GOS 714010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092963660359
Annotathon code: GOS_714010
Sample :
  • GPS :17°28'33s; 149°48'44w
  • Polynesia Archipelagos: Moorea, Cooks Bay - Fr. Polynesia
  • Coral Reef (-1.4m, 28.9°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : m2a
Annotated on : 2009-02-07 16:59:39
  • Agen Marina
  • Gonté Aymeric

Synopsis

  • Taxonomy: marine metagenome (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 408172
    Kingdom: - Phylum: - Class: - Order:
    unclassified sequences; metagenomes; ecological metagenomes;

Genomic Sequence

>JCVI_READ_1092963660359 GOS_714010 genomic DNA
ATTTAGATTCACTCTATAATAGGAATTGGTGGAAACCAAATAAATCAATGTCAGAATATATTACAGATAGATATGGTGAAAATGGACTTATGGGAAATGG
AGATTTTCATCCAAATAGTGGTGGTCAAAGATACTTTTATGAAACAATAATTAAAAAACTTTTAGAACCAGAATTAATATGAGAGAATACTTACCAACTT
TAGGTGAATTAATTGATAGACTTACTATATGTCAATTAAAAGAAGTTAAAATACCAAATAAAAAATCAGAATATGGAAAAGAAATAAAACAAATAGTTTC
TGATATAAATAAAATAATAAATGAATCTGATGACTTAGAATTTGATGGTGAGTTGGTACGAGCCATTGTAGTTTTATCTCAAATGAATACTCACATTTGG
GTCAATGAAGATAACGCGAGAAATGGAGATAACCAAGGAAATCAACTTATGTTAACCCATGGTTTAAATGGAATAAGAAATACTGCTAAAAACAAAATAC
AAGAAAAGATTGGAGGTAGAAAGGATTATAAGATAGATTGTTTAGCTTCAGATTTTTCTGATTGGGAGATAAGTTGGGATAAACCAATTGATAATAATAG
ATGGAACGAAACTGTTAAAAATGGAAATCCTGGTGGTTTTGCTTTTCAAGTATTTCAGAAAAAAGATTCTGACTTTCAAATTATAACAACTGCGAAGTGT
GGAACAAGATGGTTGGATAGTATTACAGGATTTGATAGAGCTAATGTTAAAACAAAACAAATATCATCAAATTTTTGGCATTTATGGATGAGTGAAAATG
AAAGGTGGAGATGGTTTCAAATTGAAATGCCTTATGAATATCAAGTTC

Translation

[155 - 847/848]   direct strand
>GOS_714010 Translation [155-847   direct strand]
KTFRTRINMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVRAIVVLSQMNTHIWVNEDNARNGDNQGNQLML
THGLNGIRNTAKNKIQEKIGGRKDYKIDCLASDFSDWEISWDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTAKCGTRWLDSITGFDRANVKT
KQISSNFWHLWMSENERWRWFQIEMPYEYQV

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

PROTOCOLE:
a) Infobiogen / Alignement multiple / format phylip / méthode protpars 
b) Infobiogen / Alignement multiple / format phylip / méthode NJ

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS: 
La première méthode nous a fourni deux arbres présentant une différence au niveau de la branche 
numéro 9 pour le deuxième et au niveau de la branche numéro 9,11,12 pour le premier. La méthode NJ 
nous donne un arbre se basant sur la vitesse d'évolution des espèces.Nous pouvons constater que 
notre séquence à rapidement évoluer.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a) Arbre(s) issus de protpars :

Protein parsimony algorithm, version 3.6a2.1



     2 trees in all found




                                                           +-----gi|1438868
        +-------------------------------------------------13  
        !                                                  !  +--gi|1394450
        !                                                  +--4  
        !                                                     +--gi|1432263
        !  
        !                                                     +--gi|1425809
     +--3        +-------------------------------------------14  
     !  !        !                                            +--gi|1361673
     !  !        !  
     !  !        !                                         +-----gi|1387217
     !  !        !     +-----------------------------------7  
     !  !        !     !                                   !  +--gi|1414257
     !  !        !     !                                   +--6  
     !  +--------8     !                                      +--gi|1395777
     !           !     !  
     !           !     !                             +-----------gi|1439437
     !           !     !                       +----19  
     !           !     !                       !     !  +--------gi|1408007
     !           !     !                       !     +-21  
     !           !     !                       !        !  +-----gi|1399122
     !           +-----5                       !        +-20  
     !                 !              +-------17           !  +--gi|1362836
  +--2                 !              !        !           +-18  
  !  !                 !              !        !              +--gi|1430509
  !  !                 !              !        !  
  !  !                 !        +----15        !              +--gi|1374244
  !  !                 !        !     !        +-------------16  
  !  !                 !        !     !                       +--GOS_714010
  !  !                 !        !     !  
  !  !                 !        !     !                    +-----gi|1415340
  !  !                 +-------10     +-------------------11  
  1  !                          !                          !  +--gi|1423477
  !  !                          !                          +-12  
  !  !                          !                             +--gi|1346183
  !  !                          !  
  !  !                          !                             +--gi|1422977
  !  !                          +-----------------------------9  
  !  !                                                        +--gi|1414435
  !  !  
  !  +-----------------------------------------------------------gi|1397082
  !  
  +--------------------------------------------------------------gi|1390241

  remember: this is an unrooted tree!







                                                           +-----gi|1438868
        +-------------------------------------------------13  
        !                                                  !  +--gi|1394450
        !                                                  +--4  
        !                                                     +--gi|1432263
        !  
        !                                                     +--gi|1425809
        !        +-------------------------------------------14  
        !        !                                            +--gi|1361673
     +--3        !  
     !  !        !                                   +-----------gi|1439437
     !  !        !                             +----19  
     !  !        !                             !     !  +--------gi|1408007
     !  !        !                             !     +-21  
     !  !        !                             !        !  +-----gi|1399122
     !  !        !                             !        +-20  
     !  !        !                    +-------17           !  +--gi|1362836
     !  +--------8                    !        !           +-18  
     !           !                    !        !              +--gi|1430509
     !           !                    !        !  
     !           !     +-------------15        !              +--gi|1374244
     !           !     !              !        +-------------16  
     !           !     !              !                       +--GOS_714010
     !           !     !              !  
  +--2           !     !              !                    +-----gi|1415340
  !  !           !     !              +-------------------11  
  !  !           !     !                                   !  +--gi|1423477
  !  !           +----10                                   +-12  
  !  !                 !                                      +--gi|1346183
  !  !                 !  
  !  !                 !                                +--------gi|1422977
  !  !                 !                             +--9  
  !  !                 !                             !  !  +-----gi|1387217
  1  !                 !                             !  +--7  
  !  !                 +-----------------------------5     !  +--gi|1414257
  !  !                                               !     +--6  
  !  !                                               !        +--gi|1395777
  !  !                                               !  
  !  !                                               +-----------gi|1414435
  !  !  
  !  +-----------------------------------------------------------gi|1397082
  !  
  +--------------------------------------------------------------gi|1390241

---------------------------------------------------------------------------------------------------

b) Arbre(s) issus de neighbor-joining :


