecName: Full=UDP-N-acetylmuramoylalan...   212    2e-54 Gene info
sp|Q82VS5.1|MURD_NITEU  RecName: Full=UDP-N-acetylmuramoylalan...   211    3e-54
sp|B2I1V6.1|MURD_ACIBC  RecName: Full=UDP-N-acetylmuramoylalan...   209    1e-53
sp|B7H1N2.1|MURD_ACIB3  RecName: Full=UDP-N-acetylmuramoylalan...   209    1e-53
sp|Q9JSZ5.1|MURD_NEIMA  RecName: Full=UDP-N-acetylmuramoylalan...   204    4e-52
sp|Q604V5.1|MURD_METCA  RecName: Full=UDP-N-acetylmuramoylalan...   204    4e-52
sp|Q3J787.1|MURD_NITOC  RecName: Full=UDP-N-acetylmuramoylalan...   203    1e-51 Gene info
sp|Q0AJD9.1|MURD_NITEC  RecName: Full=UDP-N-acetylmuramoylalan...   202    2e-51 Gene info
sp|A9M2H5.1|MURD_NEIM0  RecName: Full=UDP-N-acetylmuramoylalan...   201    3e-51 Gene info
sp|Q7NPZ7.1|MURD_CHRVO  RecName: Full=UDP-N-acetylmuramoylalan...   201    5e-51
sp|Q46WZ2.1|MURD_RALEJ  RecName: Full=UDP-N-acetylmuramoylalan...   199    1e-50 Gene info
sp|Q2S9Z0.1|MURD_HAHCH  RecName: Full=UDP-N-acetylmuramoylalan...   198    3e-50 Gene info
sp|Q0VS04.1|MURD_ALCBS  RecName: Full=UDP-N-acetylmuramoylalan...   198    3e-50 Gene info
sp|Q6FFC2.2|MURD_ACIAD  RecName: Full=UDP-N-acetylmuramoylalan...   197    8e-50
sp|B4RQC7.1|MURD_NEIG2  RecName: Full=UDP-N-acetylmuramoylalan...   196    2e-49
sp|Q5F6L6.1|MURD_NEIG1  RecName: Full=UDP-N-acetylmuramoylalan...   194    4e-49 Gene info
sp|Q1LIM4.1|MURD_RALME  RecName: Full=UDP-N-acetylmuramoylalan...   194    5e-49 Gene info
sp|Q7W4B2.1|MURD_BORPA  RecName: Full=UDP-N-acetylmuramoylalan...   194    5e-49
sp|Q9K0Y4.1|MURD_NEIMB  RecName: Full=UDP-N-acetylmuramoylalan...   194    8e-49
sp|Q7WFS0.1|MURD_BORBR  RecName: Full=UDP-N-acetylmuramoylalan...   193    8e-49
sp|Q2KVF5.1|MURD_BORA1  RecName: Full=UDP-N-acetylmuramoylalan...   193    9e-49 Gene info
sp|Q7VUQ1.1|MURD_BORPE  RecName: Full=UDP-N-acetylmuramoylalan...   192    2e-48
sp|Q3K742.1|MURD_PSEPF  RecName: Full=UDP-N-acetylmuramoylalan...   190    9e-48
sp|A1KVL5.1|MURD_NEIMF  RecName: Full=UDP-N-acetylmuramoylalan...   190    1e-47 Gene info
sp|Q88N78.1|MURD_PSEPK  RecName: Full=UDP-N-acetylmuramoylalan...   189    2e-47 Gene info
sp|B2SYX8.1|MURD_BURPP  RecName: Full=UDP-N-acetylmuramoylalan...   188    3e-47
sp|A5UCX0.1|MURD_HAEIE  RecName: Full=UDP-N-acetylmuramoylalan...   186    1e-46 Gene info
sp|P45063.1|MURD_HAEIN  RecName: Full=UDP-N-acetylmuramoylalan...   183    9e-46
sp|Q4QLG0.1|MURD_HAEI8  RecName: Full=UDP-N-acetylmuramoylalan...   183    1e-45 Gene info
sp|Q3IG02.1|MURD_PSEHT  RecName: Full=UDP-N-acetylmuramoylalan...   182    1e-45 Gene info
sp|A5UIR0.1|MURD_HAEIG  RecName: Full=UDP-N-acetylmuramoylalan...   182    2e-45 Gene info
sp|Q5X1S4.1|MURD_LEGPA  RecName: Full=UDP-N-acetylmuramoylalan...   182    2e-45 Gene info
sp|Q4K6J1.1|MURD_PSEF5  RecName: Full=UDP-N-acetylmuramoylalan...   182    2e-45 Gene info
sp|Q5ZSA3.1|MURD_LEGPH  RecName: Full=UDP-N-acetylmuramoylalan...   182    3e-45
sp|Q5R0M3.1|MURD_IDILO  RecName: Full=UDP-N-acetylmuramoylalan...   181    3e-45
sp|Q9F1N2.1|MURD_SHEVI  RecName: Full=UDP-N-acetylmuramoylalan...   181    4e-45
sp|Q5WTI5.1|MURD_LEGPL  RecName: Full=UDP-N-acetylmuramoylalan...   181    5e-45 Gene info
sp|A9KER6.1|MURD_COXBN  RecName: Full=UDP-N-acetylmuramoylalan...   181    5e-45
sp|Q83F20.1|MURD_COXBU  RecName: Full=UDP-N-acetylmuramoylalan...   181    5e-45
sp|B6J5K6.1|MURD_COXB1  RecName: Full=UDP-N-acetylmuramoylalan...   180    1e-44
sp|Q8E9P6.1|MURD_SHEON  RecName: Full=UDP-N-acetylmuramoylalan...   178    3e-44
sp|Q47VQ7.1|MURD_COLP3  RecName: Full=UDP-N-acetylmuramoylalan...   178    4e-44 Gene info
sp|B2JHG2.1|MURD_BURP8  RecName: Full=UDP-N-acetylmuramoylalan...   177    5e-44
sp|Q5P6Z4.1|MURD_AZOSE  RecName: Full=UDP-N-acetylmuramoylalan...   177    6e-44 Gene info
sp|Q12EL7.1|MURD_POLSJ  RecName: Full=UDP-N-acetylmuramoylalan...   177    8e-44 Gene info
sp|Q8XVI5.2|MURD_RALSO  RecName: Full=UDP-N-acetylmuramoylalan...   176    1e-43
sp|Q9HVZ9.1|MURD_PSEAE  RecName: Full=UDP-N-acetylmuramoylalan...   176    1e-43
sp|A1U3G0.1|MURD_MARAV  RecName: Full=UDP-N-acetylmuramoylalan...   174    8e-43 Gene info
sp|Q7MNV3.1|MURD_VIBVY  RecName: Full=UDP-N-acetylmuramoylalan...   174    8e-43 Gene info
sp|Q8DEK8.1|MURD_VIBVU  RecName: Full=UDP-N-acetylmuramoylalan...   173    1e-42
sp|Q21SW7.1|MURD_RHOFD  RecName: Full=UDP-N-acetylmuramoylalan...   172    1e-42 Gene info
sp|Q2SZI5.1|MURD_BURTA  RecName: Full=UDP-N-acetylmuramoylalan...   172    2e-42 Gene info
sp|Q13TZ0.1|MURD_BURXL  RecName: Full=UDP-N-acetylmuramoylalan...   171    4e-42
sp|A4JB92.1|MURD_BURVG  RecName: Full=UDP-N-acetylmuramoylalan...   171    4e-42 Gene info
sp|Q48EF6.1|MURD_PSE14  RecName: Full=UDP-N-acetylmuramoylalan...   171    6e-42
sp|Q21MH1.1|MURD_SACD2  RecName: Full=UDP-N-acetylmuramoylalan...   170    8e-42
sp|Q39JX2.1|MURD_BURS3  RecName: Full=UDP-N-acetylmuramoylalan...   169    2e-41
sp|Q4ZNY8.1|MURD_PSEU2  RecName: Full=UDP-N-acetylmuramoylalan...   168    4e-41
sp|Q87WY3.1|MURD_PSESM  RecName: Full=UDP-N-acetylmuramoylalan...   167    5e-41
sp|Q1QVG5.1|MURD_CHRSD  RecName: Full=UDP-N-acetylmuramoylalan...   167    6e-41 Gene info
sp|Q47AA2.1|MURD_DECAR  RecName: Full=UDP-N-acetylmuramoylalan...   167    9e-41 Gene info
sp|Q4FQ21.1|MURD_PSYA2  RecName: Full=UDP-N-acetylmuramoylalan...   166    1e-40 Gene info
sp|Q87SG6.1|MURD_VIBPA  RecName: Full=UDP-N-acetylmuramoylalan...   165    3e-40
sp|Q9CPB0.1|MURD_PASMU  RecName: Full=UDP-N-acetylmuramoylalan...   164    5e-40
sp|Q89AQ2.1|MURD_BUCBP  RecName: Full=UDP-N-acetylmuramoylalan...   163    1e-39
sp|P57313.1|MURD_BUCAI  RecName: Full=UDP-N-acetylmuramoylalan...   163    1e-39
sp|A7MXR3.1|MURD_VIBHB  RecName: Full=UDP-N-acetylmuramoylalan...   162    3e-39 Gene info
sp|Q8D2Z4.1|MURD_WIGBR  RecName: Full=UDP-N-acetylmuramoylalan...   162    3e-39 Gene info
sp|A9AJ18.1|MURD_BURM1  RecName: Full=UDP-N-acetylmuramoylalan...   161    3e-39
sp|Q3JND6.2|MURD_BURP1  RecName: Full=UDP-N-acetylmuramoylalan...   161    5e-39 Gene info
sp|A3NDW6.1|MURD_BURP6  RecName: Full=UDP-N-acetylmuramoylalan...   161    5e-39 Gene info
sp|Q8DVE3.1|MURD_STRMU  RecName: Full=UDP-N-acetylmuramoylalan...   161    5e-39
sp|Q62GS5.1|MURD_BURMA  RecName: Full=UDP-N-acetylmuramoylalan...   161    5e-39
sp|Q65RY4.1|MURD_MANSM  RecName: Full=UDP-N-acetylmuramoylalan...   160    1e-38
sp|Q7VQI9.1|MURD_BLOFL  RecName: Full=UDP-N-acetylmuramoylalan...   159    2e-38 Gene info
sp|A1AU63.1|MURD_PELPD  RecName: Full=UDP-N-acetylmuramoylalan...   159    2e-38 Gene info
sp|Q31I61.1|MURD_THICR  RecName: Full=UDP-N-acetylmuramoylalan...   159    2e-38 Gene info
sp|A8ZXW5.1|MURD_DESOH  RecName: Full=UDP-N-acetylmuramoylalan...   159    3e-38 Gene info
sp|Q1BZG5.1|MURD_BURCA  RecName: Full=UDP-N-acetylmuramoylalan...   158    3e-38 Gene info
sp|Q7N145.1|MURD_PHOLL  RecName: Full=UDP-N-acetylmuramoylalan...   158    4e-38
sp|Q8ZIF1.1|MURD_YERPE  RecName: Full=UDP-N-acetylmuramoylalan...   157    5e-38
sp|Q83MF9.1|MURD_SHIFL  RecName: Full=UDP-N-acetylmuramoylalan...   157    6e-38
sp|Q8ZRU4.3|MURD_SALTY  RecName: Full=UDP-N-acetylmuramoylalan...   157    6e-38
sp|Q57TD2.1|MURD_SALCH  RecName: Full=UDP-N-acetylmuramoylalan...   157    7e-38
sp|Q5PDC2.1|MURD_SALPA  RecName: Full=UDP-N-acetylmuramoylalan...   157    8e-38
sp|Q8Z9H0.3|MURD_SALTI  RecName: Full=UDP-N-acetylmuramoylalan...   157    8e-38
sp|Q6LMF4.1|MURD_PHOPR  RecName: Full=UDP-N-acetylmuramoylalan...   157    1e-37
sp|Q66EK7.1|MURD_YERPS  RecName: Full=UDP-N-acetylmuramoylalan...   157    1e-37
sp|Q32K04.1|MURD_SHIDS  RecName: Full=UDP-N-acetylmuramoylalan...   156    1e-37
sp|Q3Z5S1.1|MURD_SHISS  RecName: Full=UDP-N-acetylmuramoylalan...   156    1e-37 Gene info
sp|Q8X9Y9.3|MURD_ECO57  RecName: Full=UDP-N-acetylmuramoylalan...   156    1e-37
sp|Q326E7.1|MURD_SHIBS  RecName: Full=UDP-N-acetylmuramoylalan...   156    1e-37
sp|P14900.3|MURD_ECOLI  RecName: Full=UDP-N-acetylmuramoylalan...   156    1e-37
sp|Q8FL65.3|MURD_ECOL6  RecName: Full=UDP-N-acetylmuramoylalan...   156    2e-37
sp|Q0TLQ1.1|MURD_ECOL5  RecName: Full=UDP-N-acetylmuramoylalan...   156    2e-37 Gene info
sp|Q39YM1.1|MURD_GEOMG  RecName: Full=UDP-N-acetylmuramoylalan...   155    3e-37
sp|Q2RK81.1|MURD_MOOTA  RecName: Full=UDP-N-acetylmuramoylalan...   155    4e-37
sp|Q493Q3.1|MURD_BLOPB  RecName: Full=UDP-N-acetylmuramoylalan...   154    6e-37 Gene info
sp|Q0BIK3.1|MURD_BURCM  RecName: Full=UDP-N-acetylmuramoylalan...   154    6e-37
sp|Q7VP56.1|MURD_HAEDU  RecName: Full=UDP-N-acetylmuramoylalan...   154    6e-37
sp|Q6D0I1.1|MURD_ERWCT  RecName: Full=UDP-N-acetylmuramoylalan...   154    7e-37
sp|B1YSS2.1|MURD_BURA4  RecName: Full=UDP-N-acetylmuramoylalan...   154    8e-37
sp|Q6AJ52.1|MURD_DESPS  RecName: Full=UDP-N-acetylmuramoylalan...   152    2e-36
sp|B6ELH7.1|MURD_ALISL  RecName: Full=UDP-N-acetylmuramoylalan...   152    2e-36 Gene info
sp|Q8K9T2.1|MURD_BUCAP  RecName: Full=UDP-N-acetylmuramoylalan...   152    2e-36
sp|Q9KPG5.2|MURD_VIBCH  RecName: Full=UDP-N-acetylmuramoylalan...   152    2e-36
sp|B1JV76.1|MURD_BURCC  RecName: Full=UDP-N-acetylmuramoylalan...   151    4e-36
sp|B5FB37.1|MURD_VIBFM  RecName: Full=UDP-N-acetylmuramoylalan...   151    5e-36
sp|A5F5N1.1|MURD_VIBC3  RecName: Full=UDP-N-acetylmuramoylalan...   151    5e-36 Gene info
sp|Q64ZL9.1|MURD_BACFR  RecName: Full=UDP-N-acetylmuramoylalan...   151    5e-36
sp|Q1Q883.1|MURD_PSYCK  RecName: Full=UDP-N-acetylmuramoylalan...   150    7e-36 Gene info
sp|Q8A256.2|MURD_BACTN  RecName: Full=UDP-N-acetylmuramoylalan...   150    7e-36
sp|Q5FKV3.1|MURD_LACAC  RecName: Full=UDP-N-acetylmuramoylalan...   150    1e-35
sp|A8YUN8.1|MURD_LACH4  RecName: Full=UDP-N-acetylmuramoylalan...   150    1e-35 Gene info
sp|Q3AAE4.1|MURD_CARHZ  RecName: Full=UDP-N-acetylmuramoylalan...   149    2e-35 Gene info
sp|Q5E2P8.2|MURD_VIBF1  RecName: Full=UDP-N-acetylmuramoylalan...   149    2e-35
sp|Q5M0D5.1|MURD_STRT1  RecName: Full=UDP-N-acetylmuramoylalan...   149    2e-35 Gene info
sp|B4U1U3.1|MURD_STREM  RecName: Full=UDP-N-acetylmuramoylalan...   148    3e-35
sp|B5EBP9.1|MURD_GEOBB  RecName: Full=UDP-N-acetylmuramoylalan...   148    3e-35
sp|Q3B127.1|MURD_PELLD  RecName: Full=UDP-N-acetylmuramoylalan...   147    7e-35 Gene info
sp|Q03L98.1|MURD_STRTD  RecName: Full=UDP-N-acetylmuramoylalan...   147    7e-35 Gene info
sp|A8AW14.1|MURD_STRGC  RecName: Full=UDP-N-acetylmuramoylalan...   147    9e-35
sp|Q5L0X7.1|MURD_GEOKA  RecName: Full=UDP-N-acetylmuramoylalan...   146    2e-34
sp|A3CLN5.1|MURD_STRSV  RecName: Full=UDP-N-acetylmuramoylalan...   145    2e-34
sp|Q3A2G4.1|MURD_PELCD  RecName: Full=UDP-N-acetylmuramoylalan...   145    4e-34 Gene info
sp|Q8E6P1.1|MURD_STRA3  RecName: Full=UDP-N-acetylmuramoylalan...   144    4e-34
sp|Q5NPA7.1|MURD_ZYMMO  RecName: Full=UDP-N-acetylmuramoylalan...   144    5e-34
sp|Q2NVV3.1|MURD_SODGM  RecName: Full=UDP-N-acetylmuramoylalan...   144    7e-34 Gene info
sp|Q8E186.1|MURD_STRA5  RecName: Full=UDP-N-acetylmuramoylalan...   144    9e-34
sp|B3QLW6.1|MURD_CHLP8  RecName: Full=UDP-N-acetylmuramoylalan...   143    1e-33
sp|B2IN76.1|MURD_STRPS  RecName: Full=UDP-N-acetylmuramoylalan...   143    1e-33
sp|Q1IKG8.1|MURD_ACIBL  RecName: Full=UDP-N-acetylmuramoylalan...   142    2e-33
sp|Q8DQM2.1|MURD_STRR6  RecName: Full=UDP-N-acetylmuramoylalan...   142    3e-33 Gene info
sp|Q97RU8.1|MURD_STRPN  RecName: Full=UDP-N-acetylmuramoylalan...   142    3e-33
sp|Q1GAT6.1|MURD_LACDA  RecName: Full=UDP-N-acetylmuramoylalan...   141    4e-33 Gene info
sp|B1IAM3.1|MURD_STRPI  RecName: Full=UDP-N-acetylmuramoylalan...   141    5e-33
sp|A5G8K2.1|MURD_GEOUR  RecName: Full=UDP-N-acetylmuramoylalan...   141    5e-33 Gene info
sp|Q04B73.1|MURD_LACDB  RecName: Full=UDP-N-acetylmuramoylalan...   141    5e-33 Gene info
sp|Q8R9G4.1|MURD_THETN  RecName: Full=UDP-N-acetylmuramoylalan...   140    7e-33
sp|A0M529.1|MURD_GRAFK  RecName: Full=UDP-N-acetylmuramoylalan...   140    7e-33 Gene info
sp|B3E3Y4.1|MURD_GEOLS  RecName: Full=UDP-N-acetylmuramoylalan...   140    9e-33
sp|Q11RH3.1|MURD_CYTH3  RecName: Full=UDP-N-acetylmuramoylalan...   140    9e-33 Gene info
sp|B5E2Z8.1|MURD_STRP4  RecName: Full=UDP-N-acetylmuramoylalan...   140    1e-32
sp|Q042P8.1|MURD_LACGA  RecName: Full=UDP-N-acetylmuramoylalan...   139    2e-32 Gene info
sp|A4XI02.1|MURD_CALS8  RecName: Full=UDP-N-acetylmuramoylalan...   139    2e-32
sp|Q748D4.1|MURD_GEOSL  RecName: Full=UDP-N-acetylmuramoylalan...   138    3e-32
sp|A5D147.1|MURD_PELTS  RecName: Full=UDP-N-acetylmuramoylalan...   138    3e-32
sp|A4VTK3.1|MURD_STRSY  RecName: Full=UDP-N-acetylmuramoylalan...   138    4e-32 Gene info
sp|A4VZT8.1|MURD_STRS2  RecName: Full=UDP-N-acetylmuramoylalan...   138    4e-32 Gene info
sp|Q38XM9.1|MURD_LACSS  RecName: Full=UDP-N-acetylmuramoylalan...   137    7e-32 Gene info
sp|Q74JY5.1|MURD_LACJO  RecName: Full=UDP-N-acetylmuramoylalan...   137    7e-32
sp|Q2IG29.1|MURD_ANADE  RecName: Full=UDP-N-acetylmuramoylalan...   137    7e-32 Gene info
sp|Q2S530.1|MURD_SALRD  RecName: Full=UDP-N-acetylmuramoylalan...   135    2e-31 Gene info
sp|Q8KGD2.1|MURD_CHLTE  RecName: Full=UDP-N-acetylmuramoylalan...   135    2e-31
sp|Q1WT99.1|MURD_LACS1  RecName: Full=UDP-N-acetylmuramoylalan...   135    3e-31
sp|B2RIE9.1|MURD_PORG3  RecName: Full=UDP-N-acetylmuramoylalan...   135    3e-31
sp|Q7MWM5.1|MURD_PORGI  RecName: Full=UDP-N-acetylmuramoylalan...   135    3e-31
sp|B0K8K5.1|MURD_THEP3  RecName: Full=UDP-N-acetylmuramoylalan...   135    4e-31
sp|B0K3H2.1|MURD_THEPX  RecName: Full=UDP-N-acetylmuramoylalan...   135    4e-31
sp|Q1LSW4.1|MURD_BAUCH  RecName: Full=UDP-N-acetylmuramoylalan...   135    4e-31 Gene info
sp|B3EIL0.1|MURD_CHLL2  RecName: Full=UDP-N-acetylmuramoylalan...   134    5e-31
sp|Q8ER50.1|MURD_OCEIH  RecName: Full=UDP-N-acetylmuramoylalan...   134    5e-31
sp|Q039R8.1|MURD_LACC3  RecName: Full=UDP-N-acetylmuramoylalan...   134    7e-31 Gene info
sp|A0Q5C2.1|MURD_FRATN  RecName: Full=UDP-N-acetylmuramoylalan...   133    1e-30 Gene info
sp|B3WDY1.1|MURD_LACCB  RecName: Full=UDP-N-acetylmuramoylalan...   133    1e-30
sp|A3DE94.1|MURD_CLOTH  RecName: Full=UDP-N-acetylmuramoylalan...   133    2e-30 Gene info
sp|Q5WFG8.1|MURD_BACSK  RecName: Full=UDP-N-acetylmuramoylalan...   132    2e-30 Gene info
sp|B0TZ72.1|MURD_FRAP2  RecName: Full=UDP-N-acetylmuramoylalan...   132    2e-30 Gene info
sp|A9VU74.1|MURD_BACWK  RecName: Full=UDP-N-acetylmuramoylalan...   131    4e-30
sp|Q48SK8.1|MURD_STRPM  RecName: Full=UDP-N-acetylmuramoylalan...   131    4e-30
sp|P0C0D8.1|MURD_STRP1  RecName: Full=UDP-N-acetylmuramoylalan...   131    4e-30
sp|Q67QM7.1|MURD_SYMTH  RecName: Full=UDP-N-acetylmuramoylalan...   131    5e-30
sp|Q03522.1|MURD_BACSU  RecName: Full=UDP-N-acetylmuramoylalan...   131    5e-30
sp|Q1JAT4.1|MURD_STRPB  RecName: Full=UDP-N-acetylmuramoylalan...   131    5e-30
sp|Q879A1.1|MURD_STRP3  RecName: Full=UDP-N-acetylmuramoylalan...   131    5e-30
sp|A2RDK9.1|MURD_STRPG  RecName: Full=UDP-N-acetylmuramoylalan...   131    5e-30 Gene info
sp|Q03W34.1|MURD_LEUMM  RecName: Full=UDP-N-acetylmuramoylalan...   131    5e-30
sp|Q8P063.1|MURD_STRP8  RecName: Full=UDP-N-acetylmuramoylalan...   131    6e-30
sp|A7GJB0.1|MURD_CLOBL  RecName: Full=UDP-N-acetylmuramoylalan...   131    6e-30 Gene info
sp|A1BJY0.1|MURD_CHLPD  RecName: Full=UDP-N-acetylmuramoylalan...   130    7e-30 Gene info
sp|Q2G997.1|MURD_NOVAD  RecName: Full=UDP-N-acetylmuramoylalan...   130    8e-30 Gene info
sp|Q1J5S5.1|MURD_STRPF  RecName: Full=UDP-N-acetylmuramoylalan...   130    9e-30
sp|Q7U8T1.1|MURD_SYNPX  RecName: Full=UDP-N-acetylmuramoylalan...   130    1e-29 Gene info
sp|A7FZA3.1|MURD_CLOB1  RecName: Full=UDP-N-acetylmuramoylalan...   130    1e-29
sp|Q0TMJ3.1|MURD_CLOP1  RecName: Full=UDP-N-acetylmuramoylalan...   130    1e-29 Gene info
sp|A4J2A9.1|MURD_DESRM  RecName: Full=UDP-N-acetylmuramoylalan...   130    1e-29 Gene info
sp|Q2A1Z9.1|MURD_FRATH  RecName: Full=UDP-N-acetylmuramoylalan...   130    1e-29
sp|A4IZG9.1|MURD_FRATW  RecName: Full=UDP-N-acetylmuramoylalan...   129    1e-29 Gene info
sp|A7GRN8.1|MURD_BACCN  RecName: Full=UDP-N-acetylmuramoylalan...   129    2e-29
sp|B2SDR8.1|MURD_FRATM  RecName: Full=UDP-N-acetylmuramoylalan...   129    2e-29
sp|A0PXN6.1|MURD_CLONN  RecName: Full=UDP-N-acetylmuramoylalan...   129    3e-29 Gene info
sp|Q6MIF8.1|MURD_BDEBA  RecName: Full=UDP-N-acetylmuramoylalan...   128    3e-29
sp|B2GB77.1|MURD_LACF3  RecName: Full=UDP-N-acetylmuramoylalan...   128    4e-29
sp|Q97EB9.1|MURD_CLOAB  RecName: Full=UDP-N-acetylmuramoylalan...   128    4e-29
sp|A9KLU2.1|MURD_CLOPH  RecName: Full=UDP-N-acetylmuramoylalan...   128    4e-29 Gene info
sp|Q0SQ91.1|MURD_CLOPS  RecName: Full=UDP-N-acetylmuramoylalan...   127    6e-29 Gene info
sp|B7IUS2.1|MURD_BACC2  RecName: Full=UDP-N-acetylmuramoylalan...   127    7e-29
sp|B1KTB9.1|MURD_CLOBM  RecName: Full=UDP-N-acetylmuramoylalan...   127    7e-29
sp|Q2LR50.1|MURD_SYNAS  RecName: Full=UDP-N-acetylmuramoylalan...   127    8e-29 Gene info
sp|B1IGJ0.1|MURD_CLOBK  RecName: Full=UDP-N-acetylmuramoylalan...   127    8e-29
sp|Q8XHM4.1|MURD_CLOPE  RecName: Full=UDP-N-acetylmuramoylalan...   127    1e-28
sp|A5N4L3.1|MURD_CLOK5  RecName: Full=UDP-N-acetylmuramoylalan...   127    1e-28 Gene info
sp|Q01Q46.1|MURD_SOLUE  RecName: Full=UDP-N-acetylmuramoylalan...   126    1e-28
sp|Q5NHK3.1|MURD_FRATT  RecName: Full=UDP-N-acetylmuramoylalan...   126    2e-28
sp|B0T833.1|MURD_CAUSK  RecName: Full=UDP-N-acetylmuramoylalan...   126    2e-28 Gene info
sp|Q819Q2.1|MURD_BACCR  RecName: Full=UDP-N-acetylmuramoylalan...   126    2e-28 Gene info
sp|B7H6P8.1|MURD_BACC4  RecName: Full=UDP-N-acetylmuramoylalan...   125    2e-28
sp|Q9K9S8.1|MURD_BACHD  RecName: Full=UDP-N-acetylmuramoylalan...   125    2e-28
sp|Q636B4.1|MURD_BACCZ  RecName: Full=UDP-N-acetylmuramoylalan...   125    4e-28 Gene info
sp|O67852.1|MURD_AQUAE  RecName: Full=UDP-N-acetylmuramoylalan...   124    7e-28
sp|Q65JY2.1|MURD_BACLD  RecName: Full=UDP-N-acetylmuramoylalan...   124    8e-28 Gene info
sp|B4SHE6.1|MURD_PELPB  RecName: Full=UDP-N-acetylmuramoylalan...   124    9e-28
sp|A4WQD2.1|MURD_RHOS5  RecName: Full=UDP-N-acetylmuramoylalan...   123    1e-27 Gene info
sp|Q6HEQ2.1|MURD_BACHK  RecName: Full=UDP-N-acetylmuramoylalan...   123    1e-27
sp|B2UXV7.1|MURD_CLOBA  RecName: Full=UDP-N-acetylmuramoylalan...   123    1e-27
sp|Q732F6.1|MURD_BACC1  RecName: Full=UDP-N-acetylmuramoylalan...   123    1e-27 Gene info
sp|B7HM33.1|MURD_BACC7  RecName: Full=UDP-N-acetylmuramoylalan...   122    2e-27
sp|Q5MZA8.1|MURD_SYNP6  RecName: Full=UDP-N-acetylmuramoylalan...   122    2e-27 Gene info
sp|P73668.1|MURD_SYNY3  RecName: Full=UDP-N-acetylmuramoylalan...   122    3e-27 Gene info
sp|Q6G122.1|MURD_BARQU  RecName: Full=UDP-N-acetylmuramoylalan...   122    3e-27
sp|Q24TE4.1|MURD_DESHY  RecName: Full=UDP-N-acetylmuramoylalan...   122    3e-27 Gene info
sp|Q182Y7.1|MURD_CLOD6  RecName: Full=UDP-N-acetylmuramoylalan...   122    3e-27 Gene info
sp|Q5FUJ7.2|MURD_GLUOX  RecName: Full=UDP-N-acetylmuramoylalan...   122    4e-27
sp|Q7V0A5.1|MURD_PROMP  RecName: Full=UDP-N-acetylmuramoylalan...   121    5e-27 Gene info
sp|Q71XX7.1|MURD_LISMF  RecName: Full=UDP-N-acetylmuramoylalan...   121    6e-27 Gene info
sp|Q1GRX7.1|MURD_SPHAL  RecName: Full=UDP-N-acetylmuramoylalan...   121    6e-27
sp|Q9A597.1|MURD_CAUCR  RecName: Full=UDP-N-acetylmuramoylalan...   120    6e-27
sp|B4RFS2.1|MURD_PHEZH  RecName: Full=UDP-N-acetylmuramoylalan...   120    7e-27
sp|B2A2H0.1|MURD_NATTJ  RecName: Full=UDP-N-acetylmuramoylalan...   120    8e-27
sp|Q46JA8.1|MURD_PROMT  RecName: Full=UDP-N-acetylmuramoylalan...   120    8e-27 Gene info
sp|Q5L521.1|MURD_CHLAB  RecName: Full=UDP-N-acetylmuramoylalan...   120    8e-27
sp|Q3ANV5.1|MURD_CHLCH  RecName: Full=UDP-N-acetylmuramoylalan...   120    9e-27 Gene info
sp|B3QWT5.1|MURD_CHLT3  RecName: Full=UDP-N-acetylmuramoylalan...   120    1e-26
sp|B2TIC9.1|MURD_CLOBB  RecName: Full=UDP-N-acetylmuramoylalan...   120    1e-26
sp|Q8Y5M1.1|MURD_LISMO  RecName: Full=UDP-N-acetylmuramoylalan...   120    1e-26
sp|Q03EY1.1|MURD_PEDPA  RecName: Full=UDP-N-acetylmuramoylalan...   119    1e-26 Gene info
sp|B1YIT8.1|MURD_EXIS2  RecName: Full=UDP-N-acetylmuramoylalan...   119    1e-26
sp|A8F4W9.1|MURD_THELT  RecName: Full=UDP-N-acetylmuramoylalan...   119    2e-26 Gene info
sp|Q68WW9.1|MURD_RICTY  RecName: Full=UDP-N-acetylmuramoylalan...   119    2e-26
sp|Q9ZDC2.1|MURD_RICPR  RecName: Full=UDP-N-acetylmuramoylalan...   119    2e-26
sp|A2BY75.1|MURD_PROM5  RecName: Full=UDP-N-acetylmuramoylalan...   118    3e-26
sp|Q9S2W9.1|MURD_STRCO  RecName: Full=UDP-N-acetylmuramoylalan...   118    4e-26
sp|A6TS63.1|MURD_ALKMQ  RecName: Full=UDP-N-acetylmuramoylalan...   118    5e-26 Gene info
sp|A4SH04.1|MURD_PROVI  RecName: Full=UDP-N-acetylmuramoylalan...   117    6e-26 Gene info
sp|Q1RI52.1|MURD_RICBR  RecName: Full=UDP-N-acetylmuramoylalan...   117    7e-26 Gene info
sp|Q929Y1.1|MURD_LISIN  RecName: Full=UDP-N-acetylmuramoylalan...   117    9e-26
sp|Q6MBS4.1|MURD_PARUW  RecName: Full=UDP-N-acetylmuramoylalan...   117    1e-25 Gene info
sp|Q319C4.1|MURD_PROM9  RecName: Full=UDP-N-acetylmuramoylalan...   117    1e-25 Gene info
sp|A3PHS4.1|MURD_RHOS1  RecName: Full=UDP-N-acetylmuramoylalan...   116    1e-25 Gene info
sp|Q4ULT8.1|MURD_RICFE  RecName: Full=UDP-N-acetylmuramoylalan...   116    2e-25
sp|A7Z4E3.1|MURD_BACA2  RecName: Full=UDP-N-acetylmuramoylalan...   116    2e-25 Gene info
sp|B7IFU5.1|MURD_THEAB  RecName: Full=UDP-N-acetylmuramoylalan...   115    2e-25
sp|Q6A9Q4.1|MURD_PROAC  RecName: Full=UDP-N-acetylmuramoylalan...   115    4e-25
sp|Q3J4M6.1|MURD_RHOS4  RecName: Full=UDP-N-acetylmuramoylalan...   115    4e-25 Gene info
sp|Q3AHP0.1|MURD_SYNSC  RecName: Full=UDP-N-acetylmuramoylalan...   115    5e-25 Gene info
sp|A5VJ32.1|MURD_LACRD  RecName: Full=UDP-N-acetylmuramoylalan...   114    5e-25
sp|Q04ES9.1|MURD_OENOB  RecName: Full=UDP-N-acetylmuramoylalan...   114    6e-25
sp|Q10WA5.1|MURD_TRIEI  RecName: Full=UDP-N-acetylmuramoylalan...   114    7e-25 Gene info
sp|Q82AD8.1|MURD_STRAW  RecName: Full=UDP-N-acetylmuramoylalan...   114    9e-25
sp|B2KEW4.1|MURD_ELUMP  RecName: Full=UDP-N-acetylmuramoylalan...   113    1e-24
sp|Q7V5V5.1|MURD_PROMM  RecName: Full=UDP-N-acetylmuramoylalan...   113    1e-24 Gene info
sp|Q88V80.1|MURD_LACPL  RecName: Full=UDP-N-acetylmuramoylalan...   112    2e-24
sp|Q8CSX6.1|MURD_STAES  RecName: Full=UDP-N-acetylmuramoylalan...   112    2e-24 Gene info
sp|Q5HQ09.1|MURD_STAEQ  RecName: Full=UDP-N-acetylmuramoylalan...   112    3e-24 Gene info
sp|Q899G5.2|MURD_CLOTE  RecName: Full=UDP-N-acetylmuramoylalan...   112    4e-24
sp|B3EQC0.1|MURD_CHLPB  RecName: Full=UDP-N-acetylmuramoylalan...   111    4e-24
sp|Q255W7.1|MURD_CHLFF  RecName: Full=UDP-N-acetylmuramoylalan...   111    5e-24 Gene info
sp|A8FCX9.1|MURD_BACP2  RecName: Full=UDP-N-acetylmuramoylalan...   111    5e-24
sp|B1MXV9.1|MURD_LEUCK  RecName: Full=UDP-N-acetylmuramoylalan...   111    5e-24
sp|Q6GHQ2.1|MURD_STAAR  RecName: Full=UDP-N-acetylmuramoylalan...   110    7e-24 Gene info
sp|P0A089.1|MURD_STAAM  RecName: Full=UDP-N-acetylmuramoylalan...   110    7e-24 Gene info
sp|Q8NX35.1|MURD_STAAW  RecName: Full=UDP-N-acetylmuramoylalan...   110    9e-24 Gene info
sp|Q6GA29.1|MURD_STAAS  RecName: Full=UDP-N-acetylmuramoylalan...   110    9e-24 Gene info
sp|Q9CF91.1|MURD_LACLA  RecName: Full=UDP-N-acetylmuramoylalan...   110    9e-24
sp|Q821S1.1|MURD_CHLCV  RecName: Full=UDP-N-acetylmuramoylalan...   110    1e-23
sp|O07669.1|MURD_ENTHR  RecName: Full=UDP-N-acetylmuramoylalan...   110    1e-23
