GOS 687010

From Metagenes

Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118857949
Annotathon code: GOS_687010
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : meline
Annotated on : 2009-02-05 14:02:28
  • Charlier Mélanie
  • Chorliet Pauline

Contents

Synopsis

  • Taxonomy: Cyanobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1117
    Kingdom: Bacteria - Phylum: Cyanobacteria - Class: - Order:
    Bacteria; Cyanobacteria;

Genomic Sequence

>JCVI_READ_1091118857949 GOS_687010 genomic DNA
CATATCATTATTAATATTAACTTTGTCTCTAACTTTTCCATTCACCTGTATTACTAGTTCATATGAATCTTCTTTTAGTGCCTCGGCATTAAATAAAGGC
CAGTGTTCTAAATGCACAGATTTTTTAAATCCTATAAGATGCCATATTTCTTCTGCAATATGAGGAGCAAATGGAGCCAACAAAATACAAAATGTTTTTA
AAGCATCAATTTTTAAATTATTGTTTACGTAATTAATGGAATTTGATAAGGAATTATAAAACTTCATTAGTTCTGAAATCGCAGTATTAAATTGGTTATT
TAATATGTCATTTGAAATTTCTTTTATAGCGATATTAATTGACTTTATTAAACTTTTTTCTTTATCTGGATAGGAATTAGATTTACTATTTATATCTTTT
GCACAATTTATATAAAGCTTCCAAATCCTGCTTAAAAATCTAAATTGTCCTTCAACATCTGTATCTCCCCATTCCAAATCTTTTTCTGGTGGTGCTTTAA
ATAATATAAACATTCTTGCTGTATCTGCTCCATATTTTTTAATTACTGATTCAGGGTCTATTCCATTGTATTTAGACTTAGACATCTTCTCGAAAAGAAC
TTCGAGTTTAGAATTGTCAATTGGATCTGTAGGATTTGATAAATCAGAAATATCGGAAGGAGAAACATATTTACCAGTTTTATTGTTTTTATAGGCTGCG
GCCTGAACCATTCCTTGCGTTAATAGTTTTTTGAAAGGTTCATCGATATCAAATAGTTCATTATCCCGCAATGCTTTAGTGAAAAATCTTGCATATAACA
AATGCAATATTGCATGCTCTACTCCTCCAACATATTGATCAACTGGCAACCACTTATTAATTTCAGTCTTTTCAAATGGCTTAGTTGAACATTTTGAAGA
TGGGTATCTT

Translation

[2 - 910/910]   indirect strand
>GOS_687010 Translation [2-910   indirect strand]
RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFKKLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNS
KLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSYPDKEKSLIKSINIAIKEISN
DILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN
NDM
[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

PROTOCOLE:

a) Dans Phylip/NJ à Infobiogen, paramètres indiqués dans règles du jeu. Le groupe externe qui enracine est le n°1.

b) Dans Phylip/NJ à Infobiogen, paramètres indiqués dans règles du jeu.

---------------------------------------------------------------------------------------------------

ANALYSE DES RÉSULTATS:

Les arbres semblent etre cohérents entre eux et avec la phylogénie de référence.Les séquences des groupes d'études sont
bien choisies car on voit que les membres du groupes externe sont isolés sur l'arbre et que notre sequence s'integre 
bien au milieu des séquences homologues sélectionnées. Dans les deux cas, notre séquence est située sur une branche 
particulière avec des Pmarinus,néanmoins ce n'est pas suffisant pour dire qu'elle appartient à l'un d'entre eux.

---------------------------------------------------------------------------------------------------

RÉSULTATS BRUTS:

a)

Arbre(s) issus de neighbor :