  22 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


  +---------gi|1397082
  !  
  !        +--------gi|1414435
  !     +-13  
  !  +-15  +----------------gi|1432263
  !  !  !  
  !  !  +-----------gi|1394450
  !  !  
  !  !         +--gi|1395777
  !  !     +--10  
  !  !  +-17   +-----gi|1414257
  !  !  !  !  
 16-19  !  +---------gi|1422977
  !  !  !  
  !  !  !        +----------------gi|1387217
  !  !  !     +-12  
  !  !  !     !  +-----------------gi|1425809
  !  !  !     !  
  !  !  !     !                          +-----gi|1346183
  !  !  !     !                       +--2 
  !  +-20  +-14      +----------------3  +---gi|1415340
  !     !  !  !      !                ! 
  !     !  !  !   +--9                +-------gi|1423477
  !     !  !  !   !  ! 
  !     !  !  !   !  +------------------------gi|1438868
  !     !  !  !   !  
  !     !  !  +--11                           +-GOS_714010
  !     !  !      !       +-------------------1 
  !     !  !      !       !                   +gi|1374244
  !     !  !      !       ! 
  !     +-18      !       !       +-gi|1430509
  !        !      +-------8   +---5 
  !        !              !   !   +-gi|1362836
  !        !              ! +-6 
  !        !              ! ! !    +-----gi|1439437
  !        !              +-7 +----4 
  !        !                !      +------gi|1399122
  !        !                ! 
  !        !                +----------gi|1408007
  !        !  
  !        +----------------gi|1361673
  !  
  +-------gi|1390241


remember: this is an unrooted tree!

Between        And            Length
-------        ---            ------
  16          gi|1397082      0.16755
  16            19            0.02267
  19            15            0.02280
  15            13            0.03408
  13          gi|1414435      0.15364
  13          gi|1432263      0.29406
  15          gi|1394450      0.20712
  19            20            0.01045
  20            17            0.01529[pour _chaque_ arbre produit, expliquez:
-l'arbre est-il cohérent avec la phylogénie de référence?
-la séquence métagénomique semble s'intégrer dans quel groupe taxonomique?]

  17            10            0.06955
  10          gi|1395777      0.05585
  10          gi|1414257      0.09285
  17          gi|1422977      0.17120
  20            18            0.01280
  18            14            0.02318
  14            12            0.03127
  12          gi|1387217      0.28863
  12          gi|1425809      0.30207
  14            11            0.05971
  11             9            0.06017
   9             3            0.28349
   3             2            0.04135
   2          gi|1346183      0.10070
   2          gi|1415340      0.07570
   3          gi|1423477      0.13065
   9          gi|1438868      0.41881
  11             8            0.13635
   8             1            0.33978
   1          GOS_714010      0.02128
   1          gi|1374244     -0.01308
   8             7            0.01791
   7             6            0.03735
   6             5            0.06127
   5          gi|1430509      0.04030
   5          gi|1362836      0.04120
   6             4            0.08168
   4          gi|1439437      0.10450
   4          gi|1399122      0.11220
   7          gi|1408007      0.17662
  18          gi|1361673      0.29318
  16          gi|1390241      0.12585



Annotator commentaries

Nous avons analysé la séquence nucléotidique: GOS_714010 Origine: Cook Bay, Moorea (Fr Polynesia) Longueur: 848 pb

Afin d'étudier cette séquence nous avons recherché des ORFs dans le sens direct et indirect en couvrant les 6 cadres possibles. L'ORF trouvée dans le sens direct avec le cadre 2 étant la plus longue,nous avons décidé de l'étudier. Ce fragment est long de 692 pb,il est donc composé d'environ 230 codons.Dans ces 230 codons, aucun codon stop n'a été retrouvé. L'absence de codon-stop indique donc qu'il est probable que notre séquence soit codante.En ce qui concerne le codon initiateur, nous pouvons appliquer le même raisonnement . Ici nous n'en avons pas détecté cela signifie qu'il peut être situé plus en aval dans la séquence.

Nous avons donc poursuivi l'analyse en tentant de déterminer des domaines protéiques conservées. Cependant la recherche dans notre séquence n'a rien donnée, nous ne pouvons donc pour le moment, déterminer une fonction biologique de la proteine codée par notre séquence. Nous avons ensuite effectué des blast afin de déterminer s'il existait des protéines homologues. Le blast x contre NR ne nous a pas apporté de résultats concluants ( les E-values étant trop haute). Le blast p contre Swissprot aussi ne nous a rien donné (étant donné que NR distribué par NCBI, est une réunion de plusieurs banques dont Swissprot). Seul le blast p contre env_NR (banque regroupant l’ensemble de séquences séquencées mais pas encore étudiées), nous fourni des séquences dont les score (de 438 à 66,6) et les e-values (de 5e-122 à 5e-10)nous laissent penser qu'elles sont homologues. Cependant nous ne pouvons effectuer de rapport taxonomique car le blast a révélé que cette séquence n'avait pas encore était étudiée nous n’avons donc aucune base pour constituer des groupes internes et externes et des relations taxonomiques. Nous avons ensuite fait un alignement de séquences pour déterminer si les séquences obtenues avec le blast présentées bien des domaines conservés.L'étude de ces alignements multiples révèle que notre séquence possède des domaines homologiques avec d'autres séquences pouvant avoir des origines différentes. A partir des résultats obtenus nous avons pu établir des arbres phylogénétiques pour définir la distance entre nos séquences, nous donnant deux arbres obtenus grâce à la méthode de parcimonie et un arbre par la méthode neighbour-joining. La présence de deux arbres pour le premier format indique qu'il n'y a pas de certitudes quant à la relation entre ces séquences. La différence se fait au niveau entre les branches numéro 9,11,12 du premier et la branche 9 du deuxième arbre. L’arbre au format NJ réparti les espèces en fonction de leur vitesse d’évolution, cela nous indique que notre séquence à évoluer rapidement.

Nous pouvons donc conclure que notre séquence est issue d'un métagénome marin. Cependant comme elle n'a pas encore été étudiée, nous ne pouvons définir de relations taxonomiques et déterminer son origine précise. De plus si nous avons trouvé des séquences protéiques présentant des homologies avec la sienne, nous n'avons pas détecter de domaines protéiques conservés


Multiple Alignement

PROTOCOLE: Infobiogen / Alignement multiple / format Clustal

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:
L'étude de l'alignement multiple montre que notre ORF est plus long que les autres séquences sauf une celle qui a le score maximal.
sa taille étant la même que celle de notre séquence. On note qu'il n'y a que 3 domaines ayant conservées plus de deux acides aminés identiques
à la suite. Une région de 10 acides aminés, une région de 5 acides aminés, une région de 4 acides aminés. On note que lors d'une substitution ,
l'acide aminé de notre séquence est remplacé au maximum par deux acides aminés différents.  