sp|Q728U6.1|MURD_DESVH  RecName: Full=UDP-N-acetylmuramoylalan...   110    1e-23 Gene info
sp|A8MH34.1|MURD_ALKOO  RecName: Full=UDP-N-acetylmuramoylalan...   110    1e-23 Gene info
sp|Q3AZI5.1|MURD_SYNS9  RecName: Full=UDP-N-acetylmuramoylalan...   110    1e-23
sp|A8LS92.1|MURD_DINSH  RecName: Full=UDP-N-acetylmuramoylalan...   110    1e-23 Gene info
sp|A5IKI7.1|MURD_THEP1  RecName: Full=UDP-N-acetylmuramoylalan...   109    2e-23 Gene info
sp|B0JRM9.1|MURD_MICAN  RecName: Full=UDP-N-acetylmuramoylalan...   109    2e-23 Gene info
sp|Q6G2Q3.1|MURD_BARHE  RecName: Full=UDP-N-acetylmuramoylalan...   108    3e-23
sp|A6LPL7.1|MURD_CLOB8  RecName: Full=UDP-N-acetylmuramoylalan...   108    3e-23 Gene info
sp|Q2IYL0.1|MURD_RHOP2  RecName: Full=UDP-N-acetylmuramoylalan...   108    5e-23
sp|A6LJK7.1|MURD_THEM4  RecName: Full=UDP-N-acetylmuramoylalan...   108    6e-23 Gene info
sp|Q28NN2.1|MURD_JANSC  RecName: Full=UDP-N-acetylmuramoylalan...   107    6e-23 Gene info
sp|B0C915.1|MURD_ACAM1  RecName: Full=UDP-N-acetylmuramoylalan...   107    8e-23 Gene info
sp|B3DQM9.1|MURD_BIFLD  RecName: Full=UDP-N-acetylmuramoylalan...   107    9e-23
sp|Q57C76.1|MURD_BRUAB  RecName: Full=UDP-N-acetylmuramoylalan...   107    1e-22
sp|Q7VAM1.1|MURD_PROMA  RecName: Full=UDP-N-acetylmuramoylalan...   107    1e-22
sp|O84763.1|MURD_CHLTR  RecName: Full=UDP-N-acetylmuramoylalan...   107    1e-22
sp|Q1AVX1.1|MURD_RUBXD  RecName: Full=UDP-N-acetylmuramoylalan...   107    1e-22 Gene info
sp|Q8FZP2.1|MURD_BRUSU  RecName: Full=UDP-N-acetylmuramoylalan...   107    1e-22
sp|B7KH28.1|MURD_CYAP7  RecName: Full=UDP-N-acetylmuramoylalan...   107    1e-22 Gene info
sp|Q7NEZ5.1|MURD_GLOVI  RecName: Full=UDP-N-acetylmuramoylalan...   106    2e-22
sp|Q1MPC1.1|MURD_LAWIP  RecName: Full=UDP-N-acetylmuramoylalan...   106    2e-22 Gene info
sp|Q8G4Q6.1|MURD_BIFLO  RecName: Full=UDP-N-acetylmuramoylalan...   106    2e-22
sp|Q313Q5.1|MURD_DESDG  RecName: Full=UDP-N-acetylmuramoylalan...   105    2e-22 Gene info
sp|Q8YI68.1|MURD_BRUME  RecName: Full=UDP-N-acetylmuramoylalan...   105    2e-22
sp|Q8DMN8.1|MURD_THEEB  RecName: Full=UDP-N-acetylmuramoylalan...   105    3e-22
sp|Q4L5N4.1|MURD_STAHJ  RecName: Full=UDP-N-acetylmuramoylalan...   105    3e-22 Gene info
sp|B1L9R9.1|MURD_THESQ  RecName: Full=UDP-N-acetylmuramoylalan...   105    5e-22 Gene info
sp|B0B8Y4.1|MURD_CHLT2  RecName: Full=UDP-N-acetylmuramoylalan...   104    5e-22
sp|B0BAL3.1|MURD_CHLTB  RecName: Full=UDP-N-acetylmuramoylalan...   104    5e-22
sp|Q02XX9.1|MURD_LACLS  RecName: Full=UDP-N-acetylmuramoylalan...   104    6e-22 Gene info
sp|Q9WY76.1|MURD_THEMA  RecName: Full=UDP-N-acetylmuramoylalan...   104    6e-22
sp|A2RJQ3.1|MURD_LACLM  RecName: Full=UDP-N-acetylmuramoylalan...   103    9e-22 Gene info
sp|Q2JHP5.1|MURD_SYNJB  RecName: Full=UDP-N-acetylmuramoylalan...   103    1e-21
sp|Q04UG6.1|MURD_LEPBJ  RecName: Full=UDP-N-acetylmuramoylalan...   103    1e-21 Gene info
sp|Q9PLG5.2|MURD_CHLMU  RecName: Full=UDP-N-acetylmuramoylalan...   103    1e-21
sp|B7K318.1|MURD_CYAP8  RecName: Full=UDP-N-acetylmuramoylalan...   103    1e-21 Gene info
sp|Q3STT0.1|MURD_NITWN  RecName: Full=UDP-N-acetylmuramoylalan...   103    1e-21 Gene info
sp|Q9Z705.1|MURD_CHLPN  RecName: Full=UDP-N-acetylmuramoylalan...   103    1e-21
sp|Q5LU71.1|MURD_SILPO  RecName: Full=UDP-N-acetylmuramoylalan...   103    2e-21
sp|Q5PBH9.1|MURD_ANAMM  RecName: Full=UDP-N-acetylmuramoylalan...   103    2e-21
sp|O07108.2|MURD_ENTFA  RecName: Full=UDP-N-acetylmuramoylalan...   102    2e-21
sp|Q3MF19.1|MURD_ANAVT  RecName: Full=UDP-N-acetylmuramoylalan...   102    3e-21 Gene info
sp|Q72NP4.1|MURD_LEPIC  RecName: Full=UDP-N-acetylmuramoylalan...   102    3e-21
sp|Q8RDQ1.2|MURD_FUSNN  RecName: Full=UDP-N-acetylmuramoylalan...   102    4e-21
sp|Q8YPS9.1|MURD_ANASP  RecName: Full=UDP-N-acetylmuramoylalan...   102    4e-21 Gene info
sp|Q8F7V4.1|MURD_LEPIN  RecName: Full=UDP-N-acetylmuramoylalan...   101    4e-21
sp|Q92I60.1|MURD_RICCN  RecName: Full=UDP-N-acetylmuramoylalan...   101    4e-21
sp|A0R018.1|MURD_MYCS2  RecName: Full=UDP-N-acetylmuramoylalan...   101    5e-21 Gene info
sp|Q163I6.1|MURD_ROSDO  RecName: Full=UDP-N-acetylmuramoylalan...   101    6e-21 Gene info
sp|Q8FNT8.1|MURD_COREF  RecName: Full=UDP-N-acetylmuramoylalan...   100    8e-21
sp|Q1QNU5.1|MURD_NITHX  RecName: Full=UDP-N-acetylmuramoylalan...   100    1e-20 Gene info
sp|A1A2F1.1|MURD_BIFAA  RecName: Full=UDP-N-acetylmuramoylalan...   100    1e-20
sp|Q1GIV4.1|MURD_SILST  RecName: Full=UDP-N-acetylmuramoylalan...   100    1e-20 Gene info
sp|Q2JVR9.1|MURD_SYNJA  RecName: Full=UDP-N-acetylmuramoylalan...   100    1e-20
sp|Q47QX1.1|MURD_THEFY  RecName: Full=UDP-N-acetylmuramoylalan...  99.8    2e-20 Gene info
sp|Q73GT3.1|MURD_WOLPM  RecName: Full=UDP-N-acetylmuramoylalan...  99.8    2e-20
sp|Q89FU5.1|MURD_BRAJA  RecName: Full=UDP-N-acetylmuramoylalan...  99.8    2e-20
sp|Q1D0S8.1|MURD_MYXXD  RecName: Full=UDP-N-acetylmuramoylalan...  99.4    2e-20 Gene info
sp|Q49WW5.1|MURD_STAS1  RecName: Full=UDP-N-acetylmuramoylalan...  99.0    3e-20 Gene info
sp|A7HNT0.1|MURD_FERNB  RecName: Full=UDP-N-acetylmuramoylalan...  99.0    3e-20 Gene info
sp|Q11GS3.1|MURD_MESSB  RecName: Full=UDP-N-acetylmuramoylalan...  98.2    4e-20 Gene info
sp|A1AZK7.1|MURD_PARDP  RecName: Full=UDP-N-acetylmuramoylalan...  97.1    1e-19 Gene info
sp|Q83HK0.1|MURD_TROW8  RecName: Full=UDP-N-acetylmuramoylalan...  95.9    3e-19 Gene info
sp|Q2RVU2.1|MURD_RHORT  RecName: Full=UDP-N-acetylmuramoylalan...  94.7    5e-19 Gene info
sp|Q5YYY1.2|MURD_NOCFA  RecName: Full=UDP-N-acetylmuramoylalan...  94.0    1e-18
sp|Q0SHR9.1|MURD_RHOSR  RecName: Full=UDP-N-acetylmuramoylalan...  92.0    3e-18 Gene info
sp|Q5GSC8.1|MURD_WOLTR  RecName: Full=UDP-N-acetylmuramoylalan...  91.7    5e-18 Gene info
sp|Q2W0H5.1|MURD_MAGMM  RecName: Full=UDP-N-acetylmuramoylalan...  91.3    6e-18 Gene info
sp|A9BGS7.1|MURD_PETMO  RecName: Full=UDP-N-acetylmuramoylalan...  90.9    9e-18
sp|Q83GN2.2|MURD_TROWT  RecName: Full=UDP-N-acetylmuramoylalan...  89.7    2e-17
sp|Q216E0.1|MURD_RHOPB  RecName: Full=UDP-N-acetylmuramoylalan...  89.0    3e-17
sp|Q2JD52.1|MURD_FRASC  RecName: Full=UDP-N-acetylmuramoylalan...  88.6    4e-17 Gene info
sp|B8DP81.1|MURD_DESVM  RecName: Full=UDP-N-acetylmuramoylalan...  87.8    7e-17 Gene info
sp|Q6N409.1|MURD_RHOPA  RecName: Full=UDP-N-acetylmuramoylalan...  87.4    9e-17
sp|Q8UDM6.1|MURD_AGRT5  RecName: Full=UDP-N-acetylmuramoylalan...  87.0    1e-16 Gene info
sp|Q52953.2|MURD_RHIME  RecName: Full=UDP-N-acetylmuramoylalan...  86.7    1e-16
sp|B1VHC6.1|MURD_CORU7  RecName: Full=UDP-N-acetylmuramoylalan...  86.7    1e-16
sp|Q8P775.1|MURD_XANCP  RecName: Full=UDP-N-acetylmuramoylalan...  86.7    2e-16
sp|A1TAX0.1|MURD_MYCVP  RecName: Full=UDP-N-acetylmuramoylalan...  86.3    2e-16 Gene info
sp|O51532.1|MURD_BORBU  RecName: Full=UDP-N-acetylmuramoylalan...  85.9    3e-16
sp|B7J2E8.1|MURD_BORBZ  RecName: Full=UDP-N-acetylmuramoylalan...  85.9    3e-16
sp|Q5SJD2.1|MURD_THET8  RecName: Full=UDP-N-acetylmuramoylalan...  84.0    1e-15
sp|Q5H2Y1.1|MURD_XANOR  RecName: Full=UDP-N-acetylmuramoylalan...  83.6    1e-15
sp|A0QF50.1|MURD_MYCA1  RecName: Full=UDP-N-acetylmuramoylalan...  82.0    4e-15 Gene info
sp|Q8PII9.1|MURD_XANAC  RecName: Full=UDP-N-acetylmuramoylalan...  81.6    5e-15
sp|B2J6I3.1|MURD_NOSP7  RecName: Full=UDP-N-acetylmuramoylalan...  81.6    5e-15 Gene info
sp|Q6AE62.1|MURD_LEIXX  RecName: Full=UDP-N-acetylmuramoylalan...  80.5    1e-14
sp|Q1ME31.1|MURD_RHIL3  RecName: Full=UDP-N-acetylmuramoylalan...  80.5    1e-14 Gene info
sp|Q2K6B9.1|MURD_RHIEC  RecName: Full=UDP-N-acetylmuramoylalan...  80.1    2e-14 Gene info
sp|A5UZT4.1|MURD_ROSS1  RecName: Full=UDP-N-acetylmuramoylalan...  79.3    2e-14 Gene info
sp|Q3BR29.1|MURD_XANC5  RecName: Full=UDP-N-acetylmuramoylalan...  79.3    3e-14 Gene info
sp|Q73YQ6.1|MURD_MYCPA  RecName: Full=UDP-N-acetylmuramoylalan...  77.8    6e-14
sp|O06222.1|MURD_MYCTU  RecName: Full=UDP-N-acetylmuramoylalan...  77.0    1e-13
sp|Q98KB1.1|MURD_RHILO  RecName: Full=UDP-N-acetylmuramoylalan...  76.6    2e-13
sp|P57995.1|MURD_MYCLE  RecName: Full=UDP-N-acetylmuramoylalan...  76.3    2e-13
sp|Q0SMS3.1|MURD_BORAP  RecName: Full=UDP-N-acetylmuramoylalan...  75.1    5e-13
sp|B5Z6L9.1|MURD_HELPG  RecName: Full=UDP-N-acetylmuramoylalan...  75.1    5e-13
sp|Q6NGC6.2|MURD_CORDI  RecName: Full=UDP-N-acetylmuramoylalan...  75.1    5e-13
sp|Q1J147.1|MURD_DEIGD  RecName: Full=UDP-N-acetylmuramoylalan...  74.7    7e-13
sp|Q7VEP7.1|MURD_MYCBO  RecName: Full=UDP-N-acetylmuramoylalan...  74.3    8e-13
sp|Q4JW97.1|MURD_CORJK  RecName: Full=UDP-N-acetylmuramoylalan...  72.8    2e-12 Gene info
sp|Q87EA7.1|MURD_XYLFT  RecName: Full=UDP-N-acetylmuramoylalan...  72.0    4e-12 Gene info
sp|Q9PEB0.1|MURD_XYLFA  RecName: Full=UDP-N-acetylmuramoylalan...  70.5    1e-11
sp|Q9PI73.1|MURD_CAMJE  RecName: Full=UDP-N-acetylmuramoylalan...  68.2    5e-11
sp|A7NI97.1|MURD_ROSCS  RecName: Full=UDP-N-acetylmuramoylalan...  68.2    6e-11 Gene info
sp|A8FKL9.1|MURD_CAMJ8  RecName: Full=UDP-N-acetylmuramoylalan...  67.8    7e-11 Gene info
sp|Q5HW34.1|MURD_CAMJR  RecName: Full=UDP-N-acetylmuramoylalan...  67.8    7e-11 Gene info
sp|A0LTM4.1|MURC_ACIC1  RecName: Full=UDP-N-acetylmuramate--L-...  67.8    7e-11 Gene info
sp|A1VYE9.1|MURD_CAMJJ  RecName: Full=UDP-N-acetylmuramoylalan...  67.4    9e-11 Gene info
sp|Q7M8F9.1|MURE_WOLSU  RecName: Full=UDP-N-acetylmuramoyl-L-a...  65.5    4e-10
sp|A5CS50.1|MURC_CLAM3  RecName: Full=UDP-N-acetylmuramate--L-...  64.7    6e-10
sp|A7H4U5.1|MURD_CAMJD  RecName: Full=UDP-N-acetylmuramoylalan...  63.2    2e-09 Gene info
sp|B1MP38.1|MURC_MYCA9  RecName: Full=UDP-N-acetylmuramate--L-...  62.8    2e-09
sp|A6UB84.1|MURC_SINMW  RecName: Full=UDP-N-acetylmuramate--L-...  62.8    2e-09 Gene info
sp|Q9ZLY0.1|MURD_HELPJ  RecName: Full=UDP-N-acetylmuramoylalan...  62.8    2e-09 Gene info
sp|Q1CU35.1|MURD_HELPH  RecName: Full=UDP-N-acetylmuramoylalan...  62.4    3e-09
sp|Q92NM0.1|MURC_RHIME  RecName: Full=UDP-N-acetylmuramate--L-...  62.0    4e-09
sp|B0RIJ4.1|MURC_CLAMS  RecName: Full=UDP-N-acetylmuramate--L-...  61.6    5e-09 Gene info
sp|Q2LR47.1|MURC_SYNAS  RecName: Full=UDP-N-acetylmuramate--L-...  61.6    5e-09 Gene info
sp|O25236.1|MURD_HELPY  RecName: Full=UDP-N-acetylmuramoylalan...  61.6    6e-09
sp|A5D144.1|MURC_PELTS  RecName: Full=UDP-N-acetylmuramate--L-...  61.2    7e-09
sp|Q8UDM9.1|MURC_AGRT5  RecName: Full=UDP-N-acetylmuramate--L-...  60.8    8e-09 Gene info
sp|Q8R749.1|MURC_THETN  RecName: Full=UDP-N-acetylmuramate--L-...  60.5    1e-08
sp|Q2K6C2.2|MURC_RHIEC  RecName: Full=UDP-N-acetylmuramate--L-...  60.1    2e-08 Gene info
sp|Q8Y5L9.1|MURE_LISMO  RecName: Full=UDP-N-acetylmuramoyl-L-a...  58.9    4e-08
sp|A9KQI8.1|MURC_CLOPH  RecName: Full=UDP-N-acetylmuramate--L-...  58.5    4e-08 Gene info
sp|O69290.2|MURE_CAMJE  RecName: Full=UDP-N-acetylmuramoyl-L-a...  57.8    7e-08
sp|A3DIP6.1|MURC_CLOTH  RecName: Full=UDP-N-acetylmuramate--L-...  57.8    9e-08 Gene info
sp|P65469.1|MURC_BRUSU  RecName: Full=UDP-N-acetylmuramate--L-...  57.4    1e-07
sp|P61683.1|MURC_WOLPM  RecName: Full=UDP-N-acetylmuramate--L-...  57.0    1e-07
sp|Q71XX5.1|MURE_LISMF  RecName: Full=UDP-N-acetylmuramoyl-L-a...  57.0    1e-07 Gene info
sp|Q0RNN9.1|MURC_FRAAA  RecName: Full=UDP-N-acetylmuramate--L-...  57.0    1e-07 Gene info
sp|Q0TMG0.2|MURC_CLOP1  RecName: Full=UDP-N-acetylmuramate--L-...  56.6    1e-07
sp|Q1ME34.1|MURC_RHIL3  RecName: Full=UDP-N-acetylmuramate--L-...  56.6    2e-07 Gene info
sp|A0JV95.1|MURC_ARTS2  RecName: Full=UDP-N-acetylmuramate--L-...  56.2    2e-07 Gene info
sp|A4J2B2.1|MURC_DESRM  RecName: Full=UDP-N-acetylmuramate--L-...  56.2    2e-07 Gene info
sp|Q8DJI4.1|MURE_THEEB  RecName: Full=UDP-N-acetylmuramoyl-L-a...  56.2    2e-07
sp|Q97E89.1|MURC_CLOAB  RecName: Full=UDP-N-acetylmuramate--L-...  56.2    2e-07
sp|A5EPK1.1|MURC_BRASB  RecName: Full=UDP-N-acetylmuramate--L-...  56.2    2e-07 Gene info
sp|Q0SQ58.1|MURC_CLOPS  RecName: Full=UDP-N-acetylmuramate--L-...  56.2    3e-07 Gene info
sp|Q9RRJ4.1|MURD_DEIRA  RecName: Full=UDP-N-acetylmuramoylalan...  56.2    3e-07
sp|Q8XHJ0.2|MURC_CLOPE  RecName: Full=UDP-N-acetylmuramate--L-...  55.5    4e-07
sp|Q2S527.1|MURC_SALRD  RecName: Full=UDP-N-acetylmuramate--L-...  55.1    6e-07 Gene info
sp|Q2IYK6.1|MURC_RHOP2  RecName: Full=UDP-N-acetylmuramate--L-...  55.1    6e-07
sp|Q7V2Q8.1|MURE_PROMP  RecName: Full=UDP-N-acetylmuramoyl-L-a...  54.3    8e-07 Gene info
sp|Q01Q49.1|MURC_SOLUE  RecName: Full=UDP-N-acetylmuramate--L-...  54.3    8e-07
sp|Q6G2Q6.1|MURC_BARHE  RecName: Full=UDP-N-acetylmuramate--L-...  54.3    9e-07
sp|Q929X9.1|MURE_LISIN  RecName: Full=UDP-N-acetylmuramoyl-L-a...  53.9    1e-06
sp|Q9Z8C5.1|MURE_CHLPN  RecName: Full=UDP-N-acetylmuramoyl-L-a...  53.9    1e-06
sp|Q97H84.1|MURE1_CLOAB  RecName: Full=UDP-N-acetylmuramoyl-L-...  53.9    1e-06
sp|P61682.1|MURC_RHOPA  RecName: Full=UDP-N-acetylmuramate--L-...  53.5    1e-06
sp|Q894B7.1|MURE_CLOTE  RecName: Full=UDP-N-acetylmuramoyl-L-a...  53.5    2e-06
sp|A4YZK2.1|MURC_BRASO  RecName: Full=UDP-N-acetylmuramate--L-...  53.1    2e-06 Gene info
sp|Q2NCY9.1|MURC_ERYLH  RecName: Full=UDP-N-acetylmuramate--L-...  53.1    2e-06 Gene info
sp|A5N4I2.1|MURC_CLOK5  RecName: Full=UDP-N-acetylmuramate--L-...  53.1    2e-06 Gene info
sp|A4XGE5.1|MURC_CALS8  RecName: Full=UDP-N-acetylmuramate--L-...  53.1    2e-06
sp|O83873.1|MURD_TREPA  RecName: Full=UDP-N-acetylmuramoylalan...  52.8    3e-06
sp|Q8XVI8.1|MURC_RALSO  RecName: Full=UDP-N-acetylmuramate--L-...  52.4    3e-06
sp|Q133X2.1|MURC_RHOPS  RecName: Full=UDP-N-acetylmuramate--L-...  52.4    4e-06
sp|A1K3U7.1|MURC_AZOSB  RecName: Full=UDP-N-acetylmuramate--L-...  52.0    4e-06 Gene info
sp|Q7VF14.1|MURE_HELHP  RecName: Full=UDP-N-acetylmuramoyl-L-a...  52.0    5e-06
sp|Q6G125.1|MURC_BARQU  RecName: Full=UDP-N-acetylmuramate--L-...  51.6    6e-06
sp|A7FTY1.1|MURE_CLOB1  RecName: Full=UDP-N-acetylmuramoyl-L-a...  51.2    7e-06
sp|Q07PT2.1|MURC_RHOP5  RecName: Full=UDP-N-acetylmuramate--L-...  51.2    8e-06 Gene info
sp|A6WZQ7.1|MURC_OCHA4  RecName: Full=UDP-N-acetylmuramate--L-...  50.8    9e-06 Gene info
sp|Q5P6Z7.1|MURC_AZOSE  RecName: Full=UDP-N-acetylmuramate--L-...  50.8    9e-06 Gene info
sp|Q2RVU5.1|MURC_RHORT  RecName: Full=UDP-N-acetylmuramate--L-...  50.8    9e-06 Gene info
sp|A9FI59.1|MURC_SORC5  RecName: Full=UDP-N-acetylmuramate--L-...  50.8    9e-06
sp|A6LPI8.1|MURC_CLOB8  RecName: Full=UDP-N-acetylmuramate--L-...  50.8    1e-05 Gene info
sp|P61681.1|MURC_MYCPA  RecName: Full=UDP-N-acetylmuramate--L-...  50.4    1e-05
sp|A7GJE2.1|MURC_CLOBL  RecName: Full=UDP-N-acetylmuramate--L-...  50.4    1e-05 Gene info
sp|A7FPH5.1|MURC_CLOB1  RecName: Full=UDP-N-acetylmuramate--L-...  50.4    1e-05
sp|A0PXK5.1|MURC_CLONN  RecName: Full=UDP-N-acetylmuramate--L-...  50.4    1e-05 Gene info
sp|Q5ZSA5.1|MURC_LEGPH  RecName: Full=UDP-N-acetylmuramate--L-...  50.4    1e-05
sp|Q5WTI7.1|MURC_LEGPL  RecName: Full=UDP-N-acetylmuramate--L-...  50.4    1e-05 Gene info
sp|Q5X1S6.1|MURC_LEGPA  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    1e-05 Gene info
sp|P61676.1|MURC_BDEBA  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    1e-05
sp|Q5YYX8.1|MURC_NOCFA  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    2e-05
sp|Q98KB4.1|MURC_RHILO  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    2e-05
sp|Q47AA5.1|MURC_DECAR  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    2e-05 Gene info
sp|Q0K6M5.1|MURC_RALEH  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    2e-05 Gene info
sp|Q899J1.1|MURC_CLOTE  RecName: Full=UDP-N-acetylmuramate--L-...  50.1    2e-05
sp|Q253Y4.1|MURE_CHLFF  RecName: Full=UDP-N-acetylmuramoyl-L-a...  50.1    2e-05 Gene info
sp|Q1LIM7.1|MURC_RALME  RecName: Full=UDP-N-acetylmuramate--L-...  49.7    2e-05 Gene info
sp|Q748D2.1|MURE_GEOSL  RecName: Full=UDP-N-acetylmuramoyl-L-a...  49.3    3e-05
sp|Q8CZE6.1|MURE1_OCEIH  RecName: Full=UDP-N-acetylmuramoyl-L-...  49.3    3e-05
sp|A8HZ95.1|MURC_AZOC5  RecName: Full=UDP-N-acetylmuramate--L-...  49.3    3e-05 Gene info
sp|Q1LSW6.1|MURC_BAUCH  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    3e-05 Gene info
sp|Q211T9.1|MURC_RHOPB  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    3e-05
sp|Q3STS7.1|MURC_NITWN  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    3e-05 Gene info
sp|Q1QNU2.1|MURC_NITHX  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    3e-05 Gene info
sp|Q0AJE2.1|MURC_NITEC  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    4e-05 Gene info
sp|Q1GZ02.1|MURC_METFK  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    4e-05 Gene info
sp|A5UZT9.1|MURC_ROSS1  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    4e-05 Gene info
sp|A7MIF0.1|MURC_ENTS8  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    4e-05 Gene info
sp|A5WCT9.1|MURC_PSYWF  RecName: Full=UDP-N-acetylmuramate--L-...  48.9    4e-05 Gene info
sp|Q0VS07.1|MURE_ALCBS  RecName: Full=UDP-N-acetylmuramoyl-L-a...  48.5    4e-05 Gene info
sp|A3QIM0.1|MURC_SHELP  RecName: Full=UDP-N-acetylmuramate--L-...  48.5    5e-05 Gene info
sp|Q89FU8.1|MURC_BRAJA  RecName: Full=UDP-N-acetylmuramate--L-...  48.5    5e-05
sp|A5G8J9.1|MURC_GEOUR  RecName: Full=UDP-N-acetylmuramate--L-...  48.5    5e-05 Gene info
sp|O67373.1|MURC_AQUAE  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    6e-05
sp|Q12EL4.1|MURC_POLSJ  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    6e-05 Gene info
sp|Q1BZG2.1|MURC_BURCA  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    6e-05 Gene info
sp|Q46WZ5.1|MURC_RALEJ  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    6e-05 Gene info
sp|Q0BIK0.1|MURC_BURCM  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    7e-05
sp|Q39JW9.1|MURC_BURS3  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    7e-05
sp|A1UTC4.1|MURC_BARBK  RecName: Full=UDP-N-acetylmuramate--L-...  48.1    7e-05 Gene info
sp|Q03523.1|MURE_BACSU  RecName: Full=UDP-N-acetylmuramoyl-L-a...  47.8    8e-05
sp|Q838A4.1|MURE_ENTFA  RecName: Full=UDP-N-acetylmuramoyl-L-a...  47.8    9e-05
sp|B0KFS5.1|MURC_PSEPG  RecName: Full=UDP-N-acetylmuramate--L-...  47.8    9e-05 Gene info
sp|A6VQN2.1|MURC_ACTSZ  RecName: Full=UDP-N-acetylmuramate--L-...  47.8    9e-05 Gene info
sp|A6TJM2.1|MURC_ALKMQ  RecName: Full=UDP-N-acetylmuramate--L-...  47.8    9e-05 Gene info
sp|A1VST5.1|MURC_POLNA  RecName: Full=UDP-N-acetylmuramate--L-...  47.4    1e-04 Gene info
sp|Q13TZ3.1|MURC_BURXL  RecName: Full=UDP-N-acetylmuramate--L-...  47.4    1e-04
sp|Q0VS01.1|MURC_ALCBS  RecName: Full=UDP-N-acetylmuramate--L-...  47.4    1e-04 Gene info
sp|Q2S9Z3.1|MURC_HAHCH  RecName: Full=UDP-N-acetylmuramate--L-...  47.0    1e-04 Gene info
sp|Q2Y639.2|MURC_NITMU  RecName: Full=UDP-N-acetylmuramate--L-...  47.0    1e-04
sp|Q88Y23.2|MURE_LACPL  RecName: Full=UDP-N-acetylmuramoyl-L-a...  47.0    1e-04
sp|P96613.1|MURF_BACSU  RecName: Full=UDP-N-acetylmuramoyl-tri...  47.0    1e-04
sp|B5EBQ2.1|MURC_GEOBB  RecName: Full=UDP-N-acetylmuramate--L-...  47.0    1e-04
sp|Q1AVX4.1|MURC_RUBXD  RecName: Full=UDP-N-acetylmuramate--L-...  47.0    1e-04 Gene info
sp|Q313Q2.1|MURC_DESDG  RecName: Full=UDP-N-acetylmuramate--L-...  47.0    1e-04 Gene info
sp|Q9ZJC6.1|MURE_HELPJ  RecName: Full=UDP-N-acetylmuramoyl-L-a...  47.0    1e-04 Gene info
sp|Q11GS6.1|MURC_MESSB  RecName: Full=UDP-N-acetylmuramate--L-...  47.0    2e-04 Gene info
sp|B8FBR7.1|MURC_DESAA  RecName: Full=UDP-N-acetylmuramate--L-...  46.6    2e-04
sp|A1BJY3.1|MURE_CHLPD  RecName: Full=UDP-N-acetylmuramoyl-L-a...  46.6    2e-04 Gene info
sp|Q2RK78.1|MURC_MOOTA  RecName: Full=UDP-N-acetylmuramate--L-...  46.6    2e-04
sp|Q2NVV0.1|MURC_SODGM  RecName: Full=UDP-N-acetylmuramate--L-...  46.6    2e-04 Gene info
sp|A8LS63.2|MURC_DINSH  RecName: Full=UDP-N-acetylmuramate--L-...  46.6    2e-04
sp|A8MK48.1|MURC_ALKOO  RecName: Full=UDP-N-acetylmuramate--L-...  46.2    2e-04 Gene info
sp|Q39YM4.1|MURE_GEOMG  RecName: Full=UDP-N-acetylmuramoyl-L-a...  46.2    2e-04
sp|Q3SMH2.1|MURC_THIDA  RecName: Full=UDP-N-acetylmuramate--L-...  46.2    2e-04 Gene info
sp|Q9HW02.1|MURC_PSEAE  RecName: Full=UDP-N-acetylmuramate--L-...  46.2    2e-04
sp|A6VB84.1|MURC_PSEA7  RecName: Full=UDP-N-acetylmuramate--L-...  46.2    2e-04 Gene info
sp|A9MQC1.1|MURC_SALAR  RecName: Full=UDP-N-acetylmuramate--L-...  46.2    2e-04 Gene info
sp|Q1I5B9.1|MURC_PSEE4  RecName: Full=UDP-N-acetylmuramate--L-...  46.2    3e-04 Gene info
sp|Q0A6K3.1|MURC_ALHEH  RecName: Full=UDP-N-acetylmuramate--L-...  45.8    3e-04 Gene info
sp|Q5MZI0.1|MURC_SYNP6  RecName: Full=UDP-N-acetylmuramate--L-...  45.8    3e-04 Gene info
sp|P61677.1|MURC_CORDI  RecName: Full=UDP-N-acetylmuramate--L-...  45.8    3e-04
sp|Q82VS2.1|MURC_NITEU  RecName: Full=UDP-N-acetylmuramate--L-...  45.8    3e-04
sp|Q82VS8.1|MURE_NITEU  RecName: Full=UDP-N-acetylmuramoyl-L-a...  45.8    3e-04
sp|Q4JW94.1|MURC_CORJK  RecName: Full=UDP-N-acetylmuramate--L-...  45.4    3e-04 Gene info
sp|Q9RNM7.2|MURC_ZYMMO  RecName: Full=UDP-N-acetylmuramate--L-...  45.4    4e-04
sp|Q8XJ99.1|MURE_CLOPE  RecName: Full=UDP-N-acetylmuramoyl-L-a...  45.4    4e-04
sp|A1WC05.1|MURC_ACISJ  RecName: Full=UDP-N-acetylmuramate--L-...  45.4    4e-04 Gene info
sp|B6IRG1.1|MURC_RHOCS  RecName: Full=UDP-N-acetylmuramate--L-...  45.4    4e-04
sp|A6H194.1|MURC_FLAPJ  RecName: Full=UDP-N-acetylmuramate--L-...  45.4    4e-04 Gene info
sp|Q4FQW0.1|MURC_PSYA2  RecName: Full=UDP-N-acetylmuramate--L-...  45.4    4e-04 Gene info
sp|O26027.1|MURE_HELPY  RecName: Full=UDP-N-acetylmuramoyl-L-a...  45.4    4e-04
sp|Q8KGC9.1|MURE_CHLTE  RecName: Full=UDP-N-acetylmuramoyl-L-a...  45.4    4e-04
sp|A1R5F9.1|MURC_ARTAT  RecName: Full=UDP-N-acetylmuramate--L-...  45.1    5e-04 Gene info
sp|Q819Q0.1|MURE_BACCR  RecName: Full=UDP-N-acetylmuramoyl-L-a...  45.1    5e-04 Gene info
sp|Q0SHS2.1|MURC_RHOSR  RecName: Full=UDP-N-acetylmuramate--L-...  45.1    6e-04 Gene info
sp|Q1Q945.1|MURC_PSYCK  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    6e-04 Gene info
sp|P61679.1|MURC_GEOSL  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    6e-04
sp|A0L5N0.1|MURC_MAGSM  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    6e-04 Gene info
sp|Q8FNU1.1|MURC_COREF  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    7e-04
sp|Q4FPK6.1|MURC_PELUB  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    7e-04 Gene info
sp|Q6AE65.1|MURC_LEIXX  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    7e-04
sp|A7Z4E1.1|MURE_BACA2  RecName: Full=UDP-N-acetylmuramoyl-L-a...  44.7    8e-04 Gene info
sp|A4VIH9.1|MURC_PSEU5  RecName: Full=UDP-N-acetylmuramate--L-...  44.7    8e-04 Gene info
sp|Q163J1.1|MURC_ROSDO  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    8e-04 Gene info
sp|B6J2Q2.1|MURC_COXB2  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    8e-04
sp|B0T827.1|MURC_CAUSK  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    8e-04 Gene info
sp|A2C5M3.1|MURC_PROM3  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    9e-04 Gene info
sp|Q7NPZ4.1|MURE_CHRVO  RecName: Full=UDP-N-acetylmuramoyl-L-a...  44.3    9e-04
sp|Q81WC7.1|MURE_BACAN  RecName: Full=UDP-N-acetylmuramoyl-L-a...  44.3    9e-04
sp|A1TKD2.1|MURC_ACIAC  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    0.001 Gene info
sp|Q83F17.1|MURC_COXBU  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    0.001
sp|A4JB95.1|MURC_BURVG  RecName: Full=UDP-N-acetylmuramate--L-...  44.3    0.001 Gene info
....
..
.