  27 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


                      +------------------------Psyringae [g-proteobacteria]
         +------------6 
     +---8            +--------------------------------Ymollareti [enterobacteria]
     !   ! 
     !   +-----------------------------------------Fnucleatum [fusobacteria]
     !  
     !                    +-----------------Synechoco1 [cyanobacteria]
     !             +-----10  
     !             !      !                +-Pmarinus6 [cyanobacteria]
     !          +-15      +----------------4 
     !          !  !                       +-Pmarinus7 [cyanobacteria]
     !          !  !  
     !          !  +-------------------------------Pchromatop [cyanobacteria]
     !       +-17  
     !       !  !    +-------------------------Synechoco2 [cyanobacteria]
  +-12       !  !    !  
  !  !       !  +---19  +------------------Selongatus [cyanobacteria]
  !  !       !       !  !  
  !  !       !       !  !  +-----------------Telongatus [cyanobacteria]
  !  !       !       +-20  !  
  !  !       !          !  !        +----------Cyanothec1 [cyanobacteria]
  !  !       !          !  !     +-18  
  !  !       !          !  !     !  !        +---Cwatsonii [cyanobacteria]
  !  !       !          +-21  +-23  +--------9 
  !  !       !             !  !  !           +--Cyanothec2 [cyanobacteria]
  !  !       !             !  !  !  
  !  !       !             !  !  +---------------Amarina   [cyanobacteria]
  !  !       !             !  !  
  !  !       !             +-24                   +Nostoc   [cyanobacteria] 
  !  +------16                !            +------7 
  !          !                !     +-----14      +Avariabili [cyanobacteria]
  !          !                !     !      !  
  !          !                !  +-22      +------Nspumigena [cyanobacteria]
  !          !                !  !  !  
  !          !                +-25  +-------------Mchthonopl  [cyanobacteria]
  !          !                   !  
  !          !                   +-------------Amaxima   [cyanobacteria]
  !          !  
  !          !                                     +-Pmarinus2 [cyanobacteria]
  !          !                                   +-1 
  !          !                       +-----------2 +-GOS_687010
  !          !                       !           ! 
  !          !    +------------------5           +--Pmarinus1 [cyanobacteria]
  !          !    !                  ! 
  !          !    !                  !    +---------Pmarinus3 [cyanobacteria]
  !          +---13                  +----3 
  !               !                       +--------Pmarinus4 [cyanobacteria]
  !               !  
  !               +--------------------------------Pmarinus5 [cyanobacteria]
  !  
 11---------------------------------Fnodosum  [thermotogales]
  !  
  +--------------------------Chydrogeno [firmicutes]

------------------------------------------------------------------------------------------------------------------------
b)

Arbre(s) issus de protpars :


Protein parsimony algorithm, version 3.6a2.1


One most parsimonious tree found:




  +-----------------------------------------------------------------------------Pchromatop [cercozoans]
  !  
  !                                                                       +-----Synechoco1 [cyanobacteria]
  !  +--------------------------------------------------------------------4  
  !  !                                                                    !  +--Pmarinus7 [cyanobacteria]
  !  !                                                                    +--3  
  5  !                                                                       +--Pmarinus6 [cyanobacteria]
  !  !  
  !  !                                                           +--------------Pmarinus5 [cyanobacteria]
  !  !                                                           !  
  !  !        +-------------------------------------------------11           +--Pmarinus4 [cyanobacteria]
  !  !        !                                                  !  +-------10  
  +--2        !                                                  !  !        +--Pmarinus3 [cyanobacteria]
     !        !                                                  +--9  
     !        !                                                     !     +-----GOS_687010
     !        !                                                     +-----7  
     !        !                                                           !  +--Pmarinus2 [cyanobacteria]
     !        !                                                           +--8  
     !        !                                                              +--Pmarinus1 [cyanobacteria]
     !        !  
     !        !                                +--------------------------------Synechoco2 [cyanobacteria]                    
     !        !                                !  
     +--------6                                !                             +--Selongatus[cyanobacteria]
              !                 +-------------23  +-------------------------22  
              !                 !              !  !                          +--Telongatus[cyanobacteria]
              !                 !              !  !  
              !                 !              !  !                    +--------Amarina   [cyanobacteria]
              !                 !              +-21     +-------------20  
              !                 !                 !     !              !  +-----Cyanothec1 [cyanobacteria]
              !                 !                 !     !              +-19  
              !                 !                 !     !                 !  +--Cyanothec2 [cyanobacteria]
              !                 !                 +----17                 +-18  
              !                 !                       !                    +--Cwatsonii [cyanobacteria]
              !                 !                       !  
              !                 !                       !           +-----------Mchthonopl [cyanobacteria]
              +----------------12                       +----------15  
                                !                                   !  +--------Amaxima   [cyanobacteria]
                                !                                   +-16  
                                !                                      !  +-----Nspumigena [cyanobacteria]
                                !                                      +-14  
                                !                                         !  +--Avariabili [cyanobacteria]
                                !                                         +-13  
                                !                                            +--Nostoc    [cyanobacteria]
                                !  
                                !                                         +-----Fnucleatum [fusobacteria]
                                !                                   +----26  
                                !                                   !     !  +--Ymollareti [enterobacteria]
                                !                                   !     +-25  
                                +----------------------------------24        +--Psyringae [g-proteobacteria]
                                                                    !  
                                                                    !        +--Fnodosum  [thermotogales]
                                                                    +--------1  
                                                                             +--Chydrogeno [firmicutes]