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:



CLUSTAL W (1.82) multiple sequence alignment


gi|139024108|gb|ECC88050.1|      -----------MMSKTERKYLPTLSELIDRLSIAQLKEVFISDHKEEYAQ
gi|139708241|gb|ECG92272.1|      ------------INMTERRYLPTLAELIDRLSIVQLKEVFIPERKEEYSQ
gi|141443595|gb|ECR86720.1|      --------------MSKRKYLPTLSELVDRLSITQLKEVFITDHKKEYSD
gi|143226317|gb|EDD72939.1|      MVQYLKIMKMEQRYMSKRKYLPTLAELVDRLSIVQLKEVFITEHKEEYAQ
gi|139445047|gb|ECF14642.1|      -----MTDTKGKYKMQKRKYLPTLSELIDRLSIVQLKEVFITGHKDEYAQ
gi|139577742|gb|ECG02687.1|      ---------------MNRKYLPTLSELIDRLSIAQLKEVFITEHKAEYAE
gi|141425743|gb|ECR74057.1|      --------------MMNRKYLPTLSELIDRLSIVQLKEVFIPDHKSEYSE
gi|138721798|gb|ECB55265.1|      ---------------MDRKYLPTFSELLDRLSIVQLKEVLIPEHKEEYAA
gi|136167366|gb|EBM33768.1|      -----------MNTNNQRQYLPTFSELIDRLSIVQLKEVFILDHKNEYAN
gi|142297798|gb|ECX06527.1|      -------------MMKNRKYLPTLSELIDRLSIAQLKEVFINEHKEEYSK
gi|134618376|gb|EBC41965.1|      ------MRSLEMKKIKQRKWLPTLGELVDRLSIHQLKEVFIPENKKNYAV
gi|141534065|gb|ECS19207.1|      -------------MAKQRKFLPTLGELIDRLSIHQLKEVFIPENKKNYAK
gi|142347772|gb|ECX43451.1|      ----------GSSIMSKRKWLPTLGELIDRLSIHQLKEIFIPENKKNYAK
gi|143886858|gb|EDH34510.1|      -------MIWERQMSKERKYLPTIEDLIDRLSIFQLKEVKIPEHKEKYAQ
gi|142580979|gb|ECZ10434.1|      -----------MERGFMRKYLPTVSELIDRLSIIQLKEVFIPEHKEEYAK
GOS_714010                       --------KTFRTRINMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGK
gi|137424419|gb|EBU02420.1|      --------------MNMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGK
gi|143050907|gb|EDC45501.1|      ----------------MRKYLPTLGELIDRLSIVQLKEVKIPQHKEEYSK
gi|136283694|gb|EBN12149.1|      ----------------MRKYLPTLGELIDRLSIVQLKEVKIPQHKEEYSK
gi|143943736|gb|EDH75425.1|      -------------MSMARKYLPTLGELIDRLTIVQLKEVKIPQHKKEYQK
gi|139912233|gb|ECI31875.1|      --------------------------------IVQLKEVKIPEHKEEYQK
gi|140800780|gb|ECN60180.1|      ----------------MRKYLPTLGELIDRLTIVQLKEVKIPQHKEEYQQ
                                                                 * ****: *  .* :*  

gi|139024108|gb|ECC88050.1|      EIKDIIHDINLLLP-E---SEGIDGEMIRAIVVLSQMNLHIWHNESNYRK
gi|139708241|gb|ECG92272.1|      EIKDIVHDINVLLS-G---AGGVDAEVIRAIVVLAQMNLHIWHNESNYRK
gi|141443595|gb|ECR86720.1|      EIADILHDIDLLLSED---DIKLDAKSIRAIVVLSQMNLHIWHNESNYRK
gi|143226317|gb|EDD72939.1|      EIKDIVHDIDLILNDE---NVKLSGKDVRAIVVLSQMNLHIWHNETQYRA
gi|139445047|gb|ECF14642.1|      EISDIVHDINLTLQEE---NVILTAEDVRAIVVLAQMNLHIWHNESNYRK
gi|139577742|gb|ECG02687.1|      EIKAIVHDIQAHLDEN---EAVVDAEVIRAIVVLSQMNLHIWHNETNYRK
gi|141425743|gb|ECR74057.1|      EIAAIVHDIQAHIDEN---NAVIDADVIRAIVVLSQMNLHIWHNETNYRK
gi|138721798|gb|ECB55265.1|      EIKDILHDIQCHIDEN---NVVVDAKVLRALIVVSQINLHIWHNEANYRK
gi|136167366|gb|EBM33768.1|      EIKLILNDIEILLKEN---GVNVSSDFIRSIVVLSQMNLHIWHNESNYRK
gi|142297798|gb|ECX06527.1|      EILDIINDIQILLDET---DDKIDAKTIRAIIVLSQMNLHIWHNESNYRN
gi|134618376|gb|EBC41965.1|      EMNDMVHDIDMILEEH---KGKITGDVIRAIIVLSQMNAHIWYNESQVRK
gi|141534065|gb|ECS19207.1|      EMSDMVHDIDMLLKEH---KGKITGDVVRAIVVLSQMNAHIWYNESQVRK
gi|142347772|gb|ECX43451.1|      EMNDMVHDINLILKEH---KGEITGEVIRAIIVLSQMNAHIWYNESMVRK
gi|143886858|gb|EDH34510.1|      DIHDILNDIDIILDES---PGKVDAKLIRAIVVLSQMNAHIWYNESDVRS
gi|142580979|gb|ECZ10434.1|      EIKDILHDLESEGL---------DSELIRAVIVTSQMNLHIWHNESEARK
GOS_714010                       EIKQIVSDINKIINES--DDLEFDGELVRAIVVLSQMNTHIWVNEDNARN
gi|137424419|gb|EBU02420.1|      EIKQIVSDINKIINES--DDLEFDGELVRAIVVLSQMNTHIWVNEDNARN
gi|143050907|gb|EDC45501.1|      EISDIVHDINEILK----EKDKIDGEFIRAVIVLSQMNAHIWYNEDNARS
gi|136283694|gb|EBN12149.1|      EISDIVHDINEILK----QKDKIDGEFIRAVIVLSQMNTHIWYNEDNARN
gi|143943736|gb|EDH75425.1|      EIEEIVHDITEILTTT--KQLKIDGDFIRAIIVLAQMNTHIWVNEDNARN
gi|139912233|gb|ECI31875.1|      EIQDIIHDITEILTTV--KQLKVDGDFIRAIIVLSQMNTHIWYNEDNARN
gi|140800780|gb|ECN60180.1|      EIKDIVHDINQILLDEKLGRDIVDGDMIRAIIVLAQMNTHIWVNEDNARN
                                 ::  :: *:               .. :*:::* :*:* *** **   * 