First alignments:

>sp|Q1GYZ9.1|MURD_METFK Gene info RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=453

 GENE ID: 4001365 Mfla_2271 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Methylobacillus flagellatus KT] (10 or fewer PubMed links)

 Score =  226 bits (577),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 137/306 (44%), Positives = 189/306 (61%), Gaps = 8/306 (2%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGKSTVT +V  I +  G   V  GNIG+PVL+V+           DV+VLE+SSFQ++T
Sbjct  119  NGKSTVTTLVGEICKAAGFKTVVAGNIGLPVLDVIND-------AVDVYVLELSSFQLET  171

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEIA-GED  119
            TYS   DAA VLN+S DH+DRY D  AY  +K RI +  G++V+N D+       A G  
Sbjct  172  TYSLAADAATVLNISADHMDRYADMQAYANAKARIFTRAGLQVLNADDAWSRGMAAEGVA  231

Query  120  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
             ++FGL  P + + +G+   AGE W+A G +++    DL ++G+HN  NA+AALAL + L
Sbjct  232  QLTFGLDAPRSAQDFGLLHDAGEAWLARGQRKLMPVADLNITGLHNAANALAALALCTVL  291

Query  180  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLG  239
                  A++ L  ++GL HR+QWVADI GV FY+DSK TNVGAT AA+ GL  K VL+ G
Sbjct  292  DIDEVVALQALRDFKGLPHRVQWVADIDGVSFYDDSKGTNVGATVAALHGLNRKLVLIAG  351

Query  240  GESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLA  299
            G+ K Q+F  L   + +  R VVL+GRDA +I   ++ +GV +     L  AV  A  LA
Sbjct  352  GDGKGQDFAALRAPVAKHARAVVLIGRDAGVIADALQESGVLLEYGDTLEEAVVKAFNLA  411

Query  300  EPGEIV  305
            + G+ V
Sbjct  412  DRGDAV  417


>sp|A3M1C6.2|MURD_ACIBT  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=448

 Score =  215 bits (547),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 184/306 (60%), Gaps = 24/306 (7%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            N KSTVT ++  + ++ G      GN+G P L++L       +  P++ VLE+SSFQ++T
Sbjct  114  NAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLL-------KDQPELLVLELSSFQLET  166

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDE----PIVLNEIA  116
            T     + AVVLN+SEDHLDR+ +   Y ++K RI  G    V NRD+    P+V +   
Sbjct  167  TSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSRPLVPDTTP  226

Query  117  GEDSVSFGLSPPDNDRSWGVSKIA-GEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALAL  175
             +   SFGL+ PD ++ +GV + A G  W+ACG Q++ +  DL + GMHNV NA+A LAL
Sbjct  227  MQ---SFGLNAPDLNQ-YGVLRDADGTLWLACGLQRLIKSSDLYIQGMHNVANALACLAL  282

Query  176  SSTLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPA---  232
               +    E  +  L  ++GL+HR ++V  +  V++YNDSK TNVGAT AAI GL A   
Sbjct  283  GEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIE  342

Query  233  ----KCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADL  288
                K  L+LGG+ K Q+F  L   I +  +VVVL+G DA +I++ I+GA   IL AA L
Sbjct  343  VKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGA-TKILHAATL  401

Query  289  INAVQI  294
              AV++
Sbjct  402  KEAVEL  407


>sp|Q2Y636.1|MURD_NITMU  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=473

 Score =  215 bits (547),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 134/308 (43%), Positives = 183/308 (59%), Gaps = 4/308 (1%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGK+TVT M   +L++ G D    GNIG  VL+ L + E    KMP  +VLE+SSFQ++T
Sbjct  122  NGKTTVTAMTGAMLKKAGWDVEVAGNIGPAVLDALMRREDTG-KMPQAWVLELSSFQLET  180

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSG--RGIKVVNRDEPIVLN-EIAG  117
            T S   DAA VLNVSEDHLDRY     Y  +K RI  G   G++++N D+P+V    +AG
Sbjct  181  TKSLGLDAAAVLNVSEDHLDRYAGMQEYAAAKARIFLGDSEGVQILNGDDPVVRQMTLAG  240

Query  118  EDSVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSS  177
               V+F L+ P +   +G+ +  G+ W+  G  ++    +L ++G HN  NA+AALAL  
Sbjct  241  RPHVTFSLATPQSADDFGLLREGGDTWLMQGDTRLMDARELAITGRHNCANALAALALCR  300

Query  178  TLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLL  237
             L    E  ++ L  + GL HR++ VA  SG+ FY+DSK TNVGAT AA+ GL    VL+
Sbjct  301  ALAVPFEPLLQALREFRGLPHRVEKVAAFSGITFYDDSKGTNVGATVAALKGLGQPVVLI  360

Query  238  LGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQ  297
             GG+ K QNF  L   I E  R VVL+GRDA+ I   I   GV +  A  +  AV+ + Q
Sbjct  361  AGGDGKAQNFSPLAAPIGEHGRAVVLIGRDAEKIAVAINECGVPLHRAQTMEEAVRKSFQ  420

Query  298  LAEPGEIV  305
            LA  G+ V
Sbjct  421  LAREGDAV  428


>sp|Q3SMH5.1|MURD_THIDA Gene info RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=474

 GENE ID: 3673896 Tbd_0117 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Thiobacillus denitrificans ATCC 25259] (10 or fewer PubMed links)

 Score =  212 bits (539),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 194/307 (63%), Gaps = 6/307 (1%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGKSTVT M   + +  GL     GNIG+PVL+ L +IE+ A  +P V+VLE+SSFQ++T
Sbjct  136  NGKSTVTAMCGDMCRMAGLTVCVAGNIGLPVLDALHEIEQGAAPLPQVWVLELSSFQLET  195

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLN-EIAGED  119
            T S +  AA VLN+SEDH+DRY D  AY  +K RI SG G++V+NRD+P  L   I G  
Sbjct  196  TSSLDATAAAVLNLSEDHMDRYPDMAAYAAAKARIFSGNGVQVLNRDDPRTLAMAIPGRH  255

Query  120  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
             VSFGL     D ++G+     E  +  G   +     L V G+HN  NA+AALAL+  L
Sbjct  256  VVSFGLDRCPTDENFGLC----EDELCLGGDMLMPLSVLAVPGLHNAANALAALALTRAL  311

Query  180  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLP-AKCVLLL  238
                E  +RGL+ ++GL HR++ VADI GV +Y+DSK TNVGAT AA+ G+   K V++L
Sbjct  312  DLPIEALLRGLMHFKGLPHRVEKVADIDGVTWYDDSKGTNVGATEAALYGMGRRKAVVIL  371

Query  239  GGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQL  298
            GG+ K Q+F  L   +    R VVL+GRDA  I+  IE +GV    A  L +AV+ AA+L
Sbjct  372  GGDGKGQDFGPLKAAVAANARAVVLIGRDAVAIEAAIEDSGVASYRADTLPDAVEQAARL  431

Query  299  AEPGEIV  305
            AEPG+ V
Sbjct  432  AEPGDAV  438


>sp|Q82VS5.1|MURD_NITEU  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=471

 Score =  211 bits (538),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 190/311 (61%), Gaps = 8/311 (2%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGK+TVT MV  +++  G D    GNIG   L+ L Q    A K P ++ LE+SSFQ++T
Sbjct  122  NGKTTVTSMVGEMVKNAGWDVEVAGNIGPAALDALMQ-RMDANKWPHLWALELSSFQLET  180

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRI----HSGRGIKVVNRDEPIVLNEIA  116
            T S   DAA VLN+SEDHLDRY   + Y  +K RI    H+   ++++NRD+  V   +A
Sbjct  181  TSSLRPDAATVLNLSEDHLDRYDSIEEYAAAKARIFSRPHNNGCVQILNRDDARVY-AMA  239

Query  117  GEDS--VSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALA  174
             ++S  V+FGLS P +D  +G+     + W+A GS  + +  +L V+G+HN  NA+AALA
Sbjct  240  DKNSKQVTFGLSAPVSDEEFGLLPGGSDVWLAQGSTHLLKTSELAVAGLHNAANALAALA  299

Query  175  LSSTLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKC  234
            L   +    E  +  L ++ GL HRMQ VA+ +GV FY+DSK+TN+G+  AA++G     
Sbjct  300  LCRAVDLPFEPLLHALRTFRGLPHRMQKVAEFNGVTFYDDSKSTNIGSAVAALNGFRKNV  359

Query  235  VLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQI  294
            +L+ GG+ K Q+F  L   + + VR VVL+GRDA  + + I+ + V I     +  AVQ+
Sbjct  360  ILIAGGDGKGQDFSPLEQPVSKHVRSVVLLGRDADKVAQAIQASNVPIHRVTTMDEAVQV  419

Query  295  AAQLAEPGEIV  305
            +  LAE G++V
Sbjct  420  SFLLAEHGDVV  430


>sp|B2I1V6.1|MURD_ACIBC  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=448

 Score =  209 bits (533),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 183/306 (59%), Gaps = 24/306 (7%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            N KSTVT ++  + ++ G      GN+G P L++L       +  P++ VLE+SSFQ++T
Sbjct  114  NAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLL-------KDQPELLVLELSSFQLET  166

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDE----PIVLNEIA  116
            T     + AVVLN+SEDHLDR+ +   Y ++K RI  G    V NRD+    P+V +   
Sbjct  167  TSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSRPLVPDTTP  226

Query  117  GEDSVSFGLSPPDNDRSWGVSKIA-GEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALAL  175
             +   SFGL+ PD ++ +GV + A G  W+A G Q++ +  DL + GMHNV NA+A LAL
Sbjct  227  MQ---SFGLNAPDLNQ-YGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNVANALACLAL  282

Query  176  SSTLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPA---  232
               +    E  +  L  ++GL+HR ++V  +  V++YNDSK TNVGAT AAI GL A   
Sbjct  283  GEAIGLPMESMLETLKRFKGLEHRCEYVKTVRDVRYYNDSKGTNVGATLAAIDGLGAAIE  342

Query  233  ----KCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADL  288
                K  L+LGG+ K Q+F  L   I +  +VVVL+G DA +I++ I+GA   IL AA L
Sbjct  343  VKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGA-TKILHAATL  401

Query  289  INAVQI  294
              AV++
Sbjct  402  KEAVEL  407


>sp|B7H1N2.1|MURD_ACIB3  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 sp|B7I325.1|MURD_ACIB5  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=448

 Score =  209 bits (532),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 183/306 (59%), Gaps = 24/306 (7%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            N KSTVT ++  + ++ G      GN+G P L++L       +  P++ VLE+SSFQ++T
Sbjct  114  NAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLL-------KDQPELLVLELSSFQLET  166

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDE----PIVLNEIA  116
            T     + AVVLN+SEDHLDR+ +   Y ++K RI  G    V NRD+    P+V +   
Sbjct  167  TSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSRPLVPDTTP  226

Query  117  GEDSVSFGLSPPDNDRSWGVSKIA-GEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALAL  175
             +   SFGL+ PD ++ +GV + A G  W+A G Q++ +  DL + GMHNV NA+A LAL
Sbjct  227  MQ---SFGLNAPDLNQ-YGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNVANALACLAL  282

Query  176  SSTLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPA---  232
               +    E  +  L  ++GL+HR ++V  +  V++YNDSK TNVGAT AAI GL A   
Sbjct  283  GEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIE  342

Query  233  ----KCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADL  288
                K  L+LGG+ K Q+F  L   I +  +VVVL+G DA +I++ I+GA   IL AA L
Sbjct  343  VKKGKVALILGGQGKGQDFGPLRSSIEKYAKVVVLIGEDAPVIEQAIQGA-TKILHAATL  401

Query  289  INAVQI  294
              AV++
Sbjct  402  KEAVEL  407


>sp|Q9JSZ5.1|MURD_NEIMA  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
Length=445

 Score =  204 bits (520),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 184/306 (60%), Gaps = 9/306 (2%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGK+TVT +V  +  +CGLD V  GNIG PVLE   +++R  +K  DV+VLE+SSFQ++ 
Sbjct  119  NGKTTVTSLVGYLCIKCGLDTVIAGNIGAPVLEA--ELQREGKK-ADVWVLELSSFQLEN  175

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIV-LNEIAGED  119
            T S    AA VLN+SEDHLDRY D   Y  +K +I  G G++V+N D+      + AG +
Sbjct  176  TESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGRE  235

Query  120  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
               F L   + +  + + +  G   +  G++ +   +D+ + G+HN  N MAA+AL   +
Sbjct  236  VKWFSL---EYEADFWLERETGR--LKQGNEDLIATQDIPLQGLHNATNVMAAVALCEAV  290

Query  180  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLG  239
                E  +  + +++GL HR++ + + +GV F +DSK TNVGATAAAI+GL     ++LG
Sbjct  291  GLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG  350

Query  240  GESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLA  299
            G  K Q+F  L D +  K + V L+G DA  I+R ++G  +++ D A L  AVQ A   A
Sbjct  351  GMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQKAYAQA  410

Query  300  EPGEIV  305
            E G+IV
Sbjct  411  EAGDIV  416

....

----------------------------------------------------------------------------------------------------

b) Blastp vs nr protein sequences, default NCBI parameters except "max target sequences" set to 1000.