Annotator commentaries

Nous avons trouvé un ORF de 908 codons situé sur le brin indirect. Notre séquence initiale comptait 910 codons et notre ORF commençant en position 2 : on en conclut que notre séquence est probablement incomplète en 5'. De même, on peut raisonnablement penser que la séquence est aussi incomplète en 3' car dans cet ORF on ne trouve pas de codon stop avant la fin de notre séquence. On peut dire que notre séquence est codante car notre ORF contient un nombre significatif de codons (303 >> 60 codons).

La séquence nucléotidique a été traduite en séquence protéique dont on ne peut pas déterminer le poids moléculaire car, comme la séquence nucléotidique, elle est incomplète. Nous avons trouvé un domaine protéique intéressant qui est interrompu. Son e-value de 3.2e-101 est très pertinent. Nous nous sommes donc basé sur la fonction de ce domaine,leucyl-tRNA synthethase, pour en déduire la fonction putative de notre protéine.

Comme nous n'avons eu qu'un seul grand ORF,nous ne doutons pas de la séquence protéique obtenue et c'est pourquoi nous avons choisi de faire un blastp. Nous avons commencé par la banque swissprot (précise) puis la banque nr (vaste).Dans les 2 cas nous avons augmenté progressivement le nombre d'homologues recherchés car les premiers scores étaient tous excellents.Le blastp contre swissprot nous a permi de déterminer notre score seuil, puis de choisir les composants de nos groupes d'etude et externe.Le rapport taxonomique nous montre que les homologues les plus proches de notre organisme sont des Cyanobactéries,ce qui nous a permi de définir notre groupe d'étude.Les résultats trouvés par le site Interpro lors de la recherche de domaines conservés nous confortent dans le choix de ce groupe d'étude.Le groupe externe contient des bactéries autres que des Cyanobactéries.

L'alignement multiple confirme qu'on a bien fait de choisir "any codon" comme codon start car on voit bien en le faisant que les séquences homologues à la notre débutent jusqu'à 500 acides aminés en amont.Le pourcentage d'identité est fort si l'on tient compte de la taille de notre séquence par rapport à celle des homologues.

Nos arbres sont cohérents avec la taxonomie (notre sequence est intégrée,le groupe externe est à part).On pourrait penser que notre séquence est issue d'un Prochlorococcus marinus car elle est intégrée au milieu de 2 autres,mais en regardant mieux les arbres on se rend compte qu'il y a des P. marinus qui se trouvent sur d'autres branches. Néanmoins,on peut essayer de voir si l'on peut réduire notre organisme au groupe des Prochlorales. Pour cela, nous avons vérifié la phylogénie de plusieurs homologues à notre séquence à l'aide de leur fiche NCBI. Après vérification, nous remarquons que les P. marinus font bien partis de l'ordre des Prochlorales. Cependant certains homologues sont des Synechococcus et ils ne font pas partie de cet ordre donc on ne peut pas conclure que l'organisme dont provient notre séquence est un Prochlorale. Nous dirons donc que notre séquence provient certainement d'une Cyanobactérie proche des P.marinus mais n'en est sûrement pas une.


Multiple Alignement

PROTOCOLE:

Site PBIL, paramètres par défaut.

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Pas d'identité de l'aa 1 à 556 et de l'aa 894 à la fin.
Notre séquence est beaucoup plus courte que celles du groupe d'étude et du groupe externe en Nter et Cter.
Cela va dans le sens de notre supposition: nous étudions une séquence tronquée au niveaux de ses deux extrémités. 