gi|139024108|gb|ECC88050.1|      GIKDGNNLELTHGLNGIRNTAKNKIQEVVGGRKDYKIDCLAADFKDWEIS
gi|139708241|gb|ECG92272.1|      GIKDGNNLELTHGLNGIRNTAKNKIQEVAGGRKDYKIDCLAAEFKDWEIS
gi|141443595|gb|ECR86720.1|      GIKDGNNLELTHGLNGIRNTAKNRIQEVAGGRKDYKIDCLAAEFEDWEIS
gi|143226317|gb|EDD72939.1|      GTGDGN-LGLTHGLNGIRNTAKNMIQENVGGRKDYKIDCIAAEFKDWEVS
gi|139445047|gb|ECF14642.1|      GIKEGNNLELTHGLNGIRNTAKNKIQEAVGGRKDYKIDCLAAEFKDWEIS
gi|139577742|gb|ECG02687.1|      GIKDGNNLELTHGLNGIRNTAKNKIQEVVGGRKDYKIDCLAADFKDWEIS
gi|141425743|gb|ECR74057.1|      GIKDGNNLELTHGLNGIRNTAKNKIQEVCGGRKDYKIDCLAADFKDWEIS
gi|138721798|gb|ECB55265.1|      GNDDGNNLKLSHGLNGIRNTAKNMIQDSLGGRKDYKIDCLAAEFKDWEIS
gi|136167366|gb|EBM33768.1|      GLKDGNNLELTHGLNGIRNTAKNKIQEVFGGRKDYKIDCLAAEFKEWEIS
gi|142297798|gb|ECX06527.1|      GIKDGNNLELTHGLNGIRNTAKNKIQEVVGGRKDYKIDCLAADFKDWEIS
gi|134618376|gb|EBC41965.1|      GEKGSDNLMLTHGLNGIRNTAVNKIMEVVGGRKDYKVDCIAAEFKDWEVS
gi|141534065|gb|ECS19207.1|      GEKGSDNLMLTHGLNGIRNTAINKIMEVVGGRKDYKVDCIASEFKDWDVS
gi|142347772|gb|ECX43451.1|      GERGSDNLMLTHGLNGIRNTAVNKIMEVVGGRKDYKIDCIASEFKDWEVS
gi|143886858|gb|EDH34510.1|      GVKGSDNLLLTHGLNGIRNTAKNFITDILGGRKDHKIDCLAADFKEWEVS
gi|142580979|gb|ECZ10434.1|      GINAGENLQLTHGLNGIRNTAKNKIQERFGGRKDYKTDCLAAEFEDWEIS
GOS_714010                       GDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDCLASDFSDWEIS
gi|137424419|gb|EBU02420.1|      GDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDCLASDFSDWEIS
gi|143050907|gb|EDC45501.1|      GDDQGNQLMLTHGLNGIRNTAKNKIQELDGGRKDYKIDCIASEFKDWEIS
gi|136283694|gb|EBN12149.1|      GDDVGNQLMLTHGLNGIRNTAKNKIQELDGGRKDYKIDCIASEFKDWEVS
gi|143943736|gb|EDH75425.1|      GEDVGNNLLLTHGLNGIRNTAKNKIQEVDGGRKDYKVDCIAAEFKDWEIS
gi|139912233|gb|ECI31875.1|      GDDVGNQLMLTHGLNGIRNTAKNKIQELDGGRKDYKVDCIASEFKDWEIS
gi|140800780|gb|ECN60180.1|      GDERGNKLLLTHGLNGIRNTAKNKIQEKVGGRKDYKIDCIASEFKDWEVS
                                 *   .: * *:********** * * :  *****:* **:*::*.:*::*

gi|139024108|gb|ECC88050.1|      WK------------------------------------------------
gi|139708241|gb|ECG92272.1|      WGKDE---------------------------------------------
gi|141443595|gb|ECR86720.1|      WNE-----------------------------------------------
gi|143226317|gb|EDD72939.1|      WNE-----------------------------------------------
gi|139445047|gb|ECF14642.1|      WKK-----------------------------------------------
gi|139577742|gb|ECG02687.1|      W-------------------------------------------------
gi|141425743|gb|ECR74057.1|      W-------------------------------------------------
gi|138721798|gb|ECB55265.1|      W-------------------------------------------------
gi|136167366|gb|EBM33768.1|      W-------------------------------------------------
gi|142297798|gb|ECX06527.1|      W-------------------------------------------------
gi|134618376|gb|EBC41965.1|      WDVPRNKK------------------------------------------
gi|141534065|gb|ECS19207.1|      W-------------------------------------------------
gi|142347772|gb|ECX43451.1|      WDVPRDKK------------------------------------------
gi|143886858|gb|EDH34510.1|      WENEV---------------------------------------------
gi|142580979|gb|ECZ10434.1|      W-------------------------------------------------
GOS_714010                       WDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTAKCGTRWLDSI
gi|137424419|gb|EBU02420.1|      WDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTAKCGTRWLDSI
gi|143050907|gb|EDC45501.1|      WE------------------------------------------------
gi|136283694|gb|EBN12149.1|      WK------------------------------------------------
gi|143943736|gb|EDH75425.1|      W-------------------------------------------------
gi|139912233|gb|ECI31875.1|      WKSKK---------------------------------------------
gi|140800780|gb|ECN60180.1|      WK------------------------------------------------
                                 *                                                 

gi|139024108|gb|ECC88050.1|      -----------------------------------------
gi|139708241|gb|ECG92272.1|      -----------------------------------------
gi|141443595|gb|ECR86720.1|      -----------------------------------------
gi|143226317|gb|EDD72939.1|      -----------------------------------------
gi|139445047|gb|ECF14642.1|      -----------------------------------------
gi|139577742|gb|ECG02687.1|      -----------------------------------------
gi|141425743|gb|ECR74057.1|      -----------------------------------------
gi|138721798|gb|ECB55265.1|      -----------------------------------------
gi|136167366|gb|EBM33768.1|      -----------------------------------------
gi|142297798|gb|ECX06527.1|      -----------------------------------------
gi|134618376|gb|EBC41965.1|      -----------------------------------------
gi|141534065|gb|ECS19207.1|      -----------------------------------------
gi|142347772|gb|ECX43451.1|      -----------------------------------------
gi|143886858|gb|EDH34510.1|      -----------------------------------------
gi|142580979|gb|ECZ10434.1|      -----------------------------------------
GOS_714010                       TGFDRANVKTKQISSNFWHLWMSENERWRWFQIEMPYEYQV
gi|137424419|gb|EBU02420.1|      TGFDRANVKTKQISSNFWHLWMSENERWRW-----------
gi|143050907|gb|EDC45501.1|      -----------------------------------------
gi|136283694|gb|EBN12149.1|      -----------------------------------------
gi|143943736|gb|EDH75425.1|      -----------------------------------------
gi|139912233|gb|ECI31875.1|      -----------------------------------------
gi|140800780|gb|ECN60180.1|      -----------------------------------------

BLAST

PROTOCOLE: 

a) NCBI / BLAST X / Séquence nucléotidique versus NR 
b) NCBI / BLAST P / Séquence protéique versus Swissprot
c) NCBI / BLAST P / Séquence protéique versus Environnemental Samples (ENV_NR)
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:
Les résultats obtenus par le blast x étant non-significatifs,le rapport de similarité étant trop
faible, nous avons effectué un blast p contre nr environnemental nous fournissant des résultats que nous pouvons 
analyser. 
Dans les 100 séquences comparées, les scores vont de 1129 à 77 et les E-values de 5e-122 à 3.0. On note une
une rupture des E-values à partir d'une séquence (passage d'une E-value de 5e-10 à 0.14). Cette rupture 
indique la fin des séquences que l'on peut considérer comme homologues.

Nous n'avons pu déterminer de groupe d'étude et de groupe externe car toutes les séquences sont issues de métagénome marin qui n'ont pas encore 
été étudiées. 
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