                                                                Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_546379.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   226    2e-57 Gene info
ref|ZP_03699179.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   224    9e-57
ref|YP_743027.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   221    6e-56 Gene info
sp|A3M1C6.2|MURD_ACIBT  RecName: Full=UDP-N-acetylmuramoylalan...   215    5e-54
ref|YP_413177.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   215    5e-54 Gene info
ref|YP_001083322.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   214    5e-54 Gene info
ref|YP_313875.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   212    4e-53 Gene info
ref|YP_983637.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   212    4e-53 Gene info
ref|NP_841062.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   211    5e-53 Gene info
ref|YP_001708364.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   209    2e-52 Gene info
ref|YP_001844927.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   209    2e-52 Gene info
ref|YP_002317743.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   209    2e-52 Gene info
ref|YP_001715281.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   209    3e-52 Gene info
ref|ZP_03749793.1|  hypothetical protein NEISUBOT_00845 [Neiss...   209    3e-52
ref|ZP_03822219.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   206    2e-51
ref|YP_002797045.1|  MurD [Laribacter hongkongensis HLHK9] >gb...   205    3e-51
ref|ZP_02062855.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   205    4e-51
ref|YP_002343324.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   204    6e-51 Gene info
ref|YP_114845.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   204    6e-51 Gene info
ref|YP_932386.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   204    8e-51 Gene info
ref|YP_002512846.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   204    1e-50 Gene info
ref|YP_344839.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   203    2e-50 Gene info
ref|ZP_03712931.1|  hypothetical protein EIKCOROL_00603 [Eiken...   203    2e-50
ref|YP_002624314.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   203    2e-50 Gene info
ref|YP_746497.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   202    4e-50 Gene info
ref|YP_001599827.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   201    5e-50 Gene info
ref|NP_904015.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   201    7e-50 Gene info
ref|YP_001354707.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   200    2e-49 Gene info
ref|YP_297185.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   199    2e-49 Gene info
ref|YP_436959.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   198    4e-49 Gene info
ref|YP_692316.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   198    5e-49 Gene info
ref|ZP_03744534.1|  hypothetical protein NEICINOT_00641 [Neiss...   197    1e-48
sp|Q6FFC2.2|MURD_ACIAD  RecName: Full=UDP-N-acetylmuramoylalan...   197    1e-48
ref|YP_045057.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   197    1e-48 Gene info
ref|YP_001503658.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   196    2e-48 Gene info
ref|YP_002006722.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   196    2e-48 Gene info
ref|YP_002002449.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   196    3e-48 Gene info
ref|YP_002792437.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   196    3e-48 Gene info
ref|YP_208583.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    6e-48 Gene info
ref|YP_727717.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    7e-48 Gene info
ref|YP_585271.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    8e-48 Gene info
ref|NP_885907.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    8e-48 Gene info
ref|ZP_03554947.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   194    1e-47
ref|NP_273468.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    1e-47 Gene info
ref|NP_890735.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   193    1e-47 Gene info
ref|YP_787377.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   193    1e-47 Gene info
ref|ZP_03689586.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   193    2e-47
ref|ZP_03720599.1|  hypothetical protein NEIFLAOT_02461 [Neiss...   192    2e-47
ref|NP_881600.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   192    3e-47 Gene info
ref|ZP_03721983.1|  hypothetical protein NEILACOT_01273 [Neiss...   192    3e-47
ref|ZP_03747129.1|  hypothetical protein NEIMUCOT_01111 [Neiss...   191    6e-47
ref|YP_350403.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   190    1e-46 Gene info
ref|YP_975691.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   190    2e-46 Gene info
ref|YP_001101048.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   189    2e-46 Gene info
ref|NP_743494.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   189    3e-46 Gene info
ref|YP_002798524.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   189    4e-46
ref|YP_001897086.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   188    4e-46 Gene info
ref|YP_609953.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   188    5e-46 Gene info
ref|YP_001562497.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   187    1e-45 Gene info
ref|YP_001291004.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   186    2e-45 Gene info
ref|ZP_03741715.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   186    2e-45
ref|ZP_03541241.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   186    2e-45
ref|YP_002661646.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   186    2e-45 Gene info
ref|YP_002586308.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   185    4e-45 Gene info
ref|YP_001670736.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   185    5e-45 Gene info
ref|YP_001269696.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   184    6e-45 Gene info
ref|YP_001472149.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   184    8e-45 Gene info
ref|YP_001747816.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   184    1e-44 Gene info
ref|YP_001249856.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   184    1e-44 Gene info
ref|ZP_01788866.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   184    1e-44
ref|ZP_01915387.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   184    1e-44
ref|YP_001900646.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   184    1e-44 Gene info
ref|NP_439294.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   183    1e-44 GeoGene info
ref|ZP_00155602.2|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   183    2e-44
ref|YP_340996.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   182    2e-44 Gene info
ref|ZP_00945779.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   182    3e-44
ref|YP_001293049.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   182    3e-44 Gene info
ref|YP_124974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   182    4e-44 Gene info
ref|YP_871369.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   182    4e-44 Gene info
ref|YP_262142.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   182    4e-44 Gene info
ref|YP_096621.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   182    4e-44 Gene info
ref|ZP_01796858.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   182    4e-44
ref|ZP_01786018.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   182    4e-44
ref|YP_987859.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   182    5e-44 Gene info
ref|YP_735693.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   182    5e-44 Gene info
ref|ZP_01899263.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   181    5e-44
ref|YP_154826.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   181    5e-44 Gene info
sp|Q9F1N2.1|MURD_SHEVI  RecName: Full=UDP-N-acetylmuramoylalan...   181    6e-44
ref|YP_736444.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   181    7e-44 Gene info
ref|YP_001182016.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   181    7e-44 Gene info
ref|ZP_01127093.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   181    7e-44
ref|YP_002670389.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   181    8e-44 Gene info
ref|YP_127868.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   181    9e-44 Gene info
ref|YP_001425285.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   181    9e-44 Gene info
ref|NP_819181.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   181    9e-44 Gene info
ref|YP_002554415.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   181    9e-44 Gene info
ref|ZP_03267899.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   181    1e-43
ref|ZP_02009820.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   180    1e-43
ref|ZP_01705146.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   180    2e-43
ref|YP_961793.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   180    2e-43 Gene info
ref|ZP_02159038.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   180    2e-43
ref|ZP_01945936.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   180    2e-43
ref|YP_858325.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   179    2e-43 Gene info
ref|ZP_00156976.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   179    2e-43
ref|ZP_01308408.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   179    2e-43
ref|ZP_01736231.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   179    4e-43
ref|NP_719749.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   178    4e-43 Gene info
ref|YP_001048801.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   178    6e-43 Gene info
ref|YP_271115.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   178    7e-43 Gene info
ref|YP_001858893.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   177    8e-43 Gene info
ref|ZP_01168182.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   177    8e-43
ref|YP_002311565.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   177    8e-43 Gene info
ref|ZP_01868442.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   177    9e-43
ref|YP_157818.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   177    9e-43 Gene info
ref|YP_001364631.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   177    1e-42 Gene info
ref|YP_002356382.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   177    1e-42 Gene info
ref|ZP_01363919.1|  hypothetical protein PaerPA_01001022 [Pseu...   177    1e-42
ref|YP_969191.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   177    1e-42 Gene info
ref|YP_547923.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   177    1e-42 Gene info
emb|CAD16553.1|  probable udp-n-acetylmuramoylalanine--d-gluta...   177    2e-42 Gene info
ref|YP_001186420.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   176    2e-42 Gene info
ref|NP_520967.2|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   176    2e-42 Gene info
ref|ZP_01618541.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   176    2e-42
ref|YP_001171619.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   176    2e-42 Gene info
ref|YP_926233.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   176    2e-42 Gene info
ref|NP_253104.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   176    2e-42 Gene info
ref|YP_002442374.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   176    2e-42 Gene info
ref|YP_001672687.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   176    2e-42 Gene info
gb|AAG45237.1|  MurD [Pseudomonas aeruginosa]                       176    2e-42
ref|YP_002232566.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   175    4e-42 Gene info
ref|YP_001095580.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   175    5e-42 Gene info
ref|YP_001140324.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   174    1e-41 Gene info
ref|YP_959716.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   174    1e-41 Gene info
ref|NP_933405.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   174    1e-41 Gene info
ref|YP_002099344.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   173    2e-41 Gene info
ref|YP_561371.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   173    2e-41 Gene info
ref|YP_718566.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   173    2e-41 Gene info
ref|YP_792760.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   173    2e-41 Gene info
ref|YP_001983387.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   173    2e-41 Gene info
ref|NP_759569.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   173    2e-41 Gene info
ref|YP_524667.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   172    2e-41 Gene info
ref|YP_903964.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   172    3e-41 Gene info
ref|YP_001629298.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   172    3e-41 Gene info
ref|YP_002127548.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   172    3e-41 Gene info
ref|YP_001783964.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   172    3e-41 Gene info
ref|YP_441664.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   172    4e-41 Gene info
ref|YP_999284.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   172    4e-41 Gene info
ref|ZP_01792776.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   171    5e-41
ref|YP_001552852.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   171    6e-41 Gene info
ref|YP_560501.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   171    6e-41 Gene info
ref|YP_001118380.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   171    6e-41 Gene info
ref|YP_276232.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   171    9e-41 Gene info
ref|ZP_01043583.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   171    1e-40
ref|ZP_01612196.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   171    1e-40
ref|YP_526320.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   170    1e-40 Gene info
ref|YP_001219540.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   170    1e-40 Gene info
ref|ZP_01895011.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   170    1e-40
ref|YP_001345217.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   170    2e-40 Gene info
ref|YP_367888.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   169    3e-40 Gene info
ref|ZP_01627198.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   169    4e-40
ref|ZP_01766907.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   168    5e-40
ref|YP_237172.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    6e-40 Gene info
ref|ZP_02479193.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   168    6e-40
ref|YP_002474764.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   168    6e-40 Gene info
ref|ZP_02887834.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   168    6e-40
ref|YP_002073583.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   168    7e-40 Gene info
ref|NP_794164.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   167    8e-40 Gene info
ref|YP_574242.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   167    9e-40 Gene info
ref|ZP_03394720.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   167    1e-39
ref|YP_286699.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   167    1e-39 Gene info
ref|YP_265321.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   166    2e-39 Gene info
ref|YP_002251946.1|  udp-n-acetylmuramoylalanine--d-glutamate ...   166    3e-39 Gene info
ref|YP_001762880.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   165    4e-39 Gene info
ref|ZP_02532604.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   165    4e-39
ref|NP_796837.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   165    4e-39 Gene info
ref|ZP_02364225.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   165    5e-39
ref|NP_245077.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   164    8e-39 Gene info
ref|ZP_02378406.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   164    9e-39
ref|YP_752470.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   164    1e-38 Gene info
ref|YP_002665342.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   164    1e-38 Gene info
ref|NP_777827.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   163    2e-38 Gene info
ref|ZP_01988070.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   163    2e-38
ref|ZP_03620958.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   163    2e-38
ref|YP_002467975.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   163    2e-38 Gene info
ref|NP_240048.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   163    2e-38 Gene info
ref|ZP_02357117.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   163    2e-38
ref|ZP_01224266.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   162    3e-38
ref|ZP_02464864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   162    4e-38
emb|CAA35611.1|  unnamed protein product [Escherichia coli]         162    4e-38
ref|YP_001444126.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   162    4e-38 Gene info
ref|NP_871211.1|  hypothetical protein WGLp208 [Wigglesworthia...   162    5e-38 Gene info
ref|YP_001906697.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   162    5e-38 Gene info
ref|YP_001581019.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   161    6e-38 Gene info
ref|YP_663077.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   161    6e-38 Gene info
emb|CAH37039.1|  UDP-N-acetylmuramoylalanine--D-glutamate liga...   161    7e-38 Gene info
ref|ZP_02373345.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   161    7e-38
ref|YP_991823.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   161    7e-38 Gene info
ref|YP_002034767.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   161    7e-38 Gene info
ref|ZP_00442376.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   161    7e-38
ref|ZP_02457402.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   161    7e-38
ref|YP_001060537.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   161    7e-38 Gene info
ref|ZP_02483408.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   161    8e-38
ref|ZP_02491598.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   161    8e-38
ref|NP_720984.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   161    8e-38 Gene info
ref|YP_002013934.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   161    8e-38 Gene info
ref|YP_942581.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   161    8e-38 Gene info
gb|ABZ89707.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   161    8e-38
ref|ZP_02413087.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   161    8e-38
ref|YP_104096.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   161    8e-38 Gene info
ref|YP_002063566.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   161    9e-38 Gene info
ref|ZP_03586254.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   160    1e-37
ref|YP_001175372.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   160    1e-37 Gene info
ref|ZP_01078506.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   160    1e-37
ref|YP_001005019.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   160    1e-37 Gene info
ref|ZP_01221036.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   160    2e-37
ref|YP_088861.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   160    2e-37 Gene info
ref|ZP_03642973.1|  hypothetical protein BACCOPRO_01334 [Bacte...   159    2e-37
ref|ZP_03575542.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   159    2e-37
ref|NP_878446.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamate l...   159    2e-37 Gene info
ref|YP_002092431.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   159    3e-37 Gene info
ref|YP_902941.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   159    3e-37 Gene info
ref|YP_001439308.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   159    3e-37 Gene info
ref|ZP_01133441.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   159    4e-37
ref|YP_390836.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   159    4e-37 Gene info
ref|YP_001454807.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   159    4e-37 Gene info
ref|ZP_03280786.1|  hypothetical protein ENTCAN_00531 [Enterob...   159    4e-37
ref|YP_001530669.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   159    4e-37 Gene info
ref|YP_001341464.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   158    5e-37 Gene info
ref|YP_001279085.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   158    5e-37 Gene info
ref|ZP_01115002.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   158    5e-37
ref|ZP_01215960.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   158    5e-37
ref|YP_619963.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   158    5e-37 Gene info
ref|NP_930864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   158    6e-37 Gene info
ref|NP_670925.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    8e-37 Gene info
ref|ZP_03367430.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   157    9e-37
ref|NP_706043.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    9e-37 Gene info
gb|ABZ89690.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   157    9e-37
ref|NP_459131.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    1e-36 Gene info
ref|ZP_03835243.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   157    1e-36
ref|YP_215110.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    1e-36 Gene info
ref|ZP_02655463.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   157    1e-36
ref|YP_001722240.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   157    1e-36 Gene info
ref|YP_149473.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    1e-36 Gene info
ref|ZP_03968348.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   157    1e-36
ref|YP_001586435.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   157    1e-36 Gene info
ref|NP_454738.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    1e-36 Gene info
ref|YP_002381336.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamat...   157    1e-36 Gene info
ref|YP_001402346.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   157    1e-36 Gene info
ref|YP_002661060.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   157    1e-36 Gene info
ref|ZP_02902823.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   157    2e-36
ref|YP_131325.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    2e-36 Gene info
ref|YP_001742210.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   157    2e-36 Gene info
ref|ZP_00831635.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   157    2e-36
ref|YP_069227.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    2e-36 Gene info
gb|EEH95033.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synt...   156    2e-36
ref|ZP_03831117.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   156    2e-36
ref|YP_401842.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    2e-36 Gene info
ref|YP_001878898.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   156    2e-36 Gene info
ref|YP_001957919.1|  hypothetical protein Aasi_0816 [Candidatu...   156    2e-36 Gene info
ref|YP_309126.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    2e-36 Gene info
ref|NP_285784.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    2e-36 Gene info
ref|ZP_00825921.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   156    2e-36
ref|ZP_03029561.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   156    2e-36
ref|YP_406639.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    2e-36 Gene info
ref|NP_414630.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamate l...   156    2e-36 Gene info
ref|YP_001461258.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   156    2e-36 Gene info
ref|YP_687672.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    3e-36 Gene info
pdb|1E0D|A  Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamat...   156    3e-36 Related structures
ref|YP_001333782.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   156    3e-36 Gene info
ref|NP_752060.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    3e-36 Gene info
ref|YP_539138.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    3e-36 Gene info
ref|YP_001003659.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   156    3e-36 Gene info
ref|ZP_02033338.1|  hypothetical protein PARMER_03363 [Parabac...   155    3e-36
ref|YP_002602545.1|  MurD [Desulfobacterium autotrophicum HRM2...   155    3e-36 Gene info
ref|ZP_02814622.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   155    3e-36
ref|YP_002240440.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   155    3e-36 Gene info
ref|NP_835826.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   155    4e-36 Gene info
ref|ZP_01734230.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   155    4e-36
ref|ZP_00832999.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   155    4e-36
ref|YP_001571864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   155    5e-36 Gene info
ref|ZP_03025116.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   155    5e-36
ref|YP_383378.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   155    5e-36 Gene info
ref|ZP_00993152.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   155    5e-36
ref|ZP_03827644.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   155    6e-36
ref|YP_001476993.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   155    6e-36 Gene info
ref|YP_429701.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   155    6e-36 Gene info
ref|ZP_03391555.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   154    7e-36
ref|ZP_01116816.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   154    7e-36
ref|ZP_01313466.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   154    8e-36
ref|ZP_03474577.1|  hypothetical protein PRABACTJOHN_00231 [Pa...   154    8e-36
ref|YP_002327685.1|  UDP-N-acetylmuramoyl-L-alanine: D-glutama...   154    9e-36 Gene info
ref|YP_277657.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamate l...   154    9e-36 Gene info
ref|YP_772354.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   154    9e-36 Gene info
ref|NP_872842.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   154    1e-35 Gene info
ref|YP_051906.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   154    1e-35 Gene info
ref|ZP_01262434.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   154    1e-35
pdb|2UAG|A  Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamat...   154    1e-35 Related structures
ref|YP_001807199.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   154    1e-35 Gene info
pdb|2JFF|A  Chain A, Crystal Structure Of Murd Ligase In Compl...   154    1e-35 Related structures
ref|ZP_03905046.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   153    1e-35
ref|ZP_02891198.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   153    2e-35
ref|ZP_00822274.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   153    2e-35
ref|YP_002070041.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   153    2e-35 Gene info
ref|ZP_03206842.1|  hypothetical protein BACPLE_00454 [Bactero...   153    2e-35
ref|ZP_03011706.1|  hypothetical protein BACCOP_03622 [Bactero...   153    2e-35
ref|YP_066635.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   152    3e-35 Gene info
ref|YP_002536241.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   152    3e-35 Gene info
ref|YP_002263984.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    3e-35 Gene info
ref|NP_660564.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   152    3e-35 Gene info
gb|EEJ70624.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synt...   152    3e-35
ref|ZP_01957911.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   152    3e-35
ref|ZP_01677390.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   152    3e-35
ref|ZP_01236033.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   152    4e-35
ref|ZP_03307607.1|  hypothetical protein BACFIN_01953 [Bactero...   152    4e-35
ref|NP_232033.2|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   152    4e-35 Gene info
ref|YP_002811077.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    4e-35 Gene info
ref|ZP_01160671.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   152    5e-35
ref|ZP_01949224.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   152    5e-35
ref|ZP_02064885.1|  hypothetical protein BACOVA_01855 [Bactero...   151    5e-35
ref|ZP_03846339.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   151    6e-35
ref|YP_001763828.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   151    7e-35 Gene info
ref|YP_002156999.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   151    8e-35 Gene info
ref|ZP_01681401.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   151    8e-35
ref|YP_097591.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   151    9e-35 Gene info
ref|YP_002820743.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   151    9e-35 Gene info
ref|ZP_01066825.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   150    1e-34
ref|YP_581604.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   150    1e-34 Gene info
ref|YP_001303831.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   150    1e-34 Gene info
ref|ZP_01961865.1|  hypothetical protein BACCAC_03508 [Bactero...   150    1e-34
ref|ZP_01816133.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   150    1e-34
sp|Q8A256.2|MURD_BACTN  RecName: Full=UDP-N-acetylmuramoylalan...   150    1e-34
ref|NP_812362.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   150    1e-34 Gene info
ref|YP_002416105.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   150    1e-34 Gene info
ref|YP_193702.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   150    2e-34 Gene info
ref|YP_002151791.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   150    2e-34 Gene info
ref|YP_001577267.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   150    2e-34 Gene info
ref|ZP_03840814.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   149    2e-34
ref|ZP_03617357.1|  hypothetical protein PREVCOP_02853 [Prevot...   149    2e-34
ref|YP_001680625.1|  udp-n-acetylmuramoylalanine--d-glutamate ...   149    3e-34 Gene info
ref|YP_795579.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   149    3e-34 Gene info
ref|ZP_03807176.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   149    3e-34
ref|YP_205586.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   149    3e-34 Gene info
ref|ZP_01291365.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   149    3e-34
ref|YP_360890.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   149    3e-34 Gene info
sp|Q5E2P8.2|MURD_VIBF1  RecName: Full=UDP-N-acetylmuramoylalan...   149    3e-34
ref|ZP_01288416.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   149    3e-34
ref|ZP_02905428.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   149    4e-34
ref|YP_139239.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   149    4e-34 Gene info
ref|ZP_01290512.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   149    4e-34
ref|ZP_03803848.1|  hypothetical protein PROPEN_02224 [Proteus...   148    5e-34
ref|ZP_02072421.1|  hypothetical protein BACUNI_03868 [Bactero...   148    5e-34
ref|YP_002122973.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   148    5e-34 Gene info
ref|YP_002137314.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   148    5e-34 Gene info
ref|ZP_01122341.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   148    6e-34
ref|ZP_03460654.1|  hypothetical protein BACEGG_03472 [Bactero...   148    6e-34
ref|YP_002171856.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   148    6e-34 Gene info
ref|ZP_01101813.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   148    6e-34
gb|ABZ89695.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   148    7e-34
ref|ZP_01252997.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   148    7e-34
ref|YP_002562598.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   148    8e-34 Gene info
ref|ZP_03677151.1|  hypothetical protein BACCELL_01487 [Bacter...   148    8e-34
ref|YP_002316178.1|  UDP-N-acetylmuramoylalanyl-D-glutamate li...   147    1e-33 Gene info
ref|YP_375997.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   147    1e-33 Gene info
ref|YP_001298709.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   147    1e-33 Gene info
ref|ZP_03956482.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   147    1e-33
ref|YP_820220.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   147    1e-33 Gene info
ref|ZP_03300938.1|  hypothetical protein BACDOR_02309 [Bactero...   147    1e-33
ref|YP_001449974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   147    1e-33 Gene info
ref|ZP_03013322.1|  hypothetical protein BACINT_00879 [Bactero...   147    1e-33
ref|YP_002654979.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   147    1e-33 Gene info
ref|YP_002744914.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   147    2e-33 Gene info
ref|YP_002789265.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   146    2e-33 Gene info
ref|ZP_03557136.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   146    2e-33
ref|ZP_02436285.1|  hypothetical protein BACSTE_02542 [Bactero...   146    2e-33
ref|YP_146971.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   146    3e-33 Gene info
ref|YP_001125106.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   146    3e-33 Gene info
ref|YP_002745973.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   145    3e-33 Gene info
ref|YP_001034640.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   145    3e-33 Gene info
ref|ZP_01882133.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   145    4e-33
ref|ZP_03917010.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   145    4e-33
ref|ZP_03315112.1|  hypothetical protein PROVRUST_01912 [Provi...   145    5e-33
ref|ZP_02330008.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   145    5e-33
ref|ZP_00785114.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   145    5e-33
gb|ABZ89700.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   145    6e-33
ref|YP_001717577.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   145    6e-33 Gene info
ref|YP_357613.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   145    6e-33 Gene info
ref|NP_734986.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   144    7e-33 Gene info
ref|YP_162564.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   144    8e-33 Gene info
ref|ZP_03320883.1|  hypothetical protein PROVALCAL_03852 [Prov...   144    9e-33
ref|YP_454127.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   144    1e-32 Gene info
ref|ZP_01823644.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   144    1e-32
ref|NP_687505.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   144    1e-32 Gene info
ref|YP_864682.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   143    2e-32 Gene info
ref|YP_001999652.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   143    2e-32 Gene info
ref|ZP_03853834.1|  UDP-N-acetylmuramoylalanine--D-glutamateli...   143    2e-32
ref|ZP_01827326.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   143    2e-32
ref|ZP_02716383.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   143    2e-32
ref|ZP_03066695.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   143    2e-32
ref|ZP_02961396.1|  hypothetical protein PROSTU_03424 [Provide...   142    3e-32
ref|YP_592706.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   142    3e-32 Gene info
ref|ZP_01832062.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    3e-32
ref|ZP_01386845.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   142    3e-32
ref|ZP_03040773.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   142    3e-32
ref|ZP_01820460.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    3e-32
ref|YP_001797098.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   142    4e-32 Gene info
gb|ABZ08299.1|  putative Mur ligase family, catalytic domain p...   142    4e-32
ref|ZP_01835217.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    4e-32
ref|ZP_03494087.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   142    4e-32
ref|YP_002735722.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   142    4e-32 Gene info
ref|YP_002309150.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   142    4e-32 Gene info
ref|YP_002737890.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   142    4e-32 Gene info
ref|NP_358197.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   142    4e-32 Gene info
ref|NP_345193.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   142    5e-32 Gene info
ref|ZP_01829543.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    5e-32
ref|ZP_02716986.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   142    5e-32
ref|YP_002510654.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   142    5e-32 Gene info
ref|YP_002754193.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutama...   142    5e-32 Gene info
ref|ZP_01818493.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    6e-32
ref|YP_618804.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   141    7e-32 Gene info
ref|YP_001694158.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   141    7e-32 Gene info
ref|YP_001232693.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   141    7e-32 Gene info
ref|ZP_01824885.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   141    8e-32
ref|YP_812737.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   141    8e-32 Gene info
ref|ZP_01107256.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   141    8e-32
ref|YP_002218848.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   141    9e-32 Gene info
ref|ZP_02707866.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   141    1e-31
ref|NP_623245.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   140    1e-31 Gene info
ref|ZP_03950730.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   140    1e-31
ref|YP_862791.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   140    1e-31 Gene info
ref|YP_001950918.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   140    1e-31 Gene info
ref|YP_679333.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   140    1e-31 Gene info
ref|YP_002037343.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    2e-31 Gene info
ref|YP_002730413.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    2e-31 Gene info
ref|YP_002572664.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   140    2e-31 Gene info
ref|ZP_02919805.1|  hypothetical protein STRINF_00657 [Strepto...   140    2e-31
ref|YP_847574.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   139    2e-31 Gene info
ref|YP_815012.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   139    3e-31 Gene info
ref|YP_001179728.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   139    3e-31 Gene info
ref|YP_001740872.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   139    3e-31 Gene info
ref|YP_001967810.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   139    3e-31 Gene info
ref|YP_002494298.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   139    3e-31 Gene info
ref|YP_001651067.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   139    3e-31 Gene info
ref|ZP_02711316.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   139    4e-31
ref|ZP_00950256.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   139    4e-31
ref|ZP_00134085.2|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   139    4e-31
ref|ZP_03611755.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   139    4e-31
ref|YP_002136165.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   139    4e-31 Gene info
ref|NP_954113.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   138    5e-31 Gene info
ref|YP_002742186.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   138    5e-31 Gene info
ref|YP_001212413.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   138    5e-31 Gene info
ref|YP_001197842.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   138    7e-31 Gene info
ref|YP_001200027.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   138    7e-31 Gene info
ref|YP_002432291.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   138    8e-31 Gene info
ref|YP_395361.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   137    1e-30 Gene info
ref|NP_964826.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   137    1e-30 Gene info
ref|YP_466972.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   137    1e-30 Gene info
gb|EEJ59705.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synt...   137    1e-30
ref|YP_002247022.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   137    1e-30 Gene info
ref|YP_001612300.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   137    1e-30 Gene info
ref|YP_001209872.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   137    1e-30 Gene info
ref|ZP_02160103.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   137    1e-30
ref|ZP_03702049.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   136    2e-30
ref|YP_001296923.1|  UDP-N-acetylmuramoylalanine--D-glutamatel...   136    3e-30 Gene info
gb|EEJ74554.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synt...   135    3e-30
ref|YP_444701.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   135    3e-30 Gene info
ref|NP_660942.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   135    4e-30 Gene info
ref|ZP_01051198.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   135    4e-30
ref|YP_535942.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   135    4e-30 Gene info
ref|ZP_03929935.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   135    4e-30
ref|YP_001928741.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    5e-30 Gene info
ref|NP_904866.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   135    5e-30 Gene info
ref|YP_002654158.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    5e-30 Gene info
ref|YP_001664804.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    6e-30 Gene info
ref|YP_001663619.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    6e-30 Gene info
ref|YP_001019657.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    6e-30 Gene info
ref|YP_588950.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   135    6e-30 Gene info
ref|ZP_03637574.1|  hypothetical protein PROVRETT_00638 [Provi...   135    7e-30
ref|YP_002663907.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    7e-30 Gene info
ref|YP_001944501.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   134    7e-30 Gene info
ref|ZP_01059184.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   134    8e-30
ref|NP_692390.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   134    9e-30 Gene info
ref|YP_001789560.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   134    9e-30 Gene info
ref|YP_806496.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   134    1e-29 Gene info
ref|ZP_03965290.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   134    1e-29
ref|ZP_02912788.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   134    1e-29
ref|ZP_03152616.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   133    2e-29
ref|YP_898191.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   133    2e-29 Gene info
ref|YP_001987440.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   133    2e-29 Gene info
ref|YP_002168256.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   133    2e-29 Gene info
ref|YP_001037466.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   133    2e-29 Gene info
ref|ZP_01890991.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   133    3e-29
ref|YP_175853.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   132    3e-29 Gene info
ref|YP_001677012.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   132    3e-29 Gene info
ref|YP_002249134.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   132    4e-29 Gene info
ref|ZP_01470909.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   132    4e-29
ref|ZP_01304736.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   132    5e-29
ref|ZP_01203271.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   132    5e-29
ref|ZP_03625882.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   132    6e-29
ref|YP_001646536.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   131    6e-29 Gene info
gb|ABV90250.2|  sporulation protein A [Bacillus subtilis subsp...   131    6e-29
ref|ZP_00366481.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   131    6e-29
ref|YP_280657.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    7e-29 Gene info
dbj|BAB16028.1|  MurD [Streptococcus pyogenes]                      131    7e-29
ref|NP_269598.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    7e-29 Gene info
ref|YP_074860.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    7e-29 Gene info
ref|NP_389403.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    8e-29 Gene info
ref|YP_596979.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    8e-29 Gene info
ref|ZP_03914000.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   131    8e-29
ref|NP_664980.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    8e-29 Gene info
ref|YP_001691923.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   131    9e-29 Gene info
ref|YP_001128170.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   131    9e-29 Gene info
ref|YP_818961.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   131    9e-29 Gene info
ref|NP_607610.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    9e-29 Gene info
ref|YP_001877274.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   131    9e-29 Gene info
ref|YP_001392870.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   131    9e-29 Gene info
ref|ZP_03956759.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   130    1e-28
ref|ZP_03294980.1|  hypothetical protein COLINT_00666 [Collins...   130    1e-28
ref|YP_913131.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   130    1e-28 Gene info
ref|YP_496410.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   130    1e-28 Gene info
ref|ZP_02992329.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   130    1e-28
ref|YP_001225707.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   130    1e-28 Gene info
ref|ZP_02618260.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   130    1e-28
ref|YP_602855.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   130    1e-28 Gene info
ref|NP_896625.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   130    2e-28 Gene info
ref|YP_001264432.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   130    2e-28 Gene info
ref|ZP_03246280.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   130    2e-28
ref|ZP_03854533.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   130    2e-28
ref|YP_002166484.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   130    2e-28 Gene info
ref|YP_001255998.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   130    2e-28 Gene info
ref|YP_697147.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   130    2e-28 Gene info
ref|YP_001112037.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   130    2e-28 Gene info
ref|YP_514253.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   130    2e-28 Gene info
ref|YP_001122441.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   129    2e-28 Gene info
ref|ZP_02636844.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    2e-28
ref|YP_001375791.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   129    3e-28 Gene info
gb|EEJ68076.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamate li...   129    3e-28
ref|ZP_00786534.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    3e-28
ref|YP_002806064.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutama...   129    3e-28
ref|ZP_02615649.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    3e-28
ref|ZP_01910913.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    4e-28
ref|ZP_02036409.1|  hypothetical protein BACCAP_02011 [Bactero...   129    4e-28
ref|YP_001892061.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   129    4e-28 Gene info
emb|CAA45555.1|  UDP-N-acetylmuramoylalanine--D-glutamate liga...   129    4e-28
ref|ZP_02861816.1|  hypothetical protein ANASTE_01026 [Anaerof...   129    5e-28
ref|YP_877138.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   129    5e-28 Gene info
ref|YP_001381045.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   129    5e-28 Gene info
ref|ZP_03944874.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   129    5e-28
ref|ZP_03939428.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   128    5e-28
ref|NP_969962.1|  hypothetical protein Bd3200 [Bdellovibrio ba...   128    6e-28 Gene info
ref|YP_001843389.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   128    6e-28 Gene info
ref|YP_001107962.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   128    6e-28 Gene info
ref|NP_349791.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   128    6e-28 Gene info
ref|ZP_03942272.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   128    6e-28
ref|ZP_01122928.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   128    6e-28
ref|ZP_02176898.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   128    6e-28
ref|YP_001559575.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   128    7e-28 Gene info
ref|ZP_02643844.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   128    8e-28
ref|ZP_01751124.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   127    9e-28
ref|YP_457246.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   127    9e-28 Gene info
ref|YP_699716.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   127    9e-28 Gene info
ref|ZP_02864191.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   127    1e-27
ref|YP_002447477.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    1e-27 Gene info
ref|YP_001788857.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    1e-27 Gene info
ref|YP_460726.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   127    1e-27 Gene info
ref|YP_001783157.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    1e-27 Gene info
ref|ZP_03734184.1|  hypothetical protein CLOM621_04227 [Clostr...   127    1e-27
ref|ZP_03682095.1|  hypothetical protein CATMIT_00726 [Catenib...   127    2e-27
ref|ZP_02928791.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   127    2e-27
ref|ZP_02993974.1|  hypothetical protein CLOSPO_01076 [Clostri...   127    2e-27
ref|NP_563375.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   127    2e-27 Gene info
ref|YP_001393592.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   127    2e-27 Gene info
ref|ZP_02632859.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   127    2e-27
ref|YP_001194159.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   126    2e-27 Gene info
ref|YP_828509.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   126    2e-27 Gene info
ref|ZP_02621695.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   126    2e-27
ref|YP_169489.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   126    2e-27 Gene info
ref|ZP_01864518.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   126    3e-27
ref|YP_001685294.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   126    3e-27 Gene info
ref|NP_833632.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   126    3e-27 Gene info
ref|ZP_03954094.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   126    3e-27
gb|EEJ50235.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamate li...   125    4e-27
ref|ZP_03232111.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    4e-27
ref|NP_243433.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   125    4e-27 Gene info
ref|ZP_02216910.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    4e-27
ref|ZP_03654425.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    4e-27
ref|YP_002589729.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    4e-27 Gene info
ref|ZP_03485911.1|  hypothetical protein ROSINTL182_03317 [Ros...   125    4e-27
ref|YP_001956126.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   125    5e-27 Gene info
ref|YP_001930613.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   125    6e-27 Gene info
ref|YP_001228103.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   125    6e-27 Gene info
ref|ZP_02851147.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    6e-27
ref|NP_846291.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   125    6e-27 Gene info
ref|ZP_00236823.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    7e-27
ref|YP_001154950.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   124    9e-27 Gene info
ref|NP_214421.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   124    1e-26 Gene info
ref|YP_078913.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   124    1e-26 Gene info
ref|YP_002531415.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   124    1e-26 Gene info
ref|ZP_03211562.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   124    1e-26
ref|YP_002019656.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   124    1e-26 Gene info
ref|ZP_03717305.1|  hypothetical protein EUBHAL_02383 [Eubacte...   123    2e-26
ref|YP_001166901.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   123    2e-26 Gene info
ref|YP_037974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   123    2e-26 Gene info
ref|ZP_02417444.1|  hypothetical protein ANACAC_00008 [Anaeros...   123    2e-26
ref|YP_001919625.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   123    2e-26 Gene info
ref|NP_980253.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   123    2e-26 Gene info
ref|ZP_01551757.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   123    3e-26
ref|ZP_03237644.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    3e-26
ref|YP_001551297.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   122    3e-26 Gene info
ref|YP_001492386.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   122    3e-26 Gene info
ref|ZP_03293102.1|  hypothetical protein CLOHIR_01050 [Clostri...   122    3e-26
ref|YP_173132.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    3e-26 Gene info
ref|ZP_02210397.1|  hypothetical protein CLOBAR_02805 [Clostri...   122    4e-26
ref|ZP_01667716.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    4e-26
ref|YP_002599054.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   122    4e-26 Gene info
ref|ZP_01696998.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    4e-26
ref|ZP_03113156.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    4e-26
ref|YP_190605.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   122    4e-26 Gene info
ref|ZP_03129771.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   122    4e-26
ref|NP_441033.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    4e-26 Gene info
ref|YP_032500.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    5e-26 Gene info
ref|YP_002049324.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   122    5e-26 Gene info
ref|YP_519142.1|  hypothetical protein DSY2909 [Desulfitobacte...   122    5e-26 Gene info
ref|ZP_03331268.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   122    5e-26
ref|YP_001089164.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   122    5e-26 Gene info
sp|Q5FUJ7.2|MURD_GLUOX  RecName: Full=UDP-N-acetylmuramoylalan...   122    6e-26
ref|YP_002349497.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   121    6e-26 Gene info
ref|YP_002729356.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   121    7e-26 Gene info
ref|ZP_03867135.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   121    7e-26
ref|ZP_01802122.1|  hypothetical protein CdifQ_04003093 [Clost...   121    8e-26
ref|NP_893481.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   121    8e-26 Gene info
ref|YP_014661.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   121    9e-26 Gene info
ref|ZP_03880297.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   121    9e-26
ref|YP_616928.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   121    9e-26 Gene info
ref|NP_421359.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    1e-25 Gene info
ref|YP_002353141.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   120    1e-25 Gene info
ref|YP_002131164.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   120    1e-25 Gene info
ref|YP_001917473.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   120    1e-25 Gene info
ref|YP_292123.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    1e-25 Gene info
ref|YP_220221.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    1e-25 Gene info
ref|YP_378375.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   120    1e-25 Gene info
ref|ZP_03666863.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   120    1e-25
ref|YP_001995746.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   120    2e-25 Gene info
ref|YP_001884427.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   120    2e-25 Gene info
ref|NP_465560.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    2e-25 Gene info
ref|YP_731457.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    2e-25 Gene info
ref|XP_001772045.1|  predicted protein [Physcomitrella patens ...   120    2e-25 UniGene infoGene info
ref|YP_804683.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   119    2e-25 Gene info
ref|YP_001814431.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   119    2e-25 Gene info
ref|ZP_02084266.1|  hypothetical protein CLOBOL_01791 [Clostri...   119    2e-25
ref|YP_001826931.1|  putative UDP-N-acetylmuramoylalanine-D- g...   119    3e-25 Gene info
ref|YP_001470267.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   119    3e-25 Gene info
ref|ZP_01460029.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   119    3e-25
ref|ZP_01084053.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   119    3e-25
ref|YP_067355.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    3e-25 Gene info
ref|NP_220791.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    3e-25 Gene info
ref|ZP_01875641.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   119    3e-25
ref|YP_753515.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   119    3e-25 Gene info
ref|YP_850247.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    4e-25 Gene info
ref|ZP_02951239.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   119    4e-25
ref|ZP_03634411.1|  hypothetical protein HOLDEFILI_01705 [Hold...   119    4e-25
ref|XP_002118918.1|  hypothetical protein TRIADDRAFT_62903 [Tr...   119    5e-25 Gene info
ref|YP_001015606.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   119    5e-25 Gene info
ref|ZP_03335273.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   118    5e-25
ref|YP_001011843.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   118    5e-25 Gene info
ref|YP_001975309.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   118    6e-25 Gene info
ref|ZP_02080566.1|  hypothetical protein CLOLEP_02021 [Clostri...   118    6e-25
ref|NP_626345.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   118    6e-25 Gene info
ref|YP_001495908.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   118    6e-25 Gene info
ref|ZP_02093537.1|  hypothetical protein PEPMIC_00288 [Peptost...   118    6e-25
ref|YP_002720366.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   118    7e-25 Gene info
ref|YP_002460510.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   118    7e-25 Gene info
ref|ZP_02424993.1|  hypothetical protein ALIPUT_01128 [Alistip...   118    8e-25
ref|YP_001320690.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   118    9e-25 Gene info
ref|YP_001131265.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   117    9e-25 Gene info
ref|YP_538051.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   117    1e-24 Gene info
ref|ZP_02234020.1|  hypothetical protein DORFOR_00877 [Dorea f...   117    1e-24
ref|YP_002773320.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   117    1e-24 Gene info
ref|ZP_03053400.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   117    1e-24
ref|NP_471476.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   117    1e-24 Gene info
ref|ZP_01003751.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   117    1e-24
ref|YP_008250.1|  putative UDP-N-acetylmuramoylalanine-D-gluta...   117    2e-24 Gene info
ref|ZP_03310483.1|  hypothetical protein DESPIG_00368 [Desulfo...   117    2e-24
ref|YP_397957.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   117    2e-24 Gene info
ref|ZP_02691978.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   116    2e-24
ref|YP_001042662.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   116    2e-24 Gene info
ref|ZP_00744396.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   116    2e-24
ref|YP_002481552.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   116    2e-24 Gene info
ref|YP_924254.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   116    2e-24 Gene info
ref|ZP_02181935.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   116    3e-24
ref|ZP_03980506.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   116    3e-24
ref|YP_246650.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   116    3e-24 Gene info
ref|YP_001421100.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   116    3e-24 Gene info
emb|CAJ74243.1|  similar to UDP-N-acetylmuramoylalanine D-glut...   116    3e-24
ref|YP_002334300.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   115    3e-24 Gene info
ref|ZP_03857775.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    3e-24
ref|ZP_03783127.1|  hypothetical protein RUMHYD_02594 [Blautia...   115    4e-24
ref|ZP_02963788.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    4e-24
ref|YP_001768612.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   115    4e-24 Gene info
ref|ZP_03488805.1|  hypothetical protein EUBIFOR_01387 [Eubact...   115    4e-24
ref|ZP_02076068.1|  hypothetical protein CLOL250_02856 [Clostr...   115    4e-24
ref|YP_001016538.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   115    4e-24 Gene info
ref|YP_002672429.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   115    5e-24 Gene info
ref|ZP_01719577.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   115    5e-24
ref|ZP_03903059.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    5e-24
ref|YP_055470.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   115    6e-24 Gene info
ref|ZP_01903054.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    6e-24
ref|ZP_03074365.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   115    6e-24
ref|YP_352159.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   115    6e-24 Gene info
ref|ZP_03387891.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    6e-24
ref|ZP_02077808.1|  hypothetical protein EUBDOL_01607 [Eubacte...   115    7e-24
ref|ZP_03959059.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    7e-24
ref|YP_382447.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   115    7e-24 Gene info
ref|ZP_02171866.1|  S-layer domain protein [Bacillus selenitir...   114    7e-24
ref|ZP_03974925.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   114    7e-24
ref|YP_002524774.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   114    8e-24 Gene info
ref|YP_001271193.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   114    8e-24 Gene info
ref|YP_810708.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   114    9e-24 Gene info
ref|ZP_01974910.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   114    9e-24
ref|YP_723942.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   114    1e-23 Gene info
emb|CAO23528.1|  unnamed protein product [Vitis vinifera]           114    1e-23
ref|ZP_00394198.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   114    1e-23
ref|YP_002288238.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   114    1e-23 Gene info
ref|NP_827296.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   114    1e-23 Gene info
ref|ZP_01172482.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   114    2e-23
ref|ZP_02027535.1|  hypothetical protein EUBVEN_02810 [Eubacte...   114    2e-23
ref|YP_002691696.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   113    2e-23 Gene info
ref|ZP_02430895.1|  hypothetical protein CLOSCI_01110 [Clostri...   113    2e-23
ref|YP_001876397.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   113    2e-23 Gene info
ref|ZP_02440777.1|  hypothetical protein ANACOL_00041 [Anaerot...   113    2e-23
ref|NP_895261.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   113    2e-23 Gene info
ref|ZP_02083083.1|  hypothetical protein CLOBOL_00598 [Clostri...   112    3e-23
ref|NP_785693.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    3e-23 Gene info
gb|EEJ66786.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synt...   112    3e-23
ref|ZP_03927811.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   112    3e-23
ref|ZP_00602978.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   112    3e-23
ref|NP_764413.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    3e-23 Gene info
ref|YP_188331.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    4e-23 Gene info
ref|ZP_01155385.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   112    4e-23
ref|YP_640421.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    5e-23 Gene info
ref|ZP_01442457.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   112    5e-23
gb|EDZ38616.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   112    5e-23
ref|ZP_03709117.1|  hypothetical protein CLOSTMETH_03879 [Clos...   112    6e-23
sp|Q899G5.2|MURD_CLOTE  RecName: Full=UDP-N-acetylmuramoylalan...   112    6e-23
ref|ZP_01014228.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   112    6e-23
ref|ZP_01967278.1|  hypothetical protein RUMTOR_00824 [Ruminoc...   112    6e-23
ref|YP_947468.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   111    7e-23 Gene info
ref|NP_780924.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   111    7e-23 Gene info
ref|YP_001009956.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   111    7e-23 Gene info
ref|YP_001960899.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   111    7e-23 Gene info
ref|YP_515066.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   111    8e-23 Gene info
ref|YP_001486656.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   111    8e-23 Gene info
ref|ZP_01452907.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   111    9e-23
ref|YP_001727805.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   111    9e-23 Gene info
ref|ZP_03946426.1|  possible UDP-N-acetylmuramoyl-L-alanine--D...   111    9e-23
ref|YP_002182129.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   111    9e-23 Gene info
gb|EEH99494.1|  UDP-N-acetylmuramoylalanine-D-glutamate ligase...   111    1e-22
ref|YP_040570.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    1e-22 Gene info
ref|NP_371707.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    1e-22 Gene info
ref|YP_781029.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    1e-22 Gene info
ref|YP_001071538.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   110    1e-22 Gene info
ref|ZP_03799202.1|  hypothetical protein COPCOM_01459 [Coproco...   110    1e-22
ref|ZP_03989799.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   110    1e-22
ref|NP_645883.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    1e-22 Gene info
ref|YP_043244.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    1e-22 Gene info
ref|ZP_03866059.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   110    2e-22
ref|NP_267746.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    2e-22 Gene info
ref|ZP_01450557.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   110    2e-22
ref|YP_001855337.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|ZP_02184967.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   110    2e-22
ref|NP_829730.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    2e-22 Gene info
sp|O07669.1|MURD_ENTHR  RecName: Full=UDP-N-acetylmuramoylalan...   110    2e-22
ref|YP_011718.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   110    2e-22 Gene info
ref|YP_001512917.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|YP_002250973.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|YP_376536.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    2e-22 Gene info
ref|YP_001533786.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|YP_002495838.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   110    2e-22
ref|ZP_02208070.1|  hypothetical protein COPEUT_02897 [Coproco...   109    3e-22
ref|YP_001484793.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   109    3e-22 Gene info
ref|YP_001244286.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   109    3e-22 Gene info
ref|ZP_02427862.1|  hypothetical protein CLORAM_01250 [Clostri...   109    3e-22
ref|YP_002633891.1|  putative UDP-N-acetylmuramoylalanine--D-g...   109    3e-22 Gene info
ref|ZP_03759655.1|  hypothetical protein CLOSTASPAR_03681 [Clo...   109    3e-22
ref|YP_001655971.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   109    3e-22 Gene info
ref|ZP_02092533.1|  hypothetical protein FAEPRAM212_02826 [Fae...   109    4e-22
ref|YP_033898.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   108    4e-22 Gene info
ref|YP_001091775.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   108    4e-22 Gene info
ref|YP_001307253.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   108    4e-22 Gene info
ref|ZP_03885903.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   108    5e-22
ref|ZP_03729493.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   108    5e-22
ref|YP_002191664.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   108    5e-22 Gene info
ref|ZP_03896568.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   108    5e-22
gb|EAY57399.1|  UDP-N-acetylmuramoylalanine-D-glutamate ligase...   108    6e-22
ref|ZP_03766237.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   108    6e-22
ref|ZP_01621387.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   108    6e-22
ref|YP_485611.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   108    8e-22 Gene info
ref|YP_001628093.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   108    8e-22 Gene info
ref|ZP_01721964.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   108    9e-22
ref|YP_001305493.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   108    9e-22 Gene info
emb|CAO86897.1|  murD [Microcystis aeruginosa PCC 7806]             107    9e-22
ref|YP_510705.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   107    9e-22 Gene info
ref|ZP_02945021.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   107    1e-21
ref|YP_001207548.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   107    1e-21 Gene info
ref|ZP_03655365.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   107    1e-21
ref|YP_002322334.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   107    1e-21 Gene info
ref|ZP_02868078.1|  hypothetical protein CLOSPI_01919 [Clostri...   107    1e-21
ref|ZP_02437899.1|  hypothetical protein CLOSS21_00337 [Clostr...   107    1e-21
ref|YP_001515864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   107    1e-21 Gene info
ref|YP_761703.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    1e-21 Gene info
ref|YP_001954123.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   107    1e-21 Gene info
ref|ZP_00120691.2|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   107    1e-21
ref|ZP_01038279.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   107    1e-21
ref|ZP_03648718.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   107    2e-21
ref|ZP_03785920.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   107    2e-21
ref|YP_222119.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    2e-21 Gene info
ref|NP_875830.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    2e-21 Gene info
ref|NP_220277.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    2e-21 Gene info
ref|YP_644269.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   107    2e-21 Gene info
ref|NP_698431.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    2e-21 Gene info
ref|YP_002380383.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   107    2e-21 Gene info
ref|ZP_03273840.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   107    2e-21
ref|ZP_01879210.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   107    2e-21
ref|YP_002016913.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   107    2e-21 Gene info
ref|ZP_01038830.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   106    2e-21
ref|NP_926678.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   106    3e-21 Gene info
ref|ZP_02422163.1|  hypothetical protein EUBSIR_01004 [Eubacte...   106    3e-21
ref|YP_595477.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   106    3e-21 Gene info
ref|YP_002165851.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   106    3e-21 Gene info
ref|NP_696485.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   106    3e-21 Gene info
ref|YP_387536.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   105    3e-21 Gene info
ref|ZP_03895807.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   105    4e-21
ref|NP_539494.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   105    4e-21 Gene info
ref|ZP_01771359.1|  Hypothetical protein COLAER_00338 [Collins...   105    4e-21
ref|NP_680864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   105    4e-21 Gene info
ref|YP_002203182.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   105    4e-21 Gene info
ref|YP_757310.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   105    4e-21 Gene info
ref|YP_744252.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   105    5e-21 Gene info
ref|ZP_03775323.1|  hypothetical protein SUBVAR_01862 [Subdoli...   105    5e-21
ref|XP_001786928.1|  predicted protein [Physcomitrella patens ...   105    5e-21 Gene info
ref|YP_002506057.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   105    5e-21 Gene info
ref|YP_253647.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   105    5e-21 Gene info
ref|YP_002533994.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   105    6e-21 Gene info
ref|ZP_01742459.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   105    6e-21
ref|ZP_03467060.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   105    6e-21
ref|ZP_03736691.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   105    7e-21
ref|YP_001755037.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   105    7e-21 Gene info
gb|AAT38528.1|  MurD [Bartonella bacilliformis]                     105    7e-21
ref|ZP_03629328.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   105    7e-21
ref|YP_712422.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   105    7e-21 Gene info
ref|ZP_01468536.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   105    7e-21
ref|YP_001738750.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   105    8e-21 Gene info
ref|YP_001654218.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   104    8e-21 Gene info
ref|YP_002479694.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   104    8e-21 Gene info
ref|ZP_01045956.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   104    8e-21
ref|YP_001653230.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   104    9e-21 Gene info
ref|YP_809615.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   104    9e-21 Gene info
ref|ZP_03752838.1|  hypothetical protein ROSEINA2194_01242 [Ro...   104    1e-20
ref|NP_228048.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   104    1e-20 Gene info
ref|ZP_03548081.1|  hypothetical protein BLAHAN_01865 [Blautia...   104    1e-20
ref|YP_001032238.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   103    1e-20 Gene info
ref|YP_570521.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    1e-20 Gene info
ref|ZP_03947965.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   103    2e-20
ref|ZP_02180325.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   103    2e-20
ref|YP_476553.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    2e-20 Gene info
ref|ZP_00962714.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   103    2e-20
ref|NP_296518.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    2e-20 Gene info
ref|YP_001609927.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   103    2e-20 Gene info
ref|YP_798619.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   103    2e-20 Gene info
sp|Q9PLG5.2|MURD_CHLMU  RecName: Full=UDP-N-acetylmuramoylalan...   103    2e-20
ref|NP_300958.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    2e-20 Gene info
ref|ZP_03912305.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   103    2e-20
ref|ZP_03142040.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   103    2e-20
ref|ZP_02139581.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   103    2e-20
ref|YP_001494677.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   103    2e-20 Gene info
ref|YP_317663.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    2e-20 Gene info
ref|NP_225096.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    2e-20 Gene info
ref|ZP_00955215.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   103    2e-20
ref|ZP_03777685.1|  hypothetical protein CLOHYLEM_04738 [Clost...   103    2e-20
ref|YP_166434.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   103    2e-20 Gene info
ref|YP_002563314.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   103    3e-20 Gene info
ref|ZP_01862239.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   103    3e-20
ref|YP_153605.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   103    3e-20 Gene info
ref|NP_814729.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   102    3e-20 Gene info
ref|YP_002619029.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   102    3e-20 Gene info
ref|YP_001499315.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   102    3e-20 Gene info
ref|ZP_03483477.1|  hypothetical protein ROSINTL182_00867 [Ros...   102    4e-20
ref|ZP_02042460.1|  hypothetical protein RUMGNA_03262 [Ruminoc...   102    4e-20
ref|ZP_03924962.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   102    4e-20
ref|ZP_01131167.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   102    4e-20
ref|ZP_03167639.1|  hypothetical protein RUMLAC_01313 [Ruminoc...   102    4e-20
ref|YP_989230.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   102    4e-20 Gene info
ref|YP_002697935.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   102    4e-20 Gene info
ref|YP_001625636.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   102    4e-20 Gene info
ref|YP_321312.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   102    4e-20 Gene info
ref|YP_002705.1|  udp-n-acetylmuramoylalanine--d-glutamate lig...   102    5e-20 Gene info
ref|ZP_00517092.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   102    5e-20
ref|ZP_03323684.1|  hypothetical protein BIFCAT_00454 [Bifidob...   102    6e-20
ref|ZP_01995945.1|  hypothetical protein DORLON_01943 [Dorea l...   102    6e-20
sp|Q8RDQ1.2|MURD_FUSNN  RecName: Full=UDP-N-acetylmuramoylalan...   102    6e-20
ref|NP_604352.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   102    6e-20 Gene info
ref|NP_488152.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   102    6e-20 Gene info
ref|ZP_03727899.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   101    7e-20
ref|NP_601362.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   101    7e-20 Gene info
ref|NP_711019.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   101    7e-20 Gene info
ref|ZP_00142002.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   101    7e-20
ref|YP_002703109.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   101    7e-20 Gene info
ref|NP_360197.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   101    7e-20 Gene info
gb|AAC45626.1|  D-glutamic acid adding enzyme [Staphylococcus ...   101    7e-20
ref|YP_888506.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   101    8e-20 Gene info
ref|YP_001242006.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   101    9e-20 Gene info
ref|YP_683543.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   101    1e-19 Gene info
ref|XP_002277291.1|  PREDICTED: hypothetical protein [Vitis vi...   101    1e-19 Gene info
ref|YP_001138943.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   101    1e-19 Gene info
ref|ZP_03686732.1|  hypothetical protein BRYFOR_02369 [Bryante...   100    1e-19
ref|NP_738665.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   100    1e-19 Gene info
ref|ZP_03909166.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   100    1e-19
ref|ZP_03613774.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   100    1e-19
ref|ZP_01694587.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   100    2e-19
ref|YP_576562.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   100    2e-19 Gene info
ref|ZP_01628939.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   100    2e-19
ref|ZP_03287954.1|  hypothetical protein CLONEX_00133 [Clostri...   100    2e-19
ref|YP_909966.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   100    2e-19 Gene info
ref|ZP_00372747.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   100    2e-19
ref|ZP_00054273.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   100    2e-19
ref|YP_612674.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   100    2e-19 Gene info
ref|YP_474425.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   100    2e-19 Gene info
ref|ZP_01315140.1|  hypothetical protein Wendoof_01000003 [Wol...   100    2e-19
ref|ZP_03156337.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   100    2e-19
ref|YP_289169.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  99.8    3e-19 Gene info
ref|ZP_00994834.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  99.8    3e-19
ref|NP_966599.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  99.8    3e-19 Gene info
ref|ZP_00373796.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...  99.8    3e-19
ref|NP_773244.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  99.8    3e-19 Gene info
ref|YP_001801657.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...  99.8    3e-19 Gene info
ref|ZP_01756971.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  99.8    3e-19
ref|ZP_00999924.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  99.4    4e-19
ref|YP_002508658.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  99.4    4e-19 Gene info
ref|YP_001248917.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  99.4    4e-19 Gene info
ref|YP_633745.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  99.4    4e-19 Gene info
ref|YP_301678.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  99.0    4e-19 Gene info
ref|YP_001411220.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  99.0    5e-19 Gene info
ref|YP_002674566.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  99.0    5e-19 Gene info
ref|ZP_01962464.1|  hypothetical protein RUMOBE_00177 [Ruminoc...  99.0    5e-19
ref|ZP_01079491.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  99.0    5e-19
ref|YP_002296863.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  99.0    5e-19 Gene info
ref|ZP_03742444.1|  hypothetical protein BIFPSEUDO_03016 [Bifi...  98.6    6e-19
ref|ZP_03474082.1|  hypothetical protein MITSMUL_02475 [Mitsuo...  98.6    6e-19
ref|ZP_02029743.1|  hypothetical protein BIFADO_02203 [Bifidob...  98.6    6e-19
ref|ZP_03619589.1|  hypothetical protein BIFBRE_01790 [Bifidob...  98.6    7e-19
ref|YP_002687929.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  98.6    7e-19 Gene info
ref|YP_674567.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  98.2    7e-19 Gene info
ref|ZP_03287106.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  98.2    8e-19
ref|ZP_02148967.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  98.2    8e-19
ref|YP_001819514.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  98.2    9e-19 Gene info
ref|YP_001838588.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  98.2    9e-19 Gene info
ref|ZP_02146127.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  98.2    9e-19
ref|YP_002550095.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  98.2    9e-19 Gene info
gb|AAN87412.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...  97.8    9e-19
ref|XP_001619308.1|  hypothetical protein NEMVEDRAFT_v1g224310...  97.8    1e-18 Gene info
ref|ZP_03567858.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  97.8    1e-18
ref|YP_002363734.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...  97.4    1e-18 Gene info
ref|YP_002683332.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  97.4    1e-18 Gene info
ref|ZP_03821439.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  97.4    1e-18
ref|YP_002122177.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...  97.4    1e-18 Gene info
ref|YP_001642074.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  97.1    2e-18 Gene info
ref|ZP_00630126.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...  97.1    2e-18 Gene info
ref|ZP_01732018.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  97.1    2e-18
ref|YP_002423790.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...  97.1    2e-18 Gene info
ref|YP_002714049.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  96.7    2e-18 Gene info
ref|YP_001940897.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...  96.7    2e-18 Gene info
ref|YP_001362929.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  96.7    2e-18 Gene info
gb|AAC45635.1|  D-glutamic acid adding enzyme [Enterococcus fa...  96.7    2e-18
ref|ZP_00958186.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  96.7    2e-18
ref|YP_002633090.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  96.7    2e-18 Gene info
ref|YP_001937365.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...  96.3    3e-18 Gene info
ref|YP_002560158.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...  95.9    4e-18 Gene info
ref|ZP_03146436.1|  cytoplasmic peptidoglycan synthetase domai...  95.9    4e-18
ref|NP_789472.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  95.9    4e-18 Gene info
ref|ZP_01056262.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  95.9    5e-18
ref|YP_001413685.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  95.5    5e-18 Gene info
ref|ZP_03937712.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...  95.5    6e-18
ref|YP_426040.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  94.7    8e-18 Gene info
ref|YP_001370287.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  94.7    8e-18 Gene info
ref|ZP_02002009.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...  94.7    9e-18
gb|EEJ54326.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamate li...  94.4    1e-17
ref|ZP_03921465.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...  94.4    1e-17
ref|YP_001927803.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  94.0    1e-17 Gene info
ref|YP_117974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  94.0    2e-17 Gene info
sp|Q5YYY1.2|MURD_NOCFA  RecName: Full=UDP-N-acetylmuramoylalan...  94.0    2e-17
ref|ZP_01745063.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  93.6    2e-17
gb|AAD53938.1|AF179611_22  UDP-N-acetylmuramoyl-L-alanyl-D-glu...  93.6    2e-17
ref|YP_872767.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  93.6    2e-17 Gene info
ref|ZP_02153486.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  93.6    2e-17
ref|YP_002760938.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  93.2    3e-17 Gene info
ref|YP_001233209.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  92.8    4e-17 Gene info
ref|ZP_03933327.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...  92.8    4e-17
ref|YP_001734110.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  92.4    4e-17 Gene info
ref|YP_701075.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  92.0    5e-17 Gene info
ref|YP_002521317.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  92.0    5e-17 Gene info
ref|ZP_02918322.1|  hypothetical protein BIFDEN_01627 [Bifidob...  92.0    6e-17