Néanmoins,entre les positions 557 et 893 nous avons une région conservée. Le long de cette région de 336 acides aminés,
il y a 53 identités vraies (soit 16%), 50 similarités fortes (soit 15%) et 11 similarités moins fortes (soit 3%).
En tout, cela représente des similartités significatives sur 34% de notre séquence. Quand on regarde où se situent les 
similarités (identités + similarités)au niveau de notre séquence,on voit qu'elles correspondent aux domaines conservés
trouvés précédemment : elles se situent dans les 70 premiers acides aminés de notre séquence et les 200 derniers. 
Entre ces domaines conservés il n'y a aucune similarité,ce qui confrme la pertinence de nos résultats concernant les
domaines conservés.

Ces résultats sont assez encourageants,notre séquence s'intègre bien au sein des séquences choisies pour notre 
groupe d'étude.Plus précisemment,on peut supposer que notre séquence sera proche des organismes Pmarinus sur notre
arbre phylogénique.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

                     10        20        30        40        50        60
                      |         |         |         |         |         |
Chydrogeno   ----------------MQER--YDFKAIEAKWQKKWEELKLYEVDDFS--EKPKYYCLEM
Fnodosum     -----------------MKE--YKPQEIESKWQGVWSEKKVFETPQYS--DKKKYYALVM
GOS_687010   ------------------------------------------------------------
Pmarinus1    -MISPDKQYES-----FTNL--YNPSEIEKKWQLIWTENNLYKTDELT-ENSDKFYALSM
Pmarinus2    -MISPDQQYET-----DTNL--YNPSEIEKKWQSIWTENNLYKTDELT-DNSDKFYALSM
Pmarinus3    -MIYSENTDEKS-NQHTNNL--YKPCEIENKWQEIWDKENLYKTDDKS-SKKEKFYALSM
Pmarinus4    -MITSENTDNR-----ATNL--YKPSDIEGKWQKIWEDDNLYNTDEQA-SNKEKFYALSM
Pmarinus5    -MASKISQTPE---KQPSTA--YDPLSIETRWQQSWKEQGLYKTKEPT-KSQKTFYALSM
Nostoc       ----------------MDSR--YNPATLEEKWQKTWVELGLDKTQTQS--NKPKFYALSM
Avariabili   ----------------MDSR--YNPAILEEKWQKTWVELGLDKTQTQS--NKPKFYALSM
Nspumigena   ----------------MDSR--YNPADIEEKWQQTWAELGLDKTPANS--HKPKFYALSM
Mchthonopl   ----------------MESR--YNPVEIEEKWQTSWSHQNLDQTQDKA--DKPKFYALSM
Amaxima      ----------------MESR--YNPASIEQKWQNTWAEQGLYQTHQDP--NKPKFYALSM
Cwatsonii    ----------------MESQ--YNAAAIEQKWQQQWVKQGLDKTPENS--DKPKFYALSM
Cyanothec2   ----------------MESQ--YNAAAIEQKWQQDWVKQGLDKTPENS--DKPKFYALSM
Cyanothec1   ----------------MESQ--YNAEAIEKKWQQTWVEMGIDKTPEDK--TKPKYYALSM
Amarina      ----------------MESR--YNPTEIEPKWQASWAKQGLDATPEDT--SKPKFYALSM
Telongatus   ----------------MDDR--YDPQVIEAKWQQEWAARQLDRTDTDP--QKPKFYALSM
Selongatus   MQNGANSRSQEYQGVSVDSR--YDPQAIETKWQQSWAAAQLDRTPEAD--DRPKFYALSM
Synechoco2   ----------------MEVR--YSPAEIEAKWQQYWADNALNKTSADLGPDAKKFYALSM
Pmarinus6    -MTESFPS--TSASSQSSAR--YDPIELETRWQKEWLRQGLDRTPVAE-TNQKRFYALSM
Pmarinus7    -MTESFPS--TSASSHSSAR--YDPIELETRWQKEWLRQGLDRTPVAE-TNQKRFYALSM
Synechoco1   -MTASKSSSATATASERPDR--YDPIALEQRWQSQWQHDDLYATRSPE-PGQNAFYALSM
Pchromatop   -MSESSAP-------QSIH---YQPAAIEKRWQNQWRNDRIYQTPQNS-DGE-AFYALSM
Psyringae    ----------------MHEL--YQPREIEAAAQTFWDEQKSFEVSEQP--GKETFYCLSM
Ymollareti   ----------------MQEQ--YRPEDIETQVQLHWQEKQTFKVTEDA--SKEKYYCLSM
Fnucleatum   ----------------MNKLRDYDFKEIEKKWQERWSKDNIFKTENKVE-GKENYYVLSM
                                                                         