a) Résultats du blast x

Sequences producing significant alignments:                       (Bits)  Value

ref|YP_292147.1|  hypothetical protein PMN2A_0953 [Prochloroco...  43.9    0.011 Gene info
ref|XP_744922.1|  hypothetical protein [Plasmodium chabaudi ch...  41.6    0.053 Gene info
ref|YP_756046.1|  hypothetical protein Mmar10_0815 [Maricaulis...  41.2    0.070 Gene info
ref|YP_001015642.1|  hypothetical protein NATL1_18221 [Prochlo...  40.8    0.091 Gene info
ref|XP_001947406.1|  PREDICTED: similar to Midasin (MIDAS-cont...  40.0    0.16  UniGene infoGene info
ref|YP_292911.1|  hypothetical protein PMN2A_1720 [Prochloroco...  39.7    0.20  Gene info
ref|ZP_01549242.1|  hypothetical protein SIAM614_20645 [Stappi...  38.9    0.35 
ref|XP_766169.1|  hypothetical protein [Theileria parva strain...  38.1    0.59  Gene info
ref|XP_452327.1|  unnamed protein product [Kluyveromyces lacti...  36.6    1.7   UniGene infoGene info
ref|YP_001981860.1|  conserved hypothetical protein [Cellvibri...  36.2    2.2   Gene info
ref|YP_001324906.1|  SMC domain-containing protein [Methanococ...  36.2    2.2   Gene info
ref|XP_679320.1|  hypothetical protein [Plasmodium berghei str...  35.8    2.9   Gene info
ref|XP_651206.2|  phosphatidylinositol3-kinaseTor2 [Entamoeba ...  35.4    3.8   Gene info
ref|YP_266617.1|  hypothetical protein SAR11_1207 [Candidatus ...  35.4    3.8   Gene info
ref|XP_626574.1|  hypothetical protein [Cryptosporidium parvum...  35.4    3.8   Gene info
gb|EDZ60662.1|  conserved hypothetical protein [Candidatus Pel...  35.0    5.0  
ref|ZP_02948727.1|  putative collagenolytic protease [Clostrid...  35.0    5.0  
ref|YP_698903.1|  peptidase, M23/M37 family protein [Clostridi...  35.0    5.0   Gene info
ref|YP_378473.1|  hypothetical protein Cag_0152 [Chlorobium ch...  35.0    5.0   Gene info
ref|XP_648917.1|  hypothetical protein [Entamoeba histolytica ...  35.0    5.0   Gene info
ref|XP_001739021.1|  FKBP12-rapamycin complex-associated prote...  34.7    6.5   Gene info
ref|XP_001316891.1|  viral A-type inclusion protein [Trichomon...  34.7    6.5   Gene info
ref|ZP_01472918.1|  TPR repeat [Synechococcus sp. RS9916] >gb|...  34.7    6.5  
ref|ZP_01460692.1|  beta-hexosaminidase [Stigmatella aurantiac...  34.7    6.5  
ref|XP_972088.1|  PREDICTED: similar to cp309 CG33957-PB [Trib...  34.7    6.5   UniGene infoGene info
ref|XP_655375.1|  RNA recognition motif domain containing prot...  34.7    6.5   Gene info
ref|ZP_02639208.1|  peptidase, M23/M37 family protein [Clostri...  34.3    8.5  
ref|ZP_02185135.1|  putative glycosyltransferase [Carnobacteri...  34.3    8.5  
emb|CAO64869.1|  unnamed protein product [Vitis vinifera]          34.3    8.5  
emb|CAN74617.1|  hypothetical protein [Vitis vinifera]             34.3    8.5  
emb|CAN62733.1|  hypothetical protein [Vitis vinifera]             34.3    8.5  
ref|XP_001485565.1|  hypothetical protein PGUG_01236 [Pichia g...  34.3    8.5   Gene info
ref|ZP_01695018.1|  hypothetical protein M23134_01304 [Microsc...  34.3    8.5  
ref|YP_535621.1|  exodeoxyribonuclease V alpha chain [Lactobac...  34.3    8.5   Gene info
ref|YP_287885.1|  putative p216 surface protein [Mycoplasma hy...  34.3    8.5   Gene info
emb|CAP20583.1|  Hypothetical protein CBG23828 [Caenorhabditis...  34.3    8.5  





b) Résultats du blast p

Sequences producing significant alignments:                       (Bits)  Value

sp|Q29RT1.1|LYZL6_BOVIN  RecName: Full=Lysozyme-like protein 6...  32.3    2.2   Gene info
sp|Q9C9C9.1|SOT18_ARATH  Sulfotransferase 18 (AtSOT18) (Desulf...  32.0    2.6   Gene info
sp|O70608|SYCP2_RAT  Synaptonemal complex protein 2 (SCP-2) (S...  31.6    3.1   Gene info
sp|P49920|CBG_SHEEP  Corticosteroid-binding globulin precursor...  31.6    3.5  
sp|Q3T0Y3|ST1B1_BOVIN  Sulfotransferase family cytosolic 1B me...  31.6    3.8   Gene info
sp|Q9NR99.2|MXRA5_HUMAN  Matrix-remodeling-associated protein ...  30.8    6.4   Gene info
sp|P96994|GALT_STRMU  Galactose-1-phosphate uridylyltransferas...  30.4    7.7  
sp|Q9GK37.1|CBG_PIG  RecName: Full=Corticosteroid-binding glob...  30.4    8.2   Gene info
sp|P13368|7LESS_DROME  Protein sevenless                           30.4    8.9  
sp|Q971X1|SYR_SULTO  Arginyl-tRNA synthetase (Arginine--tRNA l...  30.0    10.0 
 