First alignments:

>ref|YP_546379.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacillus 
flagellatus KT]
 sp|Q1GYZ9.1|MURD_METFK Gene info RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|ABE50538.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacillus 
flagellatus KT]
Length=453

 GENE ID: 4001365 Mfla_2271 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Methylobacillus flagellatus KT] (10 or fewer PubMed links)

 Score =  226 bits (577),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/306 (44%), Positives = 189/306 (61%), Gaps = 8/306 (2%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGKSTVT +V  I +  G   V  GNIG+PVL+V+           DV+VLE+SSFQ++T
Sbjct  119  NGKSTVTTLVGEICKAAGFKTVVAGNIGLPVLDVIND-------AVDVYVLELSSFQLET  171

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEIA-GED  119
            TYS   DAA VLN+S DH+DRY D  AY  +K RI +  G++V+N D+       A G  
Sbjct  172  TYSLAADAATVLNISADHMDRYADMQAYANAKARIFTRAGLQVLNADDAWSRGMAAEGVA  231

Query  120  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
             ++FGL  P + + +G+   AGE W+A G +++    DL ++G+HN  NA+AALAL + L
Sbjct  232  QLTFGLDAPRSAQDFGLLHDAGEAWLARGQRKLMPVADLNITGLHNAANALAALALCTVL  291

Query  180  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLG  239
                  A++ L  ++GL HR+QWVADI GV FY+DSK TNVGAT AA+ GL  K VL+ G
Sbjct  292  DIDEVVALQALRDFKGLPHRVQWVADIDGVSFYDDSKGTNVGATVAALHGLNRKLVLIAG  351

Query  240  GESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLA  299
            G+ K Q+F  L   + +  R VVL+GRDA +I   ++ +GV +     L  AV  A  LA
Sbjct  352  GDGKGQDFAALRAPVAKHARAVVLIGRDAGVIADALQESGVLLEYGDTLEEAVVKAFNLA  411

Query  300  EPGEIV  305
            + G+ V
Sbjct  412  DRGDAV  417


>ref|ZP_03699179.1|  UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella nitroferrum 
2002]
 gb|EEG07893.1|  UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella nitroferrum 
2002]
Length=455

 Score =  224 bits (570),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 193/306 (63%), Gaps = 5/306 (1%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGKSTVT +V  + ++ GLD V  GNIG+PVL+ L + E   ++ PDV+VLE+SSFQ++T
Sbjct  119  NGKSTVTSLVGHLCRQAGLDTVLAGNIGLPVLDALGEREASGKR-PDVWVLELSSFQLET  177

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEI-AGED  119
            T S   DAA VLN+SEDHLDRY D   Y  SK  + +GRG++V+NRD+ +V   +  G  
Sbjct  178  TTSLNADAATVLNISEDHLDRYADLLDYAHSKTAVFNGRGVQVLNRDDALVRAMVRPGHA  237

Query  120  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
               F L    +   + + + AG  W+    + +F C ++ + G+HN  NA+AALAL+  +
Sbjct  238  QRWFSLKETAD---YALRQDAGRYWLTVAGEAVFDCAEMSLQGLHNAANALAALALTEAI  294

Query  180  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLG  239
                   + GL ++ GL HR+++VA++ GV++ +DSK TNVGAT AA++G+    VL+ G
Sbjct  295  GLPRAALLEGLKTFTGLAHRVEFVAEVHGVRYIDDSKGTNVGATEAALNGMTRPVVLIAG  354

Query  240  GESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLA  299
            G+ K Q+F  L        R V+L+GRDA  I+  +EG  + I+D A L  A + AA+LA
Sbjct  355  GDGKGQDFSPLKPACARIARAVLLIGRDAGKIRAVLEGLPLPIVDCATLEEATREAARLA  414

Query  300  EPGEIV  305
            E G++V
Sbjct  415  EAGDVV  420


>ref|YP_743027.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alkalilimnicola 
ehrlichei MLHE-1]
 gb|ABI57537.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alkalilimnicola 
ehrlichei MLHE-1]
Length=449

 GENE ID: 4270974 Mlg_2195 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Alkalilimnicola ehrlichei MLHE-1]

 Score =  221 bits (563),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 179/309 (57%), Gaps = 14/309 (4%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGKSTVT +V R+ +  G      GN+G P L +L+   R     PD ++LE+SSFQ++T
Sbjct  119  NGKSTVTTLVGRMAEAAGRRVAVGGNLGTPALALLDGETR-----PDAYILELSSFQLET  173

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEIAGEDS  120
            T+S     A VLN+S DH+DR+    AY   K RI  G G++V+N D+P+V   +A    
Sbjct  174  THSLAPRVAAVLNISADHMDRHGSVSAYAGIKARIFHGAGVQVLNLDDPVV-AAMAQPGR  232

Query  121  VSFGLSPPDNDR-SWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
               G S   N R   GV+   G  W+    + +    DLR+ G+HN  NA+AAL L   L
Sbjct  233  TVLGFSLASNPRRGAGVADHRGAPWLHLNGEPVLPAADLRLPGLHNRANALAALCLGQGL  292

Query  180  ---VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVL  236
               V+   +A+R    + GL HR +WVA+ +GV++YNDSK TNVGA  AAI GL    VL
Sbjct  293  GLPVAAMAEALR---RFTGLPHRTEWVAEHAGVRWYNDSKGTNVGAAVAAIRGLAGPVVL  349

Query  237  LLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAA  296
            + GG+ K  +F  L D +REK R  VL+GRDA  + + + G  V +  AAD+ +AV+ AA
Sbjct  350  IAGGDGKGADFLPLADALREKGRAAVLIGRDAPRLAQVLSGV-VPVERAADMRDAVRRAA  408

Query  297  QLAEPGEIV  305
             LA  G+ V
Sbjct  409  NLARSGDAV  417


>sp|A3M1C6.2|MURD_ACIBT  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|ABO10720.2|  UDP-N-acetylmuramoylalanine-D-glutamate ligase [Acinetobacter 
baumannii ATCC 17978]
Length=448

 Score =  215 bits (547),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 184/306 (60%), Gaps = 24/306 (7%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            N KSTVT ++  + ++ G      GN+G P L++L       +  P++ VLE+SSFQ++T
Sbjct  114  NAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLL-------KDQPELLVLELSSFQLET  166

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDE----PIVLNEIA  116
            T     + AVVLN+SEDHLDR+ +   Y ++K RI  G    V NRD+    P+V +   
Sbjct  167  TSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSRPLVPDTTP  226

Query  117  GEDSVSFGLSPPDNDRSWGVSKIA-GEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALAL  175
             +   SFGL+ PD ++ +GV + A G  W+ACG Q++ +  DL + GMHNV NA+A LAL
Sbjct  227  MQ---SFGLNAPDLNQ-YGVLRDADGTLWLACGLQRLIKSSDLYIQGMHNVANALACLAL  282

Query  176  SSTLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPA---  232
               +    E  +  L  ++GL+HR ++V  +  V++YNDSK TNVGAT AAI GL A   
Sbjct  283  GEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIE  342

Query  233  ----KCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADL  288
                K  L+LGG+ K Q+F  L   I +  +VVVL+G DA +I++ I+GA   IL AA L
Sbjct  343  VKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGA-TKILHAATL  401

Query  289  INAVQI  294
              AV++
Sbjct  402  KEAVEL  407


>ref|YP_413177.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosospira 
multiformis ATCC 25196]
 sp|Q2Y636.1|MURD_NITMU  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|ABB75785.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosospira 
multiformis ATCC 25196]
Length=473

 GENE ID: 3786755 Nmul_A2496 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Nitrosospira multiformis ATCC 25196]

 Score =  215 bits (547),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 134/308 (43%), Positives = 183/308 (59%), Gaps = 4/308 (1%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGK+TVT M   +L++ G D    GNIG  VL+ L + E    KMP  +VLE+SSFQ++T
Sbjct  122  NGKTTVTAMTGAMLKKAGWDVEVAGNIGPAVLDALMRREDTG-KMPQAWVLELSSFQLET  180

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSG--RGIKVVNRDEPIVLN-EIAG  117
            T S   DAA VLNVSEDHLDRY     Y  +K RI  G   G++++N D+P+V    +AG
Sbjct  181  TKSLGLDAAAVLNVSEDHLDRYAGMQEYAAAKARIFLGDSEGVQILNGDDPVVRQMTLAG  240

Query  118  EDSVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSS  177
               V+F L+ P +   +G+ +  G+ W+  G  ++    +L ++G HN  NA+AALAL  
Sbjct  241  RPHVTFSLATPQSADDFGLLREGGDTWLMQGDTRLMDARELAITGRHNCANALAALALCR  300

Query  178  TLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLL  237
             L    E  ++ L  + GL HR++ VA  SG+ FY+DSK TNVGAT AA+ GL    VL+
Sbjct  301  ALAVPFEPLLQALREFRGLPHRVEKVAAFSGITFYDDSKGTNVGATVAALKGLGQPVVLI  360

Query  238  LGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQ  297
             GG+ K QNF  L   I E  R VVL+GRDA+ I   I   GV +  A  +  AV+ + Q
Sbjct  361  AGGDGKAQNFSPLAAPIGEHGRAVVLIGRDAEKIAVAINECGVPLHRAQTMEEAVRKSFQ  420

Query  298  LAEPGEIV  305
            LA  G+ V
Sbjct  421  LAREGDAV  428


>ref|YP_001083322.1| Gene info UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Acinetobacter 
baumannii ATCC 17978]
Length=435

 GENE ID: 4919251 murD | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
[Acinetobacter baumannii ATCC 17978] (10 or fewer PubMed links)

 Score =  214 bits (546),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 184/306 (60%), Gaps = 24/306 (7%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            N KSTVT ++  + ++ G      GN+G P L++L       +  P++ VLE+SSFQ++T
Sbjct  101  NAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLL-------KDQPELLVLELSSFQLET  153

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDE----PIVLNEIA  116
            T     + AVVLN+SEDHLDR+ +   Y ++K RI  G    V NRD+    P+V +   
Sbjct  154  TSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSRPLVPDTTP  213

Query  117  GEDSVSFGLSPPDNDRSWGVSKIA-GEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALAL  175
             +   SFGL+ PD ++ +GV + A G  W+ACG Q++ +  DL + GMHNV NA+A LAL
Sbjct  214  MQ---SFGLNAPDLNQ-YGVLRDADGTLWLACGLQRLIKSSDLYIQGMHNVANALACLAL  269

Query  176  SSTLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPA---  232
               +    E  +  L  ++GL+HR ++V  +  V++YNDSK TNVGAT AAI GL A   
Sbjct  270  GEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAAIE  329

Query  233  ----KCVLLLGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADL  288
                K  L+LGG+ K Q+F  L   I +  +VVVL+G DA +I++ I+GA   IL AA L
Sbjct  330  VKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGA-TKILHAATL  388

Query  289  INAVQI  294
              AV++
Sbjct  389  KEAVEL  394


>ref|YP_313875.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thiobacillus 
denitrificans ATCC 25259]
 sp|Q3SMH5.1|MURD_THIDA Gene info RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|AAZ96070.1| Gene info UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thiobacillus 
denitrificans ATCC 25259]
Length=474

 GENE ID: 3673896 Tbd_0117 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Thiobacillus denitrificans ATCC 25259] (10 or fewer PubMed links)

 Score =  212 bits (539),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 194/307 (63%), Gaps = 6/307 (1%)

Query  1    NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  60
            NGKSTVT M   + +  GL     GNIG+PVL+ L +IE+ A  +P V+VLE+SSFQ++T
Sbjct  136  NGKSTVTAMCGDMCRMAGLTVCVAGNIGLPVLDALHEIEQGAAPLPQVWVLELSSFQLET  195

Query  61   TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLN-EIAGED  119
            T S +  AA VLN+SEDH+DRY D  AY  +K RI SG G++V+NRD+P  L   I G  
Sbjct  196  TSSLDATAAAVLNLSEDHMDRYPDMAAYAAAKARIFSGNGVQVLNRDDPRTLAMAIPGRH  255

Query  120  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  179
             VSFGL     D ++G+     E  +  G   +     L V G+HN  NA+AALAL+  L
Sbjct  256  VVSFGLDRCPTDENFGLC----EDELCLGGDMLMPLSVLAVPGLHNAANALAALALTRAL  311

Query  180  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLP-AKCVLLL  238
                E  +RGL+ ++GL HR++ VADI GV +Y+DSK TNVGAT AA+ G+   K V++L
Sbjct  312  DLPIEALLRGLMHFKGLPHRVEKVADIDGVTWYDDSKGTNVGATEAALYGMGRRKAVVIL  371

Query  239  GGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQL  298
            GG+ K Q+F  L   +    R VVL+GRDA  I+  IE +GV    A  L +AV+ AA+L
Sbjct  372  GGDGKGQDFGPLKAAVAANARAVVLIGRDAVAIEAAIEDSGVASYRADTLPDAVEQAARL  431

Query  299  AEPGEIV  305
            AEPG+ V
Sbjct  432  AEPGDAV  438
...
..
.


----------------------------------------------------------------------------------------------------

c) Blastx vs nr protein sequences, default NCBI settings
On genomic sequence.