c)Séquence protéique versus env_nr

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|EBU02420.1|  hypothetical protein GOS_7178454 [marine metag...   438    5e-122
gb|EDC45501.1|  hypothetical protein GOS_1473169 [marine metag...   212    5e-54 
gb|EBN12149.1|  hypothetical protein GOS_8298475 [marine metag...   210    2e-53 
gb|ECN60180.1|  hypothetical protein GOS_5261476 [marine metag...   209    5e-53 
gb|EDH75425.1|  hypothetical protein GOS_548038 [marine metage...   206    3e-52 
gb|EDC36553.1|  hypothetical protein GOS_1488893 [marine metag...   206    4e-52 
gb|EDE25839.1|  hypothetical protein GOS_1162014 [marine metag...   198    1e-49 
gb|ECC88050.1|  hypothetical protein GOS_5656643 [marine metag...   187    1e-46 
gb|ECX06527.1|  hypothetical protein GOS_2605595 [marine metag...   183    2e-45 
gb|ECG02687.1|  hypothetical protein GOS_3913545 [marine metag...   183    3e-45 
gb|ECG92272.1|  hypothetical protein GOS_3825524 [marine metag...   183    4e-45 
gb|ECR74057.1|  hypothetical protein GOS_3983129 [marine metag...   182    5e-45 
gb|EBM44805.1|  hypothetical protein GOS_8408383 [marine metag...   182    8e-45 
gb|EBM42997.1|  hypothetical protein GOS_8411345 [marine metag...   181    9e-45 
gb|EBU70497.1|  hypothetical protein GOS_7018953 [marine metag...   181    2e-44 
gb|ECM32975.1|  hypothetical protein GOS_3349170 [marine metag...   180    3e-44 
gb|EDG80981.1|  hypothetical protein GOS_717736 [marine metage...   180    3e-44 
gb|ECB50049.1|  hypothetical protein GOS_4125332 [marine metag...   179    4e-44 
gb|EBM27451.1|  hypothetical protein GOS_8435820 [marine metag...   179    6e-44 
gb|ECI31875.1|  hypothetical protein GOS_5269951 [marine metag...   179    7e-44 
gb|ECF14642.1|  hypothetical protein GOS_3893886 [marine metag...   179    7e-44 
gb|ECX43451.1|  hypothetical protein GOS_2538955 [marine metag...   178    7e-44 
gb|ECZ10434.1|  hypothetical protein GOS_2241084 [marine metag...   178    1e-43 
gb|ECR86720.1|  hypothetical protein GOS_3485350 [marine metag...   177    2e-43 
gb|ECJ93866.1|  hypothetical protein GOS_5851880 [marine metag...   176    4e-43 
gb|ECY00234.1|  hypothetical protein GOS_2435748 [marine metag...   176    6e-43 
gb|ECH69184.1|  hypothetical protein GOS_4255175 [marine metag...   174    2e-42 
gb|EDE17108.1|  hypothetical protein GOS_1177250 [marine metag...   173    3e-42 
gb|EBD73422.1|  hypothetical protein GOS_9880988 [marine metag...   173    3e-42 
gb|EBV81595.1|  hypothetical protein GOS_6846316 [marine metag...   172    6e-42 
gb|EBC41965.1|  hypothetical protein GOS_72938 [marine metagen...   172    7e-42 
gb|EDD72939.1|  hypothetical protein GOS_1254708 [marine metag...   172    7e-42 
gb|ECS19207.1|  hypothetical protein GOS_5684356 [marine metag...   170    2e-41 
gb|EBM33768.1|  hypothetical protein GOS_8426020 [marine metag...   169    4e-41 
gb|ECB55265.1|  hypothetical protein GOS_3923373 [marine metag...   169    7e-41 
gb|EDH34510.1|  hypothetical protein GOS_622600 [marine metage...   167    2e-40 
gb|EDI50122.1|  hypothetical protein GOS_422206 [marine metage...   165    7e-40 
gb|ECI53697.1|  hypothetical protein GOS_4403162 [marine metag...   163    4e-39 
gb|ECQ68802.1|  hypothetical protein GOS_4667057 [marine metag...   162    5e-39 
gb|ECF22308.1|  hypothetical protein GOS_3585647 [marine metag...   160    2e-38 
gb|ECK45255.1|  hypothetical protein GOS_3802714 [marine metag...   157    2e-37 
gb|ECL29172.1|  hypothetical protein GOS_3974935 [marine metag...   155    6e-37 
gb|EBF86603.1|  hypothetical protein GOS_9527980 [marine metag...   154    1e-36 
gb|ECA83171.1|  hypothetical protein GOS_3303622 [marine metag...   144    2e-33 
gb|EBC85858.1|  hypothetical protein GOS_3129 [marine metagenome]   133    3e-30 
gb|ECU95602.1|  hypothetical protein GOS_2988620 [marine metag...   133    4e-30 
gb|EBC30768.1|  hypothetical protein GOS_91381 [marine metagen...   124    3e-27 
gb|EDE66730.1|  hypothetical protein GOS_1091021 [marine metag...   117    2e-25 
gb|ECI56366.1|  hypothetical protein GOS_4298654 [marine metag...   117    2e-25 
gb|ECG76526.1|  hypothetical protein GOS_4434605 [marine metag...   114    2e-24 
gb|ECA69677.1|  hypothetical protein GOS_3819577 [marine metag...   107    2e-22 
gb|EDG67023.1|  hypothetical protein GOS_741678 [marine metage...   105    9e-22 
gb|ECU40076.1|  hypothetical protein GOS_4508886 [marine metag...  98.6    1e-19 
gb|ECC83659.1|  hypothetical protein GOS_5835313 [marine metag...  94.0    2e-18 
gb|EDC37660.1|  hypothetical protein GOS_1486919 [marine metag...  89.7    5e-17 
gb|EBG74245.1|  hypothetical protein GOS_9381933 [marine metag...  82.8    6e-15 
gb|EBM10734.1|  hypothetical protein GOS_8462137 [marine metag...  73.9    2e-12 
gb|EBQ90520.1|  hypothetical protein GOS_7679987 [marine metag...  66.6    4e-10 
gb|EBS11413.1|  hypothetical protein GOS_7488974 [marine metag...  66.6    5e-10 
gb|EBZ97876.1|  hypothetical protein GOS_3214180 [marine metag...  38.5    0.14  
gb|EBZ31876.1|  hypothetical protein GOS_5834766 [marine metag...  38.1    0.16  
gb|ECS92641.1|  hypothetical protein GOS_8930487 [marine metag...  37.4    0.33  
gb|EDA29540.1|  hypothetical protein GOS_2027721 [marine metag...  37.0    0.34  
gb|ECN03697.1|  hypothetical protein GOS_4026996 [marine metag...  37.0    0.40  
gb|EDJ77329.1|  hypothetical protein GOS_1635281 [marine metag...  36.6    0.48  
gb|ECI14874.1|  hypothetical protein GOS_5958161 [marine metag...  36.6    0.48  
gb|ECY66391.1|  hypothetical protein GOS_2320148 [marine metag...  36.6    0.52  
gb|ECS56735.1|  hypothetical protein GOS_4198327 [marine metag...  36.6    0.53  
gb|ECB39314.1|  hypothetical protein GOS_4538200 [marine metag...  36.2    0.69  
gb|ECG11280.1|  hypothetical protein GOS_3584076 [marine metag...  35.8    0.80  
gb|EBZ39502.1|  hypothetical protein GOS_5513872 [marine metag...  35.8    0.80  
gb|EBQ84808.1|  hypothetical protein GOS_7688614 [marine metag...  35.8    0.85  
gb|ECA46143.1|  hypothetical protein GOS_4763997 [marine metag...  35.8    0.86  
gb|EBB27598.1|  hypothetical protein GOS_260806 [marine metage...  35.8    0.91  
gb|ECU77091.1|  hypothetical protein GOS_3070519 [marine metag...  35.8    0.93  
gb|EDH96105.1|  hypothetical protein GOS_511617 [marine metage...  35.8    0.94  
gb|EBH31006.1|  hypothetical protein GOS_9284668 [marine metag...  35.8    0.95  
gb|EBC53773.1|  hypothetical protein GOS_54052 [marine metagen...  35.4    1.0   
gb|EDA33892.1|  hypothetical protein GOS_2019720 [marine metag...  35.4    1.2   
gb|ECZ91893.1|  hypothetical protein GOS_2096518 [marine metag...  35.0    1.4   
gb|EBR04981.1|  hypothetical protein GOS_7659156 [marine metag...  35.0    1.4   
gb|EBP56491.1|  hypothetical protein GOS_7891248 [marine metag...  34.7    1.7   
gb|EBZ98490.1|  hypothetical protein GOS_3190267 [marine metag...  34.7    1.7   
gb|ECD28412.1|  hypothetical protein GOS_4047649 [marine metag...  34.7    1.8   
gb|EBJ54804.1|  hypothetical protein GOS_8880091 [marine metag...  34.7    1.9   
gb|ECB18970.1|  hypothetical protein GOS_5339731 [marine metag...  34.7    2.0   
gb|ECF92129.1|  hypothetical protein GOS_4313113 [marine metag...  34.7    2.0   
gb|EDG59566.1|  hypothetical protein GOS_754744 [marine metage...  34.7    2.1   
gb|EBO36586.1|  hypothetical protein GOS_8092525 [marine metag...  34.7    2.1   
gb|ECK73355.1|  hypothetical protein GOS_6202521 [marine metag...  34.3    2.2   
gb|ECX99293.1|  hypothetical protein GOS_2437639 [marine metag...  34.3    2.3   
gb|EDH72009.1|  hypothetical protein GOS_554117 [marine metage...  34.3    2.4   
gb|EBG96436.1|  hypothetical protein GOS_9343901 [marine metag...  34.3    2.4   
gb|EDI75140.1|  hypothetical protein GOS_380507 [marine metage...  34.3    2.5   
gb|ECR39069.1|  hypothetical protein GOS_5365073 [marine metag...  34.3    2.5   
gb|ECD23583.1|  hypothetical protein GOS_4234270 [marine metag...  34.3    2.6   
gb|ECB01620.1|  hypothetical protein GOS_6040634 [marine metag...  34.3    2.7   
gb|ECA01614.1|  hypothetical protein GOS_3068611 [marine metag...  34.3    2.8   
gb|EDD57034.1|  hypothetical protein GOS_1281819 [marine metag...  33.9    3.0   
gb|EBW31357.1|  hypothetical protein GOS_6766275 [marine metag...  33.9    3.0   


-------------------------------------------------------------------------------
blast p env nr

>gb|EBU02420.1|  hypothetical protein GOS_7178454 [marine metagenome]
Length=214

 Score =  438 bits (1126),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 213/214 (99%), Positives = 214/214 (100%), Gaps = 0/214 (0%)

Query  7    INMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGE  66
            +NMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGE
Sbjct  1    MNMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGE  60

Query  67   LVRAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYK  126
            LVRAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYK
Sbjct  61   LVRAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYK  120

Query  127  IDCLASDFSDWEISWDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTAKCGTRW  186
            IDCLASDFSDWEISWDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTAKCGTRW
Sbjct  121  IDCLASDFSDWEISWDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTAKCGTRW  180

Query  187  LDSITGFDRANVKTKQISSNFWHLWMSENERWRW  220
            LDSITGFDRANVKTKQISSNFWHLWMSENERWRW
Sbjct  181  LDSITGFDRANVKTKQISSNFWHLWMSENERWRW  214


>gb|EDC45501.1|  hypothetical protein GOS_1473169 [marine metagenome]
Length=132

 Score =  212 bits (540),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (85%), Gaps = 2/134 (1%)

Query  9    MREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELV  68
            MR+YLPTLGELIDRL+I QLKEVKIP  K EY KEI  IV DIN+I+ E D  + DGE +
Sbjct  1    MRKYLPTLGELIDRLSIVQLKEVKIPQHKEEYSKEISDIVHDINEILKEKD--KIDGEFI  58

Query  69   RAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKID  128
            RA++VLSQMN HIW NEDNAR+GD+QGNQLMLTHGLNGIRNTAKNKIQE  GGRKDYKID
Sbjct  59   RAVIVLSQMNAHIWYNEDNARSGDDQGNQLMLTHGLNGIRNTAKNKIQELDGGRKDYKID  118

Query  129  CLASDFSDWEISWD  142
            C+AS+F DWEISW+
Sbjct  119  CIASEFKDWEISWE  132


>gb|EBN12149.1|  hypothetical protein GOS_8298475 [marine metagenome]
Length=132

 Score =  210 bits (535),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/133 (75%), Positives = 114/133 (85%), Gaps = 2/133 (1%)

Query  9    MREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELV  68
            MR+YLPTLGELIDRL+I QLKEVKIP  K EY KEI  IV DIN+I+ + D  + DGE +
Sbjct  1    MRKYLPTLGELIDRLSIVQLKEVKIPQHKEEYSKEISDIVHDINEILKQKD--KIDGEFI  58

Query  69   RAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKID  128
            RA++VLSQMNTHIW NEDNARNGD+ GNQLMLTHGLNGIRNTAKNKIQE  GGRKDYKID
Sbjct  59   RAVIVLSQMNTHIWYNEDNARNGDDVGNQLMLTHGLNGIRNTAKNKIQELDGGRKDYKID  118

Query  129  CLASDFSDWEISW  141
            C+AS+F DWE+SW
Sbjct  119  CIASEFKDWEVSW  131


>gb|ECN60180.1|  hypothetical protein GOS_5261476 [marine metagenome]
Length=136

 Score =  209 bits (532),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 119/136 (87%), Gaps = 4/136 (2%)

Query  9    MREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESD---DLEFDG  65
            MR+YLPTLGELIDRLTI QLKEVKIP  K EY +EIK IV DIN+I+ +     D+  DG
Sbjct  1    MRKYLPTLGELIDRLTIVQLKEVKIPQHKEEYQQEIKDIVHDINQILLDEKLGRDI-VDG  59

Query  66   ELVRAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDY  125
            +++RAI+VL+QMNTHIWVNEDNARNGD +GN+L+LTHGLNGIRNTAKNKIQEK+GGRKDY
Sbjct  60   DMIRAIIVLAQMNTHIWVNEDNARNGDERGNKLLLTHGLNGIRNTAKNKIQEKVGGRKDY  119

Query  126  KIDCLASDFSDWEISW  141
            KIDC+AS+F DWE+SW
Sbjct  120  KIDCIASEFKDWEVSW  135


>gb|EDH75425.1|  hypothetical protein GOS_548038 [marine metagenome]
Length=136

 Score =  206 bits (525),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)

Query  10   REYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVR  69
            R+YLPTLGELIDRLTI QLKEVKIP  K EY KEI++IV DI +I+  +  L+ DG+ +R
Sbjct  5    RKYLPTLGELIDRLTIVQLKEVKIPQHKKEYQKEIEEIVHDITEILTTTKQLKIDGDFIR  64

Query  70   AIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDC  129
            AI+VL+QMNTHIWVNEDNARNG++ GN L+LTHGLNGIRNTAKNKIQE  GGRKDYK+DC
Sbjct  65   AIIVLAQMNTHIWVNEDNARNGEDVGNNLLLTHGLNGIRNTAKNKIQEVDGGRKDYKVDC  124

Query  130  LASDFSDWEISW  141
            +A++F DWEISW
Sbjct  125  IAAEFKDWEISW  136


>gb|EDC36553.1|  hypothetical protein GOS_1488893 [marine metagenome]
Length=136

 Score =  206 bits (524),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)

Query  10   REYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVR  69
            R+YLPTLGELIDRLTI QLKEVKIP  K EY KEI+QIV DI +I+     L+ DG+ +R
Sbjct  5    RKYLPTLGELIDRLTIVQLKEVKIPEHKEEYQKEIEQIVHDITEILTTVKQLKVDGDFIR  64

Query  70   AIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDC  129
            A++VLSQMNTHIW NEDNAR+GDN  N L+LTHGLNGIRNTAKNKIQE  GGRKDYK+DC
Sbjct  65   AVIVLSQMNTHIWYNEDNARSGDNVANDLLLTHGLNGIRNTAKNKIQEVDGGRKDYKVDC  124

Query  130  LASDFSDWEISW  141
            +AS+F DWEISW
Sbjct  125  IASEFKDWEISW  136


>gb|EDE25839.1|  hypothetical protein GOS_1162014 [marine metagenome]
Length=138

 Score =  198 bits (503),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 111/132 (84%), Gaps = 1/132 (0%)

Query  10   REYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVR  69
            R+YLPTLGELIDRL+I QLKEV I   KSEYGKEIK IV DI+ I+ +S D + DGE +R
Sbjct  8    RKYLPTLGELIDRLSIIQLKEVFIKEHKSEYGKEIKDIVHDIDLIL-KSGDYKLDGEFIR  66

Query  70   AIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDC  129
            AIVVLSQMN HIW NE NAR G + GN+L+LTHGLNGIRNTAKNKIQ K+GGRKDYKIDC
Sbjct  67   AIVVLSQMNLHIWSNETNARAGIDAGNKLLLTHGLNGIRNTAKNKIQSKVGGRKDYKIDC  126

Query  130  LASDFSDWEISW  141
            +A++F DWEISW
Sbjct  127  IAAEFKDWEISW  138


>gb|ECC88050.1|  hypothetical protein GOS_5656643 [marine metagenome]
Length=137

 Score =  187 bits (476),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 106/132 (80%), Gaps = 2/132 (1%)