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_313875.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   250    1e-64 Gene info
ref|YP_546379.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   245    4e-63 Gene info
ref|YP_932386.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   243    2e-62 Gene info
ref|ZP_03699179.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   242    4e-62
ref|YP_413177.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   233    2e-59 Gene info
ref|YP_157818.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   232    4e-59 Gene info
ref|NP_841062.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   227    1e-57 Gene info
ref|NP_904015.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   224    8e-57 Gene info
ref|ZP_03712931.1|  hypothetical protein EIKCOROL_00603 [Eiken...   224    1e-56
ref|YP_002512846.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   224    1e-56 Gene info
ref|YP_114845.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   223    1e-56 Gene info
ref|YP_002797045.1|  MurD [Laribacter hongkongensis HLHK9] >gb...   220    2e-55
ref|YP_002624314.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   220    2e-55 Gene info
ref|YP_344839.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   220    2e-55 Gene info
ref|YP_983637.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   218    5e-55 Gene info
ref|YP_746497.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   218    8e-55 Gene info
ref|YP_743027.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   214    1e-53 Gene info
ref|YP_001897086.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   213    1e-53 Gene info
ref|YP_002661646.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   213    2e-53 Gene info
ref|ZP_03744534.1|  hypothetical protein NEICINOT_00641 [Neiss...   213    3e-53
ref|ZP_01127093.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   212    4e-53
ref|YP_002792437.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   211    6e-53 Gene info
ref|ZP_03689586.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   211    6e-53
ref|YP_002002449.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   211    6e-53 Gene info
ref|YP_787377.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   211    1e-52 Gene info
ref|YP_208583.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   211    1e-52 Gene info
ref|YP_560501.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   210    2e-52 Gene info
sp|A3M1C6.2|MURD_ACIBT  RecName: Full=UDP-N-acetylmuramoylalan...   209    2e-52
ref|YP_001083322.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   209    2e-52 Gene info
ref|YP_436959.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   209    2e-52 Gene info
ref|ZP_03721983.1|  hypothetical protein NEILACOT_01273 [Neiss...   209    3e-52
ref|ZP_03749793.1|  hypothetical protein NEISUBOT_00845 [Neiss...   209    4e-52
ref|NP_273468.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   209    4e-52 Gene info
ref|ZP_03720599.1|  hypothetical protein NEIFLAOT_02461 [Neiss...   208    5e-52
ref|ZP_03747129.1|  hypothetical protein NEIMUCOT_01111 [Neiss...   208    6e-52
ref|YP_297185.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   208    6e-52 Gene info
ref|YP_001858893.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   206    2e-51 Gene info
ref|ZP_02887834.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   206    2e-51
ref|YP_002343324.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   206    2e-51 Gene info
ref|ZP_03267899.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   206    3e-51
ref|YP_002006722.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   206    3e-51 Gene info
ref|ZP_01915387.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   206    3e-51
ref|YP_975691.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   205    4e-51 Gene info
ref|YP_001708364.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   205    5e-51 Gene info
ref|ZP_03554947.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   204    7e-51
ref|YP_001844927.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   204    7e-51 Gene info
ref|YP_002317743.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   204    9e-51 Gene info
ref|YP_001715281.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   204    9e-51 Gene info
ref|YP_547923.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   204    9e-51 Gene info
ref|YP_001599827.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   204    1e-50 Gene info
ref|YP_727717.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   203    2e-50 Gene info
ref|YP_585271.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   203    2e-50 Gene info
ref|YP_619963.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   202    4e-50 Gene info
ref|ZP_03822219.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   201    8e-50
ref|YP_001900646.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   201    8e-50 Gene info
ref|YP_001354707.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   201    1e-49 Gene info
ref|YP_350403.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   201    1e-49 Gene info
ref|YP_002232566.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   200    1e-49 Gene info
ref|YP_002092431.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   200    1e-49 Gene info
ref|ZP_02009820.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   200    2e-49
ref|YP_441664.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   200    2e-49 Gene info
ref|YP_002670389.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   199    2e-49 Gene info
ref|YP_609953.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   199    2e-49 Gene info
ref|ZP_02491598.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   199    3e-49
ref|ZP_02483408.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   199    3e-49
ref|ZP_02464864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   199    3e-49
ref|ZP_02457402.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   199    3e-49
ref|ZP_02413087.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   199    3e-49
ref|YP_002013934.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   199    3e-49 Gene info
ref|YP_002063566.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   199    3e-49 Gene info
ref|YP_001060537.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   199    3e-49 Gene info
ref|YP_991823.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   199    3e-49 Gene info
ref|YP_286699.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   199    3e-49 Gene info
ref|YP_104096.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   199    3e-49 Gene info
ref|NP_743494.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   199    3e-49 Gene info
ref|YP_002034767.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   199    3e-49 Gene info
ref|ZP_00442376.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   199    3e-49
emb|CAH37039.1|  UDP-N-acetylmuramoylalanine--D-glutamate liga...   199    3e-49 Gene info
ref|YP_692316.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   198    5e-49 Gene info
ref|YP_001118380.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   198    5e-49 Gene info
ref|YP_001101048.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   198    6e-49 Gene info
ref|YP_001562497.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   197    8e-49 Gene info
ref|ZP_01168182.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   197    8e-49
ref|YP_002586308.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   197    1e-48 Gene info
ref|YP_001581019.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   197    1e-48 Gene info
ref|ZP_02062855.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   197    1e-48
ref|ZP_03586254.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   196    2e-48
ref|YP_772354.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   196    2e-48 Gene info
ref|ZP_01766907.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   196    2e-48
ref|YP_001670736.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   196    2e-48 Gene info
ref|YP_001807199.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   196    2e-48 Gene info
ref|YP_367888.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   196    2e-48 Gene info
ref|ZP_02891198.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   196    3e-48
ref|NP_520967.2|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   196    3e-48 Gene info
emb|CAD16553.1|  probable udp-n-acetylmuramoylalanine--d-gluta...   196    3e-48 Gene info
ref|YP_001269696.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   196    3e-48 Gene info
ref|ZP_03575542.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   195    4e-48
ref|YP_001747816.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   195    4e-48 Gene info
ref|YP_001249856.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   195    5e-48 Gene info
ref|YP_001171619.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   195    5e-48 Gene info
ref|YP_001503658.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   195    5e-48 Gene info
ref|NP_885907.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   195    5e-48 Gene info
ref|ZP_02905428.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   194    9e-48
ref|ZP_02364225.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   194    9e-48
ref|YP_262142.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    9e-48 Gene info
sp|Q6FFC2.2|MURD_ACIAD  RecName: Full=UDP-N-acetylmuramoylalan...   194    9e-48
ref|YP_045057.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    9e-48 Gene info
ref|NP_890735.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   194    9e-48 Gene info
ref|YP_001763828.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   194    1e-47 Gene info
ref|YP_124974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   193    2e-47 Gene info
ref|NP_881600.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   193    2e-47 Gene info
ref|YP_096621.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   193    2e-47 Gene info
ref|YP_002099344.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   192    3e-47 Gene info
ref|YP_987859.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   192    4e-47 Gene info
ref|YP_127868.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   192    4e-47 Gene info
ref|YP_002554415.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   191    6e-47 Gene info
ref|ZP_02378406.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   191    6e-47
ref|ZP_02357117.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   191    8e-47
ref|ZP_00945779.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   191    1e-46
ref|ZP_01627198.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   190    1e-46
ref|YP_999284.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   190    2e-46 Gene info
ref|YP_001186420.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   190    2e-46 Gene info
ref|ZP_01363919.1|  hypothetical protein PaerPA_01001022 [Pseu...   189    2e-46
ref|ZP_02373345.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   189    3e-46
ref|YP_969191.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   189    3e-46 Gene info
ref|YP_001425285.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   188    5e-46 Gene info
ref|NP_819181.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   188    5e-46 Gene info
ref|YP_002798524.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   188    5e-46
ref|NP_253104.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   188    5e-46 Gene info
ref|YP_002442374.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   188    7e-46 Gene info
ref|YP_001629298.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   188    7e-46 Gene info
ref|YP_001003659.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   188    7e-46 Gene info
ref|ZP_01618541.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   187    9e-46
gb|AAG45237.1|  MurD [Pseudomonas aeruginosa]                       187    9e-46
ref|YP_276232.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   187    1e-45 Gene info
ref|ZP_01945936.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   187    1e-45
ref|YP_002251946.1|  udp-n-acetylmuramoylalanine--d-glutamate ...   186    2e-45 Gene info
ref|YP_001672687.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   186    3e-45 Gene info
ref|YP_001472149.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   186    3e-45 Gene info
ref|YP_858325.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   186    3e-45 Gene info
ref|YP_871369.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   186    3e-45 Gene info
ref|YP_735693.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   186    3e-45 Gene info
ref|YP_792760.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   186    3e-45 Gene info
ref|YP_524667.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   185    4e-45 Gene info
ref|YP_736444.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   185    4e-45 Gene info
ref|ZP_02532604.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   184    7e-45
ref|ZP_01899263.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   184    7e-45
ref|NP_794164.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   184    1e-44 Gene info
ref|YP_001182016.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   184    1e-44 Gene info
ref|ZP_01705146.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   184    1e-44
ref|YP_574242.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   184    1e-44 Gene info
ref|YP_237172.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   184    1e-44 Gene info
ref|NP_719749.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   184    1e-44 Gene info
ref|YP_961793.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   184    1e-44 Gene info
ref|YP_959716.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   184    1e-44 Gene info
ref|ZP_03394720.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   183    2e-44
ref|YP_001291004.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   183    2e-44 Gene info
ref|ZP_03541241.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   183    2e-44
ref|YP_001983387.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   183    2e-44 Gene info
ref|YP_154826.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   182    5e-44 Gene info
ref|YP_002661060.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   181    6e-44 Gene info
ref|ZP_01792776.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   181    6e-44
ref|ZP_03741715.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   181    1e-43
ref|ZP_01788866.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   181    1e-43
ref|ZP_00155602.2|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   181    1e-43
ref|YP_001279085.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   180    1e-43 Gene info
ref|NP_439294.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   180    1e-43 GeoGene info
ref|ZP_01736231.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   180    2e-43
ref|YP_002311565.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   179    2e-43 Gene info
ref|ZP_01895011.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   179    2e-43
sp|Q9F1N2.1|MURD_SHEVI  RecName: Full=UDP-N-acetylmuramoylalan...   179    2e-43
ref|ZP_02159038.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   179    3e-43
ref|YP_001293049.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   179    3e-43 Gene info
ref|YP_271115.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   179    3e-43 Gene info
ref|YP_001048801.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   179    3e-43 Gene info
ref|ZP_01796858.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   179    4e-43
ref|ZP_01786018.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   179    4e-43
ref|YP_001140324.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   179    4e-43 Gene info
ref|YP_265321.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   179    4e-43 Gene info
ref|YP_002356382.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   178    5e-43 Gene info
ref|YP_001364631.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   178    5e-43 Gene info
ref|YP_001552852.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   178    5e-43 Gene info
ref|ZP_01308408.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   178    7e-43
ref|ZP_01224266.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   178    7e-43
ref|YP_581604.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   178    7e-43 Gene info
ref|YP_752470.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   178    7e-43 Gene info
ref|YP_926233.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   177    9e-43 Gene info
ref|YP_340996.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   177    1e-42 Gene info
ref|YP_001762880.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   177    2e-42 Gene info
ref|ZP_01101813.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   177    2e-42
ref|ZP_00156976.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   177    2e-42
ref|ZP_01868442.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   176    3e-42
ref|YP_001095580.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   175    6e-42 Gene info
ref|ZP_03620958.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   174    1e-41
ref|YP_526320.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   174    1e-41 Gene info
ref|YP_561371.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   173    2e-41 Gene info
ref|NP_245077.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   173    2e-41 Gene info
ref|ZP_01221036.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   172    4e-41
ref|YP_002127548.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   172    4e-41 Gene info
ref|ZP_01043583.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   172    4e-41
ref|ZP_03280786.1|  hypothetical protein ENTCAN_00531 [Enterob...   172    5e-41
ref|YP_001005019.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   172    5e-41 Gene info
ref|YP_001175372.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   172    5e-41 Gene info
ref|NP_933405.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   171    6e-41 Gene info
ref|YP_001341464.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   171    8e-41 Gene info
ref|ZP_01215960.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   171    8e-41
ref|NP_759569.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   171    8e-41 Gene info
ref|ZP_03831117.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   171    1e-40
ref|YP_718566.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   171    1e-40 Gene info
ref|YP_002654979.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   170    1e-40 Gene info
ref|YP_001439308.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   170    1e-40 Gene info
ref|YP_001783964.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   170    2e-40 Gene info
ref|NP_670925.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   170    2e-40 Gene info
ref|YP_001906697.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   169    2e-40 Gene info
ref|YP_001722240.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   169    2e-40 Gene info
ref|ZP_00831635.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   169    2e-40
ref|YP_001402346.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   169    2e-40 Gene info
ref|ZP_02902823.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   169    3e-40
ref|YP_069227.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   169    3e-40 Gene info
ref|ZP_03827644.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   169    4e-40
ref|YP_001454807.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   169    4e-40 Gene info
ref|YP_401842.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   169    4e-40 Gene info
ref|YP_088861.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   169    4e-40 Gene info
ref|YP_131325.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   169    4e-40 Gene info
ref|NP_285784.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   169    4e-40 Gene info
ref|YP_002381336.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamat...   168    5e-40 Gene info
ref|YP_001742210.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   168    5e-40 Gene info
ref|ZP_00825921.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   168    5e-40
ref|ZP_02814622.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   168    7e-40
ref|ZP_02655463.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   168    7e-40
ref|YP_001586435.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   168    7e-40 Gene info
ref|YP_215110.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
ref|YP_149473.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
ref|NP_459131.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
ref|NP_706043.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
ref|NP_752060.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
pdb|1E0D|A  Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamat...   168    7e-40 Related structures
ref|ZP_03029561.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   168    7e-40
ref|ZP_00832999.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   168    7e-40
ref|YP_539138.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
ref|YP_001461258.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   168    7e-40 Gene info
ref|YP_406639.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   168    7e-40 Gene info
ref|YP_001878898.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   168    7e-40 Gene info
ref|NP_414630.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamate l...   168    7e-40 Gene info
ref|ZP_03835243.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   167    9e-40
ref|YP_903964.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   167    9e-40 Gene info
ref|NP_454738.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   167    9e-40 Gene info
ref|NP_872842.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   167    1e-39 Gene info
ref|YP_002073583.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   167    1e-39 Gene info
gb|EEH95033.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synt...   167    2e-39
ref|ZP_03367430.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   167    2e-39
ref|YP_429701.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   167    2e-39 Gene info
ref|YP_051906.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   167    2e-39 Gene info
ref|YP_002327685.1|  UDP-N-acetylmuramoyl-L-alanine: D-glutama...   166    2e-39 Gene info
ref|YP_687672.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   166    2e-39 Gene info
ref|ZP_01262434.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   166    2e-39
ref|NP_835826.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   166    2e-39 Gene info
ref|YP_002474764.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   166    3e-39 Gene info
ref|ZP_03066695.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   166    3e-39
ref|ZP_02479193.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   166    3e-39
ref|YP_309126.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   166    3e-39 Gene info
ref|ZP_00822274.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   166    3e-39
ref|YP_001345217.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   166    3e-39 Gene info
pdb|2JFF|A  Chain A, Crystal Structure Of Murd Ligase In Compl...   166    4e-39 Related structures
ref|YP_001476993.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   166    4e-39 Gene info
ref|ZP_01236033.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   166    4e-39
pdb|2UAG|A  Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamat...   166    4e-39 Related structures
ref|YP_001219540.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   165    5e-39 Gene info
ref|ZP_01612196.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   165    5e-39
ref|YP_001797098.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   165    6e-39 Gene info
ref|YP_001571864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   164    8e-39 Gene info
ref|ZP_00993152.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   164    8e-39
ref|YP_002665342.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   164    1e-38 Gene info
ref|YP_002240440.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   164    1e-38 Gene info
ref|YP_001333782.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   164    1e-38 Gene info
ref|NP_796837.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   164    1e-38 Gene info
ref|ZP_01160671.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   164    1e-38
ref|YP_002602545.1|  MurD [Desulfobacterium autotrophicum HRM2...   163    2e-38 Gene info
ref|YP_001717577.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   163    2e-38 Gene info
ref|YP_001680625.1|  udp-n-acetylmuramoylalanine--d-glutamate ...   163    2e-38 Gene info
emb|CAA35611.1|  unnamed protein product [Escherichia coli]         163    2e-38
ref|ZP_03025116.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   163    2e-38
ref|YP_002263984.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   162    4e-38 Gene info
ref|ZP_01988070.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   162    5e-38
ref|YP_383378.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   161    7e-38 Gene info
ref|ZP_01066825.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   161    7e-38
ref|YP_002171856.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   161    9e-38 Gene info
ref|YP_001444126.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   160    1e-37 Gene info
ref|ZP_01816133.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   160    1e-37
ref|YP_001530669.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   160    1e-37 Gene info
ref|YP_663077.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   160    1e-37 Gene info
ref|YP_002218848.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   160    1e-37 Gene info
ref|ZP_03803848.1|  hypothetical protein PROPEN_02224 [Proteus...   160    2e-37
ref|YP_002151791.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   159    3e-37 Gene info
ref|YP_001154950.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   159    3e-37 Gene info
ref|YP_002536241.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   159    3e-37 Gene info
ref|ZP_03840814.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   159    3e-37
ref|YP_002416105.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   159    3e-37 Gene info
ref|YP_001212413.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   159    3e-37 Gene info
ref|YP_942581.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   159    3e-37 Gene info
ref|YP_001789560.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   159    4e-37 Gene info
ref|YP_454127.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   159    4e-37 Gene info
ref|YP_390836.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   158    6e-37 Gene info
ref|YP_002467975.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   158    7e-37 Gene info
ref|YP_360890.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   158    7e-37 Gene info
ref|NP_240048.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   158    7e-37 Gene info
ref|ZP_03315112.1|  hypothetical protein PROVRUST_01912 [Provi...   157    1e-36
ref|YP_066635.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   157    1e-36 Gene info
ref|NP_930864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   157    1e-36 Gene info
ref|YP_002137314.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   157    2e-36 Gene info
ref|NP_878446.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamate l...   157    2e-36 Gene info
ref|ZP_01078506.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   157    2e-36
ref|ZP_01115002.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   156    2e-36
ref|NP_720984.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   156    3e-36 Gene info
ref|YP_902941.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   156    3e-36 Gene info
ref|ZP_03905046.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   155    4e-36
ref|NP_871211.1|  hypothetical protein WGLp208 [Wigglesworthia...   155    4e-36 Gene info
ref|ZP_01313466.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   155    4e-36
ref|YP_001612300.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   155    5e-36 Gene info
ref|NP_954113.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   155    5e-36 Gene info
ref|ZP_03557136.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   155    6e-36
ref|ZP_03320883.1|  hypothetical protein PROVALCAL_03852 [Prov...   155    6e-36
ref|ZP_01116816.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   155    6e-36
ref|ZP_02961396.1|  hypothetical protein PROSTU_03424 [Provide...   154    8e-36
ref|ZP_01291365.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   154    8e-36
ref|YP_146971.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   154    8e-36 Gene info
ref|ZP_03968348.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   154    1e-35
ref|ZP_03642973.1|  hypothetical protein BACCOPRO_01334 [Bacte...   154    1e-35
ref|YP_001125106.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   154    1e-35 Gene info
ref|YP_588950.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   154    1e-35 Gene info
ref|ZP_01288416.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   154    1e-35
ref|ZP_01133441.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   154    1e-35
ref|ZP_01290512.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   153    2e-35
ref|NP_777827.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   153    2e-35 Gene info
ref|ZP_02033338.1|  hypothetical protein PARMER_03363 [Parabac...   153    2e-35
ref|YP_001112037.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   153    2e-35 Gene info
ref|YP_002654158.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    3e-35 Gene info
ref|YP_001232693.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    3e-35 Gene info
ref|ZP_03494087.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   152    4e-35
ref|YP_002156999.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    4e-35 Gene info
gb|ABZ08299.1|  putative Mur ligase family, catalytic domain p...   152    4e-35
ref|ZP_01734230.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   152    4e-35
ref|YP_002070041.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    4e-35 Gene info
gb|ABZ89707.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   152    5e-35
ref|YP_277657.1|  UDP-N-acetylmuramoyl-L-alanine:D-glutamate l...   152    5e-35 Gene info
ref|YP_001019657.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   152    5e-35 Gene info
ref|ZP_03474577.1|  hypothetical protein PRABACTJOHN_00231 [Pa...   151    7e-35
ref|NP_232033.2|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   151    7e-35 Gene info
ref|YP_002811077.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   151    7e-35 Gene info
ref|ZP_01957911.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   151    7e-35
ref|ZP_01677390.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   151    7e-35
ref|ZP_03611755.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   151    9e-35
ref|YP_001944501.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   151    9e-35 Gene info
gb|ABZ89690.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   150    1e-34
ref|ZP_01949224.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   150    1e-34
ref|YP_847574.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   150    1e-34 Gene info
ref|YP_002789265.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   150    1e-34 Gene info
ref|ZP_03637574.1|  hypothetical protein PROVRETT_00638 [Provi...   150    2e-34
ref|ZP_03391555.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   150    2e-34
ref|YP_002820743.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   150    2e-34 Gene info
ref|YP_205586.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   150    2e-34 Gene info
sp|Q5E2P8.2|MURD_VIBF1  RecName: Full=UDP-N-acetylmuramoylalan...   150    2e-34
ref|ZP_01681401.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   150    2e-34
ref|YP_864682.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   150    2e-34 Gene info
ref|YP_002432291.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   149    3e-34 Gene info
ref|YP_002754193.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutama...   149    3e-34 Gene info
ref|YP_097591.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   149    3e-34 Gene info
ref|ZP_01122341.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   149    3e-34
ref|ZP_03307607.1|  hypothetical protein BACFIN_01953 [Bactero...   149    4e-34
ref|YP_002316178.1|  UDP-N-acetylmuramoylalanyl-D-glutamate li...   149    4e-34 Gene info
ref|YP_002247022.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   149    4e-34 Gene info
ref|ZP_03040773.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   149    4e-34
ref|YP_001967810.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   149    4e-34 Gene info
ref|YP_001957919.1|  hypothetical protein Aasi_0816 [Candidatu...   149    4e-34 Gene info
ref|YP_001264432.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   149    4e-34 Gene info
ref|ZP_01304736.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   149    4e-34
ref|YP_162564.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   149    4e-34 Gene info
ref|ZP_03206842.1|  hypothetical protein BACPLE_00454 [Bactero...   148    6e-34
ref|YP_001651067.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   148    6e-34 Gene info
ref|ZP_02064885.1|  hypothetical protein BACOVA_01855 [Bactero...   148    6e-34
ref|YP_444701.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   148    6e-34 Gene info
ref|ZP_00134085.2|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   148    6e-34
ref|ZP_03011706.1|  hypothetical protein BACCOP_03622 [Bactero...   147    1e-33
ref|YP_001950918.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   147    1e-33 Gene info
ref|YP_375997.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   147    1e-33 Gene info
ref|YP_139239.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   147    1e-33 Gene info
ref|YP_679333.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   147    1e-33 Gene info
ref|YP_002122973.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   147    1e-33 Gene info
ref|YP_001303831.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   147    1e-33 Gene info
ref|YP_002562598.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   147    2e-33 Gene info
ref|ZP_01961865.1|  hypothetical protein BACCAC_03508 [Bactero...   147    2e-33
ref|YP_002744914.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   146    2e-33 Gene info
ref|YP_001999652.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   146    2e-33 Gene info
ref|ZP_02072421.1|  hypothetical protein BACUNI_03868 [Bactero...   146    2e-33
ref|YP_795579.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   146    2e-33 Gene info
ref|ZP_01203271.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   146    2e-33
ref|NP_812362.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   146    2e-33 Gene info
sp|Q8A256.2|MURD_BACTN  RecName: Full=UDP-N-acetylmuramoylalan...   146    2e-33
ref|ZP_03677151.1|  hypothetical protein BACCELL_01487 [Bacter...   146    3e-33
ref|YP_820220.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   146    3e-33 Gene info
ref|ZP_03846339.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   145    4e-33
ref|ZP_03617357.1|  hypothetical protein PREVCOP_02853 [Prevot...   145    4e-33
ref|ZP_03013322.1|  hypothetical protein BACINT_00879 [Bactero...   145    5e-33
ref|YP_001577267.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   145    5e-33 Gene info
ref|NP_660942.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   145    5e-33 Gene info
ref|YP_828509.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   145    5e-33 Gene info
ref|YP_002745973.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   145    6e-33 Gene info
ref|YP_001449974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   145    6e-33 Gene info
ref|NP_623245.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   145    6e-33 Gene info
ref|YP_001179728.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   145    6e-33 Gene info
ref|YP_002572664.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   144    8e-33 Gene info
ref|YP_193702.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   144    8e-33 Gene info
ref|ZP_03917010.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   144    1e-32
ref|ZP_03460654.1|  hypothetical protein BACEGG_03472 [Bactero...   144    1e-32
ref|ZP_02919805.1|  hypothetical protein STRINF_00657 [Strepto...   144    1e-32
ref|YP_001034640.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   144    1e-32 Gene info
ref|YP_357613.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   144    1e-32 Gene info
ref|ZP_03294980.1|  hypothetical protein COLINT_00666 [Collins...   144    1e-32
ref|ZP_00785114.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   144    1e-32
ref|ZP_02436285.1|  hypothetical protein BACSTE_02542 [Bactero...   143    2e-32
ref|ZP_02330008.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   143    2e-32
ref|YP_640421.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   143    2e-32 Gene info
ref|ZP_01252997.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   143    2e-32
ref|YP_395361.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   143    2e-32 Gene info
ref|YP_913131.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   143    2e-32 Gene info
ref|NP_734986.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   143    2e-32 Gene info
ref|ZP_03956482.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   143    2e-32
ref|ZP_03300938.1|  hypothetical protein BACDOR_02309 [Bactero...   143    2e-32
ref|YP_001298709.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   143    2e-32 Gene info
ref|ZP_01882133.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   143    2e-32
ref|YP_592706.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   143    2e-32 Gene info
ref|ZP_01059184.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   143    2e-32
ref|YP_616928.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   143    2e-32 Gene info
ref|ZP_03807176.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    3e-32
ref|ZP_01386845.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   142    3e-32
ref|NP_660564.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   142    3e-32 Gene info
ref|ZP_02716383.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   142    4e-32
ref|ZP_01823644.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   142    4e-32
ref|NP_687505.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   142    4e-32 Gene info
ref|ZP_03485911.1|  hypothetical protein ROSINTL182_03317 [Ros...   142    5e-32
ref|YP_001071538.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   142    5e-32 Gene info
ref|NP_692390.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   142    5e-32 Gene info
ref|ZP_03854533.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   141    7e-32
ref|YP_002735722.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   141    7e-32 Gene info
ref|ZP_02912788.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   141    7e-32
ref|ZP_01835217.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   141    7e-32
ref|ZP_01827326.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   141    7e-32
ref|YP_753515.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   141    7e-32 Gene info
ref|ZP_03702049.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   141    9e-32
ref|YP_001928741.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   141    9e-32 Gene info
ref|ZP_01818493.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   141    9e-32
ref|NP_904866.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   141    9e-32 Gene info
ref|YP_002737890.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    1e-31 Gene info
ref|YP_002510654.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    1e-31 Gene info
ref|ZP_02716986.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   140    1e-31
ref|ZP_01820460.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   140    1e-31
ref|ZP_01832062.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   140    1e-31
ref|ZP_01829543.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   140    1e-31
ref|YP_001663619.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    1e-31 Gene info
ref|NP_358197.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   140    1e-31 Gene info
ref|NP_345193.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   140    1e-31 Gene info
ref|ZP_03853834.1|  UDP-N-acetylmuramoylalanine--D-glutamateli...   140    2e-31
gb|ABZ89700.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   140    2e-31
ref|YP_001694158.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    2e-31 Gene info
ref|YP_001877274.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   140    2e-31 Gene info
ref|ZP_01824885.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   140    2e-31
ref|YP_460726.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   140    2e-31 Gene info
ref|YP_001664804.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   140    2e-31 Gene info
ref|ZP_03895807.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   140    2e-31
ref|ZP_02707866.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   140    2e-31
ref|YP_806496.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   140    2e-31 Gene info
ref|ZP_03965290.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   139    3e-31
ref|ZP_03211562.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   139    3e-31
ref|YP_001200027.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   139    3e-31 Gene info
ref|YP_001197842.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   139    3e-31 Gene info
ref|YP_175853.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   139    3e-31 Gene info
ref|YP_074860.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   139    3e-31 Gene info
ref|YP_002191664.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   139    4e-31 Gene info
ref|YP_001995746.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   139    4e-31 Gene info
ref|YP_001691923.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   139    4e-31 Gene info
ref|YP_001107962.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   139    4e-31 Gene info
ref|YP_862791.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   139    4e-31 Gene info
ref|YP_002037343.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   139    4e-31 Gene info
ref|ZP_01107256.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   139    4e-31
ref|YP_001987440.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   139    5e-31 Gene info
ref|YP_618804.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   139    5e-31 Gene info
ref|YP_535942.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   139    5e-31 Gene info
ref|YP_002309150.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   138    6e-31 Gene info
ref|YP_002019656.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   138    6e-31 Gene info
ref|YP_812737.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   138    6e-31 Gene info
ref|ZP_03734184.1|  hypothetical protein CLOM621_04227 [Clostr...   138    8e-31
ref|ZP_02928791.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   138    8e-31
ref|YP_001209872.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   138    8e-31 Gene info
ref|YP_001194159.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   138    8e-31 Gene info
ref|ZP_03956759.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   137    1e-30
ref|YP_002742186.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   137    1e-30 Gene info
ref|YP_002182129.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   137    1e-30 Gene info
ref|ZP_02711316.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   137    1e-30
ref|ZP_01051198.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   137    1e-30
ref|YP_519142.1|  hypothetical protein DSY2909 [Desulfitobacte...   137    1e-30 Gene info
ref|ZP_03634411.1|  hypothetical protein HOLDEFILI_01705 [Hold...   137    2e-30
gb|ABZ89695.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   136    2e-30
ref|ZP_03944874.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   136    3e-30
ref|YP_001843389.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   136    3e-30 Gene info
ref|YP_001296923.1|  UDP-N-acetylmuramoylalanine--D-glutamatel...   135    4e-30 Gene info
ref|ZP_03654425.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   135    5e-30
ref|ZP_02861816.1|  hypothetical protein ANASTE_01026 [Anaerof...   135    5e-30
ref|ZP_02160103.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   135    5e-30
ref|YP_173132.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   135    5e-30 Gene info
ref|ZP_00950256.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   135    5e-30
ref|YP_002729356.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   135    7e-30 Gene info
ref|ZP_03625882.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   135    7e-30
ref|YP_001826931.1|  putative UDP-N-acetylmuramoylalanine-D- g...   135    7e-30 Gene info
ref|ZP_02851147.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   135    7e-30
ref|YP_001740872.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   134    9e-30 Gene info
ref|ZP_02424993.1|  hypothetical protein ALIPUT_01128 [Alistip...   134    9e-30
ref|ZP_02417444.1|  hypothetical protein ANACAC_00008 [Anaeros...   134    9e-30
ref|ZP_03950730.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   134    1e-29
ref|YP_002494298.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   134    1e-29 Gene info
ref|YP_001089164.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   134    1e-29 Gene info
ref|YP_002460510.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   134    1e-29 Gene info
ref|ZP_03729493.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   134    1e-29
ref|ZP_01667716.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   134    1e-29
ref|ZP_01470909.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   134    1e-29
ref|ZP_01802122.1|  hypothetical protein CdifQ_04003093 [Clost...   134    1e-29
ref|YP_002203182.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   133    2e-29 Gene info
ref|ZP_03129771.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   133    2e-29
ref|YP_002136165.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   133    2e-29 Gene info
ref|YP_466972.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   133    2e-29 Gene info
ref|ZP_03880297.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   133    3e-29
ref|ZP_02083083.1|  hypothetical protein CLOBOL_00598 [Clostri...   133    3e-29
ref|YP_815012.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   133    3e-29 Gene info
ref|YP_280657.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   133    3e-29 Gene info
dbj|BAB16028.1|  MurD [Streptococcus pyogenes]                      133    3e-29
ref|NP_269598.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   133    3e-29 Gene info
ref|NP_664980.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   133    3e-29 Gene info
ref|NP_626345.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   133    3e-29 Gene info
ref|ZP_00366481.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   133    3e-29
ref|ZP_03293102.1|  hypothetical protein CLOHIR_01050 [Clostri...   132    3e-29
ref|ZP_03152616.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   132    3e-29
ref|YP_001225707.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   132    3e-29 Gene info
ref|YP_001128170.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   132    3e-29 Gene info
ref|YP_596979.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   132    3e-29 Gene info
ref|NP_607610.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   132    3e-29 Gene info
ref|ZP_03959059.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   132    4e-29
ref|ZP_03717305.1|  hypothetical protein EUBHAL_02383 [Eubacte...   132    4e-29
ref|YP_602855.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   132    4e-29 Gene info
ref|YP_001037466.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   132    4e-29 Gene info
ref|ZP_02992329.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   132    6e-29
ref|YP_289169.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   132    6e-29 Gene info
ref|YP_002730413.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   131    7e-29 Gene info
ref|ZP_02210397.1|  hypothetical protein CLOBAR_02805 [Clostri...   131    7e-29
ref|ZP_01967278.1|  hypothetical protein RUMTOR_00824 [Ruminoc...   131    7e-29
ref|YP_001685294.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   131    7e-29 Gene info
ref|ZP_03929935.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   131    1e-28
ref|ZP_03799202.1|  hypothetical protein COPCOM_01459 [Coproco...   131    1e-28
gb|ABV90250.2|  sporulation protein A [Bacillus subtilis subsp...   131    1e-28
ref|YP_924254.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    1e-28 Gene info
ref|NP_896625.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    1e-28 Gene info
ref|NP_389403.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   131    1e-28 Gene info
ref|YP_001919625.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   130    1e-28 Gene info
ref|ZP_01460029.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   130    1e-28
ref|ZP_03074365.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   130    1e-28
ref|ZP_03974925.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   130    1e-28
ref|NP_964826.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   130    1e-28 Gene info
ref|YP_001271193.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   130    1e-28 Gene info
ref|ZP_03759655.1|  hypothetical protein CLOSTASPAR_03681 [Clo...   130    2e-28
ref|YP_002249134.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   130    2e-28 Gene info
ref|ZP_02691978.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   130    2e-28
ref|ZP_01719577.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   130    2e-28
ref|YP_712422.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   130    2e-28 Gene info
ref|YP_001392870.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   130    2e-28 Gene info
ref|YP_001375791.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   130    2e-28 Gene info
ref|ZP_01122928.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   130    2e-28
ref|YP_001956126.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   129    3e-28 Gene info
ref|ZP_01751124.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    3e-28
ref|NP_969962.1|  hypothetical protein Bd3200 [Bdellovibrio ba...   129    3e-28 Gene info
ref|NP_421359.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   129    3e-28 Gene info
ref|ZP_02618260.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    4e-28
ref|ZP_01890991.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   129    4e-28
ref|YP_001255998.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   129    4e-28 Gene info
ref|ZP_01696998.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    4e-28
emb|CAA45555.1|  UDP-N-acetylmuramoylalanine--D-glutamate liga...   129    4e-28
ref|NP_827296.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   129    4e-28 Gene info
ref|NP_243433.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   129    4e-28 Gene info
ref|YP_001646536.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   129    4e-28 Gene info
ref|ZP_03914000.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    5e-28
ref|ZP_03783127.1|  hypothetical protein RUMHYD_02594 [Blautia...   129    5e-28
sp|Q5YYY1.2|MURD_NOCFA  RecName: Full=UDP-N-acetylmuramoylalan...   129    5e-28
ref|YP_117974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   129    5e-28 Gene info
ref|ZP_00786534.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   129    5e-28
ref|YP_818961.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   129    5e-28 Gene info
ref|ZP_01771359.1|  Hypothetical protein COLAER_00338 [Collins...   128    6e-28
ref|YP_877138.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   128    6e-28 Gene info
ref|NP_441033.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   128    6e-28 Gene info
ref|ZP_01003751.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   128    6e-28
ref|YP_002806064.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutama...   128    8e-28
ref|ZP_02636844.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   128    8e-28
ref|ZP_02951239.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   128    8e-28
ref|ZP_02615649.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   128    8e-28
ref|YP_697147.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   128    8e-28 Gene info
ref|YP_001559575.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   128    8e-28 Gene info
ref|YP_001320690.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   128    8e-28 Gene info
ref|YP_002353141.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   127    1e-27 Gene info
ref|YP_002447477.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    1e-27 Gene info
ref|YP_001876397.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   127    1e-27 Gene info
ref|ZP_02036409.1|  hypothetical protein BACCAP_02011 [Bactero...   127    1e-27
ref|YP_496410.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   127    1e-27 Gene info
ref|ZP_03885903.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   127    1e-27
ref|YP_001783157.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    1e-27 Gene info
ref|YP_001393592.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   127    1e-27 Gene info
ref|YP_744252.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   127    1e-27 Gene info
ref|NP_349791.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   127    1e-27 Gene info
ref|ZP_01172482.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   127    1e-27
ref|YP_001884427.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    2e-27 Gene info
ref|YP_001917473.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   127    2e-27 Gene info
ref|ZP_02027535.1|  hypothetical protein EUBVEN_02810 [Eubacte...   127    2e-27
ref|ZP_01551757.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   127    2e-27
ref|NP_601362.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   127    2e-27 Gene info
ref|ZP_02643844.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   126    2e-27
ref|ZP_02234020.1|  hypothetical protein DORFOR_00877 [Dorea f...   126    2e-27
ref|ZP_02176898.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   126    2e-27
ref|ZP_03335273.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   126    3e-27
ref|YP_002481552.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   126    3e-27 Gene info
ref|YP_001975309.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   126    3e-27 Gene info
ref|YP_001788857.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   126    3e-27 Gene info
ref|ZP_02864191.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   126    3e-27
ref|ZP_02093537.1|  hypothetical protein PEPMIC_00288 [Peptost...   126    3e-27
ref|YP_001421100.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   126    3e-27 Gene info
ref|ZP_01864518.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   126    3e-27
ref|YP_001138943.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   126    3e-27 Gene info
ref|YP_699716.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   126    3e-27 Gene info
ref|NP_833632.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   126    3e-27 Gene info
ref|YP_002349497.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    4e-27 Gene info
ref|YP_002663907.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    4e-27 Gene info
ref|ZP_02993974.1|  hypothetical protein CLOSPO_01076 [Clostri...   125    4e-27
ref|ZP_03232111.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    4e-27
ref|ZP_02171866.1|  S-layer domain protein [Bacillus selenitir...   125    4e-27
ref|YP_457246.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   125    4e-27 Gene info
ref|ZP_00744396.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    4e-27
ref|ZP_03937712.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   125    5e-27
ref|YP_002599054.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    5e-27 Gene info
ref|YP_002131164.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    5e-27 Gene info
ref|YP_001855337.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    5e-27 Gene info
ref|ZP_02621695.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    5e-27
ref|YP_001381045.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   125    5e-27 Gene info
ref|NP_738665.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   125    5e-27 Gene info
ref|YP_014661.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   125    5e-27 Gene info
ref|YP_644269.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   125    5e-27 Gene info
ref|ZP_03909166.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   125    7e-27
ref|ZP_02430895.1|  hypothetical protein CLOSCI_01110 [Clostri...   125    7e-27
ref|YP_378375.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   125    7e-27 Gene info
ref|YP_078913.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   125    7e-27 Gene info
ref|NP_563375.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   125    7e-27 Gene info
ref|ZP_03939428.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   124    9e-27
ref|ZP_03942272.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   124    9e-27
ref|ZP_02216910.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   124    9e-27
ref|XP_001772045.1|  predicted protein [Physcomitrella patens ...   124    9e-27 UniGene infoGene info
ref|ZP_03666863.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   124    1e-26
ref|ZP_03287954.1|  hypothetical protein CLONEX_00133 [Clostri...   124    1e-26
ref|ZP_03167639.1|  hypothetical protein RUMLAC_01313 [Ruminoc...   124    1e-26
ref|ZP_02632859.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   124    1e-26
ref|YP_001625636.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   124    1e-26 Gene info
ref|ZP_02042460.1|  hypothetical protein RUMGNA_03262 [Ruminoc...   124    1e-26
ref|YP_850247.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   124    1e-26 Gene info
ref|NP_846291.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   124    1e-26 Gene info
ref|NP_465560.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   124    1e-26 Gene info
ref|ZP_00236823.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   124    1e-26
ref|ZP_03857775.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   124    2e-26
ref|ZP_03682095.1|  hypothetical protein CATMIT_00726 [Catenib...   124    2e-26
ref|YP_001930613.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   124    2e-26 Gene info
ref|ZP_02076068.1|  hypothetical protein CLOL250_02856 [Clostr...   124    2e-26
ref|ZP_03980506.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   123    2e-26
ref|YP_001042662.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   123    2e-26 Gene info
ref|YP_723942.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   123    2e-26 Gene info
ref|ZP_02440777.1|  hypothetical protein ANACOL_00041 [Anaerot...   123    3e-26
ref|YP_001228103.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   123    3e-26 Gene info
ref|YP_001131265.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   123    3e-26 Gene info
ref|ZP_03866059.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    3e-26
ref|ZP_03777685.1|  hypothetical protein CLOHYLEM_04738 [Clost...   122    3e-26
ref|YP_002531415.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   122    3e-26 Gene info
ref|YP_002049324.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   122    3e-26 Gene info
ref|ZP_02181935.1|  putative UDP-N-acetylmuramoylalanine--D-gl...   122    3e-26
ref|YP_055470.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    3e-26 Gene info
ref|YP_037974.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    3e-26 Gene info
ref|YP_001551297.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   122    3e-26 Gene info
ref|ZP_03954094.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   122    4e-26
ref|ZP_03387891.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    4e-26
ref|ZP_03113156.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   122    4e-26
ref|YP_888506.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    4e-26 Gene info
ref|YP_804683.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   122    4e-26 Gene info
ref|YP_352159.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   122    4e-26 Gene info
ref|NP_980253.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    4e-26 Gene info
ref|YP_872767.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   122    4e-26 Gene info
ref|YP_001166901.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   122    4e-26 Gene info
ref|ZP_03927811.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   122    6e-26
ref|YP_002524774.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   122    6e-26 Gene info
ref|YP_001960899.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   122    6e-26 Gene info
ref|YP_001655971.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   122    6e-26 Gene info
ref|YP_011718.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   122    6e-26 Gene info
ref|NP_267746.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   122    6e-26 Gene info
ref|YP_002720366.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   121    8e-26 Gene info
ref|YP_002683332.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   121    8e-26 Gene info
ref|ZP_03237644.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   121    8e-26
ref|ZP_03921465.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   121    1e-25
ref|YP_001134251.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   121    1e-25 Gene info
ref|YP_731457.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   121    1e-25 Gene info
ref|YP_190605.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   121    1e-25 Gene info
sp|Q5FUJ7.2|MURD_GLUOX  RecName: Full=UDP-N-acetylmuramoylalan...   121    1e-25
emb|CAO86897.1|  murD [Microcystis aeruginosa PCC 7806]             120    1e-25
ref|YP_220221.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    1e-25 Gene info
ref|ZP_00602978.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   120    1e-25
ref|ZP_03946426.1|  possible UDP-N-acetylmuramoyl-L-alanine--D...   120    2e-25
ref|YP_001515864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   120    2e-25 Gene info
ref|ZP_01875641.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   120    2e-25
ref|NP_471476.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   120    2e-25 Gene info
ref|NP_214421.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   120    2e-25 Gene info
gb|EEH99494.1|  UDP-N-acetylmuramoylalanine-D-glutamate ligase...   120    2e-25
ref|YP_002380383.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   120    2e-25 Gene info
ref|YP_002016913.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   120    2e-25 Gene info
ref|YP_002589729.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   119    3e-25 Gene info
ref|YP_002288238.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   119    3e-25 Gene info
ref|ZP_02080566.1|  hypothetical protein CLOLEP_02021 [Clostri...   119    3e-25
ref|YP_001413685.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   119    3e-25 Gene info
ref|YP_757310.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    3e-25 Gene info
ref|YP_032500.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    3e-25 Gene info
ref|NP_785693.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    3e-25 Gene info
sp|O07669.1|MURD_ENTHR  RecName: Full=UDP-N-acetylmuramoylalan...   119    4e-25
ref|ZP_01084053.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   119    4e-25
ref|YP_001814431.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   119    4e-25 Gene info
ref|YP_002773320.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   119    5e-25 Gene info
ref|ZP_03567858.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   119    5e-25
ref|ZP_03331268.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   119    5e-25
ref|ZP_01962464.1|  hypothetical protein RUMOBE_00177 [Ruminoc...   119    5e-25
ref|YP_480519.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   119    5e-25 Gene info
ref|NP_220791.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   119    5e-25 Gene info
ref|YP_001492386.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   118    6e-25 Gene info
ref|YP_002633090.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   118    8e-25 Gene info
ref|ZP_02139581.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   118    8e-25
ref|ZP_02184967.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   118    8e-25
ref|ZP_01621387.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   118    8e-25
ref|YP_292123.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   118    8e-25 Gene info
ref|NP_893481.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   118    8e-25 Gene info
ref|YP_001634385.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   118    8e-25 Gene info
gb|EEH91384.1|  UDP-N-acetylmuramoylalanine-D-glutamate ligase...   117    1e-24
ref|ZP_03273840.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   117    1e-24
ref|ZP_02437899.1|  hypothetical protein CLOSS21_00337 [Clostr...   117    1e-24
ref|ZP_02084266.1|  hypothetical protein CLOBOL_01791 [Clostri...   117    1e-24
ref|YP_001307253.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   117    1e-24 Gene info
ref|ZP_02208070.1|  hypothetical protein COPEUT_02897 [Coproco...   117    1e-24
ref|YP_008250.1|  putative UDP-N-acetylmuramoylalanine-D-gluta...   117    1e-24 Gene info
ref|YP_001009956.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   117    2e-24 Gene info
ref|YP_570521.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   117    2e-24 Gene info
ref|ZP_03709117.1|  hypothetical protein CLOSTMETH_03879 [Clos...   116    2e-24
ref|ZP_03142040.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   116    2e-24
ref|YP_001484793.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   116    2e-24 Gene info
ref|YP_001470267.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   116    2e-24 Gene info
ref|YP_485611.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   116    2e-24 Gene info
ref|YP_067355.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   116    2e-24 Gene info
ref|YP_809615.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   116    2e-24 Gene info
ref|YP_002714049.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   116    3e-24 Gene info
ref|YP_001032238.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   116    3e-24 Gene info
ref|ZP_01442457.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   116    3e-24
ref|YP_001495908.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   116    3e-24 Gene info
ref|YP_633745.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   116    3e-24 Gene info
ref|YP_002674566.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   115    4e-24 Gene info
ref|XP_001786928.1|  predicted protein [Physcomitrella patens ...   115    4e-24 Gene info
ref|YP_683543.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   115    4e-24 Gene info
ref|ZP_01155385.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    4e-24
ref|ZP_03766237.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   115    5e-24
ref|YP_002691696.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   115    5e-24 Gene info
ref|ZP_03053400.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    5e-24
ref|ZP_01862239.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   115    5e-24
ref|YP_001091775.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   115    5e-24 Gene info
ref|ZP_01450557.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   115    5e-24
ref|YP_382447.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   115    5e-24 Gene info
ref|ZP_00630126.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   115    5e-24 Gene info
ref|ZP_03752838.1|  hypothetical protein ROSEINA2194_01242 [Ro...   115    7e-24
emb|CAO23528.1|  unnamed protein product [Vitis vinifera]           115    7e-24
ref|YP_001016538.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   115    7e-24 Gene info
ref|YP_538051.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   115    7e-24 Gene info
ref|YP_033898.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   115    7e-24 Gene info
ref|YP_532065.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   115    7e-24 Gene info
ref|ZP_03467060.1|  UDP-N-acetylmuramoylalanine/D-glutamate li...   114    9e-24
ref|ZP_01974910.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   114    9e-24
ref|NP_926678.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   114    9e-24 Gene info
ref|ZP_03323684.1|  hypothetical protein BIFCAT_00454 [Bifidob...   114    1e-23
ref|YP_001609927.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   114    1e-23 Gene info
ref|YP_001015606.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   114    1e-23 Gene info
ref|YP_001011843.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   114    1e-23 Gene info
ref|YP_701075.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   114    1e-23 Gene info
ref|ZP_00994834.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   114    1e-23
ref|YP_781029.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   114    1e-23 Gene info
ref|ZP_00394198.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   114    1e-23
ref|ZP_03310483.1|  hypothetical protein DESPIG_00368 [Desulfo...   114    2e-23
ref|YP_246650.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   114    2e-23 Gene info
ref|YP_002521317.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   113    2e-23 Gene info
gb|EDZ38616.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   113    2e-23
ref|YP_001207548.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   113    2e-23 Gene info
ref|ZP_03947965.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   113    3e-23
ref|YP_002672429.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   113    3e-23 Gene info
ref|YP_002619029.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   113    3e-23 Gene info
ref|YP_761703.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   113    3e-23 Gene info
gb|AAT38528.1|  MurD [Bartonella bacilliformis]                     113    3e-23
ref|YP_002508658.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   113    3e-23 Gene info
ref|YP_001734110.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   112    4e-23 Gene info
ref|YP_001727805.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   112    4e-23 Gene info
ref|YP_002464147.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   112    4e-23 Gene info
ref|NP_764413.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    4e-23 Gene info
ref|ZP_03821439.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   112    5e-23
ref|ZP_03156337.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   112    5e-23
ref|XP_002118918.1|  hypothetical protein TRIADDRAFT_62903 [Tr...   112    5e-23 Gene info
ref|YP_397957.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    5e-23 Gene info
ref|YP_188331.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    5e-23 Gene info
ref|ZP_01045956.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   112    5e-23
ref|ZP_00955215.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   112    5e-23
ref|ZP_03933327.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   112    6e-23
ref|ZP_02427862.1|  hypothetical protein CLORAM_01250 [Clostri...   112    6e-23
ref|NP_780924.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    6e-23 Gene info
sp|Q899G5.2|MURD_CLOTE  RecName: Full=UDP-N-acetylmuramoylalan...   112    6e-23
ref|NP_948870.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    6e-23 Gene info
ref|NP_895261.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    6e-23 Gene info
ref|NP_680864.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   112    6e-23 Gene info
ref|YP_810708.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   112    6e-23 Gene info
ref|YP_001702740.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   111    8e-23 Gene info
ref|ZP_02077808.1|  hypothetical protein EUBDOL_01607 [Eubacte...   111    8e-23
ref|YP_001486656.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   111    8e-23 Gene info
gb|EAY57399.1|  UDP-N-acetylmuramoylalanine-D-glutamate ligase...   111    8e-23
ref|NP_814729.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   111    8e-23 Gene info
ref|ZP_01131167.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   111    8e-23
ref|ZP_00962714.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   111    8e-23
ref|ZP_00517092.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   111    8e-23
ref|YP_002778010.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   111    1e-22 Gene info
ref|YP_002334300.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   111    1e-22 Gene info
ref|ZP_01903054.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   111    1e-22
ref|YP_954326.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   111    1e-22 Gene info
ref|YP_515066.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   111    1e-22 Gene info
ref|ZP_03742444.1|  hypothetical protein BIFPSEUDO_03016 [Bifi...   110    1e-22
ref|ZP_02300693.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   110    1e-22 Gene info
ref|ZP_01628939.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   110    1e-22
ref|YP_002506057.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   110    1e-22 Gene info
ref|YP_510705.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   110    1e-22 Gene info
ref|ZP_00999924.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   110    1e-22
ref|ZP_03903059.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   110    2e-22
ref|YP_002767001.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|YP_909966.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   110    2e-22 Gene info
ref|YP_001533786.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|ZP_01226108.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   110    2e-22
ref|YP_002633891.1|  putative UDP-N-acetylmuramoylalanine--D-g...   110    2e-22 Gene info
ref|YP_002563314.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|YP_002322334.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   110    2e-22 Gene info
ref|YP_321312.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    2e-22 Gene info
ref|YP_153605.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   110    2e-22 Gene info
ref|NP_875830.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   110    2e-22 Gene info
gb|ACP25872.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...   109    3e-22
gb|AAC45635.1|  D-glutamic acid adding enzyme [Enterococcus fa...   109    3e-22
ref|ZP_03648718.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   109    4e-22
ref|ZP_03488805.1|  hypothetical protein EUBIFOR_01387 [Eubact...   109    4e-22
ref|YP_001954123.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   109    4e-22 Gene info
ref|ZP_01879210.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   109    4e-22
ref|NP_488152.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   109    4e-22 Gene info
ref|NP_696485.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   109    4e-22 Gene info
ref|ZP_00120691.2|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   109    4e-22
ref|YP_002550095.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   108    5e-22 Gene info
ref|YP_002703109.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   108    5e-22 Gene info
ref|YP_001801657.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   108    5e-22 Gene info
ref|ZP_01014228.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   108    5e-22
ref|YP_001628093.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   108    7e-22 Gene info
ref|ZP_02029743.1|  hypothetical protein BIFADO_02203 [Bifidob...   108    7e-22
ref|ZP_01721964.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   108    7e-22
ref|ZP_01437832.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   108    7e-22
ref|YP_166434.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   108    7e-22 Gene info
ref|ZP_03973181.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   108    9e-22
ref|YP_376536.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   108    9e-22 Gene info
ref|ZP_01038279.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   108    9e-22
ref|ZP_03978960.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   107    1e-21
ref|ZP_03775323.1|  hypothetical protein SUBVAR_01862 [Subdoli...   107    1e-21
ref|ZP_03711116.1|  hypothetical protein CORMATOL_01956 [Coryn...   107    1e-21
ref|YP_002609768.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   107    1e-21 Gene info
ref|ZP_02868078.1|  hypothetical protein CLOSPI_01919 [Clostri...   107    1e-21
ref|YP_001233209.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   107    1e-21 Gene info
ref|ZP_03785920.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   107    1e-21
ref|ZP_01468536.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   107    1e-21
ref|YP_222119.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    1e-21 Gene info
ref|NP_698431.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   107    1e-21 Gene info
ref|ZP_01056262.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   107    1e-21
ref|YP_001242006.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   107    1e-21 Gene info
ref|ZP_03655365.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   107    2e-21
ref|YP_612674.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   107    2e-21 Gene info
ref|YP_001867331.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   107    2e-21 Gene info
ref|YP_002760938.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   106    3e-21 Gene info
ref|ZP_03613774.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   106    3e-21
ref|NP_539494.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   106    3e-21 Gene info
ref|ZP_03918843.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   106    3e-21
ref|ZP_03393407.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   106    3e-21
ref|ZP_01742459.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   106    3e-21
ref|YP_001244286.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   106    3e-21 Gene info
ref|YP_881538.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   106    3e-21 Gene info
ref|YP_576562.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   106    3e-21 Gene info
ref|YP_317663.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   106    3e-21 Gene info
ref|ZP_01079491.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   106    3e-21
ref|YP_002697935.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   105    4e-21 Gene info
ref|YP_476553.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   105    4e-21 Gene info
ref|NP_386284.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   105    4e-21 Gene info
ref|ZP_00054273.1|  COG0771: UDP-N-acetylmuramoylalanine-D-glu...   105    4e-21
ref|ZP_03924962.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   105    6e-21
ref|YP_001710098.1|  UDP-N-acetylmuramoylalanine-D-glutamate l...   105    6e-21 Gene info
ref|ZP_02422163.1|  hypothetical protein EUBSIR_01004 [Eubacte...   105    6e-21
ref|YP_001222603.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...   105    6e-21 Gene info
ref|ZP_01756971.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   105    6e-21
ref|ZP_00958186.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   105    6e-21
ref|ZP_03934740.1|  UDP-N-acetylmuramoyl-L-alanine--D-glutamat...   105    7e-21
ref|ZP_01732018.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   105    7e-21
ref|YP_002282093.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   104    1e-20 Gene info
ref|ZP_02146127.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   104    1e-20
ref|ZP_02148967.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   104    1e-20
ref|NP_773244.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   104    1e-20 Gene info
ref|YP_002165851.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   104    1e-20 Gene info
ref|YP_002687929.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   103    2e-20 Gene info
ref|NP_355061.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    2e-20 Gene info
ref|YP_001362929.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   103    2e-20 Gene info
ref|ZP_01548294.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   103    2e-20
ref|YP_474425.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   103    3e-20 Gene info
ref|NP_604352.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   103    3e-20 Gene info
sp|Q8RDQ1.2|MURD_FUSNN  RecName: Full=UDP-N-acetylmuramoylalan...   103    3e-20
ref|NP_960833.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   102    4e-20 Gene info
gb|ACP33262.1|  UDP-N-acetylmuramoylalanine-D-glutamate ligase...   102    5e-20
ref|YP_002479694.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   102    5e-20 Gene info
ref|YP_253647.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   102    5e-20 Gene info
ref|XP_002277291.1|  PREDICTED: hypothetical protein [Vitis vi...   102    6e-20 Gene info
ref|ZP_03146436.1|  cytoplasmic peptidoglycan synthetase domai...   102    6e-20
ref|YP_001278087.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...   102    6e-20 Gene info
ref|YP_674567.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...   101    8e-20 Gene info
ref|ZP_02002009.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...   101    1e-19
ref|NP_228048.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...   101    1e-19 Gene info
ref|YP_002363734.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...   100    1e-19 Gene info
ref|ZP_02153486.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...   100    1e-19
ref|YP_423209.1|  UDP-N-acetylmuramoylalanine-D-glutamate liga...   100    1e-19 Gene info
ref|ZP_03757101.1|  hypothetical protein CLOSTASPAR_01090 [Clo...   100    2e-19
ref|ZP_00952251.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...   100    2e-19
ref|ZP_03336082.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  99.8    3e-19
ref|ZP_03287106.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  99.8    3e-19
gb|AAN87412.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...  99.4    4e-19
ref|YP_250528.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  99.4    4e-19 Gene info
ref|NP_301695.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  99.4    4e-19 Gene info
ref|ZP_03645961.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  99.0    5e-19
ref|NP_103117.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  99.0    5e-19 Gene info
ref|YP_798619.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  98.6    7e-19 Gene info
ref|YP_062439.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  98.6    7e-19 Gene info
ref|YP_002705.1|  udp-n-acetylmuramoylalanine--d-glutamate lig...  98.6    7e-19 Gene info
ref|NP_216671.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  98.2    9e-19 Gene info
ref|NP_711019.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  98.2    9e-19 Gene info
sp|Q6NGC6.2|MURD_CORDI  RecName: Full=UDP-N-acetylmuramoylalan...  97.8    1e-18
ref|ZP_01745063.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  97.8    1e-18
ref|NP_939942.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  97.8    1e-18 Gene info
ref|ZP_03463924.1|  hypothetical protein BACPEC_03025 [Bactero...  97.1    2e-18
ref|ZP_03372222.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  96.7    3e-18
ref|ZP_03407320.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  96.3    3e-18
ref|ZP_01452795.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  96.3    3e-18
ref|ZP_03425454.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  95.9    4e-18
ref|NP_336684.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  95.9    4e-18 Gene info
ref|NP_855828.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  95.9    4e-18 Gene info
ref|NP_789472.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  95.9    4e-18 Gene info
ref|YP_001831829.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  95.5    6e-18 Gene info
ref|YP_002122177.1|  UDP-N-acetylmuramoylalanine/D-glutamate l...  95.1    8e-18 Gene info
ref|YP_001416747.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  95.1    8e-18 Gene info
ref|YP_001523017.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  94.0    2e-17 Gene info
ref|YP_001546278.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  94.0    2e-17 Gene info
ref|YP_001159820.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  93.2    3e-17 Gene info
ref|ZP_02242481.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  92.4    5e-17
ref|YP_001538027.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate...  91.7    8e-17 Gene info
ref|NP_638086.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  91.3    1e-16 Gene info
ref|NP_787354.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  90.5    2e-16 Gene info
sp|Q83GN2.2|MURD_TROWT  RecName: Full=UDP-N-acetylmuramoylalan...  90.5    2e-16
ref|ZP_00786636.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  90.5    2e-16
ref|YP_200075.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  90.1    2e-16 Gene info
ref|YP_002785144.1|  putative UDP-N-acetylmuramoylalanine--D-g...  89.0    5e-16 Gene info
emb|CAN60311.1|  hypothetical protein [Vitis vinifera]             88.6    7e-16
ref|YP_364784.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  87.4    2e-15 Gene info
ref|NP_643217.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate sy...  87.4    2e-15 Gene info
gb|AAD53938.1|AF179611_22  UDP-N-acetylmuramoyl-L-alanyl-D-glu...  87.0    2e-15
ref|XP_002339832.1|  predicted protein [Populus trichocarpa] >...  86.7    3e-15 Gene info
ref|YP_001568831.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  86.3    4e-15 Gene info
ref|ZP_03527868.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  85.1    8e-15
ref|YP_001971040.1|  putative UDP-N-acetylmuramoylalanine--D-g...  84.7    1e-14 Gene info
ref|YP_002591243.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  84.3    1e-14 Gene info
ref|YP_002708761.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  84.0    2e-14 Gene info
gb|ABE73464.1|  putative UDP-N-acetylmuramoylalanyl-D glutamat...  83.6    2e-14
ref|ZP_03537210.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  83.2    3e-14
ref|YP_265454.1|  UDP-N-acetylmuramoylalanine--D-glutamate lig...  82.8    4e-14 Gene info
ref|ZP_01264808.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  82.4    5e-14
ref|ZP_03375177.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  82.0    7e-14
ref|ZP_03087100.1|  UDP-N-acetylmuramoylalanine--D-glutamate l...  81.6    9e-14
ref|NP_967080.1|  hypothetical protein Bd0052 [Bdellovibrio ba...  81.6    9e-14 Gene info
ref|ZP_03404971.1|  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate ...  81.3    1e-13
ref|YP_001775104.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  80.9    1e-13 Gene info
gb|AAD10535.1|  UDP-N-acetylmuramoylalanine--D-glutamate ligas...  80.9    1e-13
ref|ZP_00652326.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...  80.9    1e-13
ref|YP_001697167.1|  UDP-N-acetylmuramoylalanine--D-glutamate ...  80.5    2e-13 Gene info
ref|ZP_00679938.1|  UDP-N-acetylmuramoylalanine-D-glutamate li...  80.5    2e-13