Query  10   REYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVR  69
            R+YLPTL ELIDRL+I QLKEV I + K EY +EIK I+ DIN ++ ES+ +  DGE++R
Sbjct  7    RKYLPTLSELIDRLSIAQLKEVFISDHKEEYAQEIKDIIHDINLLLPESEGI--DGEMIR  64

Query  70   AIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDC  129
            AIVVLSQMN HIW NE N R G   GN L LTHGLNGIRNTAKNKIQE +GGRKDYKIDC
Sbjct  65   AIVVLSQMNLHIWHNESNYRKGIKDGNNLELTHGLNGIRNTAKNKIQEVVGGRKDYKIDC  124

Query  130  LASDFSDWEISW  141
            LA+DF DWEISW
Sbjct  125  LAADFKDWEISW  136


>gb|ECX06527.1|  hypothetical protein GOS_2605595 [marine metagenome]
Length=135

 Score =  183 bits (465),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 105/132 (79%), Gaps = 1/132 (0%)

Query  10   REYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVR  69
            R+YLPTL ELIDRL+I QLKEV I   K EY KEI  I++DI  +++E+DD + D + +R
Sbjct  5    RKYLPTLSELIDRLSIAQLKEVFINEHKEEYSKEILDIINDIQILLDETDD-KIDAKTIR  63

Query  70   AIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDC  129
            AI+VLSQMN HIW NE N RNG   GN L LTHGLNGIRNTAKNKIQE +GGRKDYKIDC
Sbjct  64   AIIVLSQMNLHIWHNESNYRNGIKDGNNLELTHGLNGIRNTAKNKIQEVVGGRKDYKIDC  123

Query  130  LASDFSDWEISW  141
            LA+DF DWEISW
Sbjct  124  LAADFKDWEISW  135


>gb|ECG02687.1|  hypothetical protein GOS_3913545 [marine metagenome]
Length=133

 Score =  183 bits (464),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 104/132 (78%), Gaps = 1/132 (0%)

Query  10   REYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDDLEFDGELVR  69
            R+YLPTL ELIDRL+I QLKEV I   K+EY +EIK IV DI   ++E++ +  D E++R
Sbjct  3    RKYLPTLSELIDRLSIAQLKEVFITEHKAEYAEEIKAIVHDIQAHLDENEAV-VDAEVIR  61

Query  70   AIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIGGRKDYKIDC  129
            AIVVLSQMN HIW NE N R G   GN L LTHGLNGIRNTAKNKIQE +GGRKDYKIDC
Sbjct  62   AIVVLSQMNLHIWHNETNYRKGIKDGNNLELTHGLNGIRNTAKNKIQEVVGGRKDYKIDC  121

Query  130  LASDFSDWEISW  141
            LA+DF DWEISW
Sbjct  122  LAADFKDWEISW  133
---------------------------------------------------------------------------------------------------

ORF finding

PROTOCOLE:

a) SMS ORFinder / sens direct   / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'
b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'



---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:
Suite à l'analyse de la séquence génomique , nous avons découvert une séquence codante dans le sens
direct et une dans le sens indirect.
Nous avons décidé de prendre la séquence la plus grande afin de continuer l'analyse:
- nous avons pris la séquence de l'ORF numéro 1 dans le cadre de lecture 2.

Après avoir fait le blast p contre nr_env, on remarque que les séquences homologues trouvées
s'alignent avec la notre sur toute leur longueur. L'homolgie des séquences ne démarrant pas au niveau 
de la même position ( la comparaison commencant au niveau du 9 ème acide aminé pour notre séquence et au premier pour la séquence du blast) nous pouvons
supposer que notre protéine commence donc au niveau de ce neuvième acide aminé qui est une méthionine.
Nous pouvons estimer que la protéine est longue de 214 aa.
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a)sens direct

>ORF number 1 in reading frame 2 on the direct strand extends from base 155 to base 847.
AAAACTTTTAGAACCAGAATTAATATGAGAGAATACTTACCAACTTTAGGTGAATTAATT
GATAGACTTACTATATGTCAATTAAAAGAAGTTAAAATACCAAATAAAAAATCAGAATAT
GGAAAAGAAATAAAACAAATAGTTTCTGATATAAATAAAATAATAAATGAATCTGATGAC
TTAGAATTTGATGGTGAGTTGGTACGAGCCATTGTAGTTTTATCTCAAATGAATACTCAC
ATTTGGGTCAATGAAGATAACGCGAGAAATGGAGATAACCAAGGAAATCAACTTATGTTA
ACCCATGGTTTAAATGGAATAAGAAATACTGCTAAAAACAAAATACAAGAAAAGATTGGA
GGTAGAAAGGATTATAAGATAGATTGTTTAGCTTCAGATTTTTCTGATTGGGAGATAAGT
TGGGATAAACCAATTGATAATAATAGATGGAACGAAACTGTTAAAAATGGAAATCCTGGT
GGTTTTGCTTTTCAAGTATTTCAGAAAAAAGATTCTGACTTTCAAATTATAACAACTGCG
AAGTGTGGAACAAGATGGTTGGATAGTATTACAGGATTTGATAGAGCTAATGTTAAAACA
AAACAAATATCATCAAATTTTTGGCATTTATGGATGAGTGAAAATGAAAGGTGGAGATGG
TTTCAAATTGAAATGCCTTATGAATATCAAGTT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
KTFRTRINMREYLPTLGELIDRLTICQLKEVKIPNKKSEYGKEIKQIVSDINKIINESDD
LEFDGELVRAIVVLSQMNTHIWVNEDNARNGDNQGNQLMLTHGLNGIRNTAKNKIQEKIG
GRKDYKIDCLASDFSDWEISWDKPIDNNRWNETVKNGNPGGFAFQVFQKKDSDFQIITTA
KCGTRWLDSITGFDRANVKTKQISSNFWHLWMSENERWRWFQIEMPYEYQV

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 182.
TTAGATTCACTCTATAATAGGAATTGGTGGAAACCAAATAAATCAATGTCAGAATATATT
ACAGATAGATATGGTGAAAATGGACTTATGGGAAATGGAGATTTTCATCCAAATAGTGGT
GGTCAAAGATACTTTTATGAAACAATAATTAAAAAACTTTTAGAACCAGAATTAATATGA


>Translation of ORF number 1 in reading frame 3 on the direct strand.
LDSLYNRNWWKPNKSMSEYITDRYGENGLMGNGDFHPNSGGQRYFYETIIKKLLEPELI*

--------------------------------------------------------------------------------------------------
b)sens indirect

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 86 to base 301.
TATTTGTTTTGTTTTAACATTAGCTCTATCAAATCCTGTAATACTATCCAACCATCTTGT
TCCACACTTCGCAGTTGTTATAATTTGAAAGTCAGAATCTTTTTTCTGAAATACTTGAAA
AGCAAAACCACCAGGATTTCCATTTTTAACAGTTTCGTTCCATCTATTATTATCAATTGG
TTTATCCCAACTTATCTCCCAATCAGAAAAATCTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
YLFCFNISSIKSCNTIQPSCSTLRSCYNLKVRIFFLKYLKSKTTRISIFNSFVPSIIINW
FIPTYLPIRKI*

No ORFs were found in reading frame 3.

-------------------------------------------------------------------------------------------