First alignments:

>ref|YP_313875.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thiobacillus 
denitrificans ATCC 25259]
 sp|Q3SMH5.1|MURD_THIDA Gene info RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|AAZ96070.1| Gene info UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thiobacillus 
denitrificans ATCC 25259]
Length=474

 GENE ID: 3673896 Tbd_0117 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Thiobacillus denitrificans ATCC 25259] (10 or fewer PubMed links)

 Score =  250 bits (639),  Expect = 1e-64
 Identities = 145/307 (47%), Positives = 194/307 (63%), Gaps = 6/307 (1%)
 Frame = -2

Query  916  NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  737
            NGKSTVT M   + +  GL     GNIG+PVL+ L +IE+ A  +P V+VLE+SSFQ++T
Sbjct  136  NGKSTVTAMCGDMCRMAGLTVCVAGNIGLPVLDALHEIEQGAAPLPQVWVLELSSFQLET  195

Query  736  TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVL-NEIAGED  560
            T S +  AA VLN+SEDH+DRY D  AY  +K RI SG G++V+NRD+P  L   I G  
Sbjct  196  TSSLDATAAAVLNLSEDHMDRYPDMAAYAAAKARIFSGNGVQVLNRDDPRTLAMAIPGRH  255

Query  559  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  380
             VSFGL     D ++G+     E  +  G   +     L V G+HN  NA+AALAL+  L
Sbjct  256  VVSFGLDRCPTDENFGLC----EDELCLGGDMLMPLSVLAVPGLHNAANALAALALTRAL  311

Query  379  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGL-PAKCVLLL  203
                E  +RGL+ ++GL HR++ VADI GV +Y+DSK TNVGAT AA+ G+   K V++L
Sbjct  312  DLPIEALLRGLMHFKGLPHRVEKVADIDGVTWYDDSKGTNVGATEAALYGMGRRKAVVIL  371

Query  202  GGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQL  23
            GG+ K Q+F  L   +    R VVL+GRDA  I+  IE +GV    A  L +AV+ AA+L
Sbjct  372  GGDGKGQDFGPLKAAVAANARAVVLIGRDAVAIEAAIEDSGVASYRADTLPDAVEQAARL  431

Query  22   AEPGEIV  2
            AEPG+ V
Sbjct  432  AEPGDAV  438


>ref|YP_546379.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacillus 
flagellatus KT]
 sp|Q1GYZ9.1|MURD_METFK Gene info RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|ABE50538.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacillus 
flagellatus KT]
Length=453

 GENE ID: 4001365 Mfla_2271 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Methylobacillus flagellatus KT] (10 or fewer PubMed links)

 Score =  245 bits (626),  Expect = 4e-63
 Identities = 137/306 (44%), Positives = 189/306 (61%), Gaps = 8/306 (2%)
 Frame = -2

Query  916  NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  737
            NGKSTVT +V  I +  G   V  GNIG+PVL+V+           DV+VLE+SSFQ++T
Sbjct  119  NGKSTVTTLVGEICKAAGFKTVVAGNIGLPVLDVINDAV-------DVYVLELSSFQLET  171

Query  736  TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEIA-GED  560
            TYS   DAA VLN+S DH+DRY D  AY  +K RI +  G++V+N D+       A G  
Sbjct  172  TYSLAADAATVLNISADHMDRYADMQAYANAKARIFTRAGLQVLNADDAWSRGMAAEGVA  231

Query  559  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  380
             ++FGL  P + + +G+   AGE W+A G +++    DL ++G+HN  NA+AALAL + L
Sbjct  232  QLTFGLDAPRSAQDFGLLHDAGEAWLARGQRKLMPVADLNITGLHNAANALAALALCTVL  291

Query  379  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLG  200
                  A++ L  ++GL HR+QWVADI GV FY+DSK TNVGAT AA+ GL  K VL+ G
Sbjct  292  DIDEVVALQALRDFKGLPHRVQWVADIDGVSFYDDSKGTNVGATVAALHGLNRKLVLIAG  351

Query  199  GESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLA  20
            G+ K Q+F  L   + +  R VVL+GRDA +I   ++ +GV +     L  AV  A  LA
Sbjct  352  GDGKGQDFAALRAPVAKHARAVVLIGRDAGVIADALQESGVLLEYGDTLEEAVVKAFNLA  411

Query  19   EPGEIV  2
            + G+ V
Sbjct  412  DRGDAV  417


>ref|YP_932386.1| Gene info UDP-N-acetylmuramoylalanine-D-glutamate ligase [Azoarcus sp. 
BH72]
 emb|CAL93499.1| Gene info probable UDP-N-acetylmuramoylalanine-D-glutamate ligase [Azoarcus 
sp. BH72]
Length=472

 GENE ID: 4609269 murD | UDP-N-acetylmuramoylalanine-D-glutamate ligase
[Azoarcus sp. BH72] (10 or fewer PubMed links)

 Score =  243 bits (620),  Expect = 2e-62
 Identities = 135/308 (43%), Positives = 186/308 (60%), Gaps = 3/308 (0%)
 Frame = -2

Query  916  NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  737
            NGK+T T +   + Q  GLDAVA GNI    L+VL       + +P  +VLE+SSFQI+T
Sbjct  130  NGKTTTTALTAALAQSAGLDAVAAGNISPAALDVLMARLDAGQALPQCWVLELSSFQIET  189

Query  736  TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNR-DEPIVLNEIAGED  560
              + + DAA VLNV++DHLDRY D   Y  +K RI  GRG +V+NR D  +    ++G  
Sbjct  190  AQALDADAATVLNVTDDHLDRYADLADYAATKARIFQGRGAQVLNREDARVAAMVLSGRK  249

Query  559  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSST-  383
             V FG   P N   +G+ + AG  W+  G +++   ++L ++G HN  NA+AALAL  T 
Sbjct  250  VVRFGTDAPQNPADYGLVEDAGRCWLVRGGERLLALDELALAGRHNAANALAALALCETG  309

Query  382  LVSVNEDAIRGLLSYEGLDHRMQWVAD-ISGVQFYNDSKATNVGATAAAISGLPAKCVLL  206
            L       + GL ++ GL HR++ VA+   GV++Y+DSK TNVGAT AA+ GL  + VL+
Sbjct  310  LGLAPAQLLAGLRAFRGLPHRVELVAERADGVRYYDDSKGTNVGATVAALDGLGGRVVLI  369

Query  205  LGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQ  26
             GG+ K Q+F  L   +    R VVL+GRDAKLI+  + G GV +  AADL  AV  A  
Sbjct  370  AGGDGKGQDFSPLAPVLTRHARAVVLIGRDAKLIEAAVAGCGVPLEHAADLDTAVLRANA  429

Query  25   LAEPGEIV  2
            LA PG+ V
Sbjct  430  LARPGDAV  437


>ref|ZP_03699179.1|  UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella nitroferrum 
2002]
 gb|EEG07893.1|  UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella nitroferrum 
2002]
Length=455

 Score =  242 bits (617),  Expect = 4e-62
 Identities = 130/306 (42%), Positives = 192/306 (62%), Gaps = 5/306 (1%)
 Frame = -2

Query  916  NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  737
            NGKSTVT +V  + ++ GLD V  GNIG+PVL+ L + E   ++ PDV+VLE+SSFQ++T
Sbjct  119  NGKSTVTSLVGHLCRQAGLDTVLAGNIGLPVLDALGEREASGKR-PDVWVLELSSFQLET  177

Query  736  TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSGRGIKVVNRDEPIVLNEIA-GED  560
            T S   DAA VLN+SEDHLDRY D   Y  SK  + +GRG++V+NRD+ +V   +  G  
Sbjct  178  TTSLNADAATVLNISEDHLDRYADLLDYAHSKTAVFNGRGVQVLNRDDALVRAMVRPGHA  237

Query  559  SVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSSTL  380
               F L        + + + AG  W+    + +F C ++ + G+HN  NA+AALAL+  +
Sbjct  238  QRWFSLK---ETADYALRQDAGRYWLTVAGEAVFDCAEMSLQGLHNAANALAALALTEAI  294

Query  379  VSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLLLG  200
                   + GL ++ GL HR+++VA++ GV++ +DSK TNVGAT AA++G+    VL+ G
Sbjct  295  GLPRAALLEGLKTFTGLAHRVEFVAEVHGVRYIDDSKGTNVGATEAALNGMTRPVVLIAG  354

Query  199  GESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQLA  20
            G+ K Q+F  L        R V+L+GRDA  I+  +EG  + I+D A L  A + AA+LA
Sbjct  355  GDGKGQDFSPLKPACARIARAVLLIGRDAGKIRAVLEGLPLPIVDCATLEEATREAARLA  414

Query  19   EPGEIV  2
            E G++V
Sbjct  415  EAGDVV  420


>ref|YP_413177.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosospira 
multiformis ATCC 25196]
 sp|Q2Y636.1|MURD_NITMU  RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; 
AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; 
AltName: Full=D-glutamic acid-adding enzyme
 gb|ABB75785.1| Gene info UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrosospira 
multiformis ATCC 25196]
Length=473

 GENE ID: 3786755 Nmul_A2496 | UDP-N-acetylmuramoylalanine--D-glutamate ligase
[Nitrosospira multiformis ATCC 25196]

 Score =  233 bits (593),  Expect = 2e-59
 Identities = 134/308 (43%), Positives = 183/308 (59%), Gaps = 4/308 (1%)
 Frame = -2

Query  916  NGKSTVTRMVERILQECGLDAVAVGNIGVPVLEVLEQIERRARKMPDVFVLEMSSFQIDT  737
            NGK+TVT M   +L++ G D    GNIG  VL+ L + E    KMP  +VLE+SSFQ++T
Sbjct  122  NGKTTVTAMTGAMLKKAGWDVEVAGNIGPAVLDALMRREDTG-KMPQAWVLELSSFQLET  180

Query  736  TYSFECDAAVVLNVSEDHLDRYRDFDAYLRSKCRIHSG--RGIKVVNRDEPIVLN-EIAG  566
            T S   DAA VLNVSEDHLDRY     Y  +K RI  G   G++++N D+P+V    +AG
Sbjct  181  TKSLGLDAAAVLNVSEDHLDRYAGMQEYAAAKARIFLGDSEGVQILNGDDPVVRQMTLAG  240

Query  565  EDSVSFGLSPPDNDRSWGVSKIAGEQWVACGSQQIFRCEDLRVSGMHNVCNAMAALALSS  386
               V+F L+ P +   +G+ +  G+ W+  G  ++    +L ++G HN  NA+AALAL  
Sbjct  241  RPHVTFSLATPQSADDFGLLREGGDTWLMQGDTRLMDARELAITGRHNCANALAALALCR  300

Query  385  TLVSVNEDAIRGLLSYEGLDHRMQWVADISGVQFYNDSKATNVGATAAAISGLPAKCVLL  206
             L    E  ++ L  + GL HR++ VA  SG+ FY+DSK TNVGAT AA+ GL    VL+
Sbjct  301  ALAVPFEPLLQALREFRGLPHRVEKVAAFSGITFYDDSKGTNVGATVAALKGLGQPVVLI  360

Query  205  LGGESKQQNFEILVDYIREKVRVVVLMGRDAKLIKRGIEGAGVDILDAADLINAVQIAAQ  26
             GG+ K QNF  L   I E  R VVL+GRDA+ I   I   GV +  A  +  AV+ + Q
Sbjct  361  AGGDGKAQNFSPLAAPIGEHGRAVVLIGRDAEKIAVAINECGVPLHRAQTMEEAVRKSFQ  420

Query  25   LAEPGEIV  2
            LA  G+ V
Sbjct  421  LAREGDAV  428
...
..
.