Prim.cons.   MMI2S3S23ETSASSQMESRRDYNPAEIE2KWQQTWAEQGLDKTPEDS24NKPKFYALSM

                     70        80        90       100       110       120
                      |         |         |         |         |         |
Chydrogeno   FPYPSGKLHMGHVRNYSIGDVVARYKRMRGYAVLHPMGWDAFGLPAENAAIKHGNVHPAD
Fnodosum     FPYPSGTLHVGHVKNYVIGDIVARYKRMQGYNVLHPFGYDAFGLPAENAAIAH-KIHPKK
GOS_687010   ------------------------------------------------------------
Pmarinus1    FPYPSGNLHMGHVRNYVITDLIARFHRFKGKSVLHPMGWDAFGLPAENAAIER-GISPSV
Pmarinus2    FPYPSGNLHMGHVRNYVITDLIARFQRFKGKSVLHPMGWDAFGLPAENAAIER-GISPSV
Pmarinus3    FPYPSGNLHMGHVRNYVITDLIARFQRFQGKSLLHPMGWDAFGLPAENAAIER-GINPND
Pmarinus4    FPYPSGNLHMGHVRNYVITDLIARFQRFQGKVVLHPMGWDAFGLPAENAAIER-GINPDK
Pmarinus5    FPYPSGTLHMGHVRNYVITDVIARLHRMKGDSVLHPMGWDAFGLPAENAAIER-GIPADI
Nostoc       FPYPSGSLHMGHVRNYTITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAIDR-GVPPAK
Avariabili   FPYPSGSLHMGHVRNYTITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAIDR-GVPPAN
Nspumigena   FPYPSGSLHMGHVRNYTITDVIARLKRMQGYKVLHPMGWDAFGLPAENAAIDR-GVPPAK
Mchthonopl   FPYPSGNLHMGHVRNYTITDVIARKSRMQGYRVLHPMGWDAFGLPAENAAIQR-GVHPAK
Amaxima      FPYPSGSLHMGHVRNYTITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAIDR-GIPPQT
Cwatsonii    FPYPSGNLHMGHVRNYVITDVIARLKRLQGYRVLHPMGWDAFGLPAENAAIDR-NIPPAD
Cyanothec2   FPYPSGNLHMGHVRNYVITDVIARLKRLQGYRVLHPMGWDAFGLPAENAAIDR-NIPPAD
Cyanothec1   FPYPSGNLHMGHVRNYVITDVIARLKRMQGHRVLHPMGWDAFGLPAENAAIER-GIHPAK
Amarina      FPYPSGSLHVGHTRNYVITDVIARLKRMQGYRVLQPMGWDAFGLPAENAAIAR-GIHPAE
Telongatus   FPYPSGNLHMGHVRNYTITDVIARCRRMQGYRVLHPMGWDAFGLPAENAAIER-GIHPRV
Selongatus   FPYPSGNLHMGHVRNYTITDAIARVKRRQGFRVLHAMGWDAFGLPAENAAIDR-GVQPAD
Synechoco2   FPYPSGDLHMGHVRNYTITDVVARVRRMQGYNVLHPMGWDAFGLPAENAAIKR-GVPPAD
Pmarinus6    FPYPSGKLHMGHVRNYVITDVIARVQRMRGDAVLHPMGWDAFGLPAENAAIAR-NVDPGD
Pmarinus7    FPYPSGKLHMGHVRNYVITDVIARVQRMRGDAVLHPMGWDAFGLPAENAAIAR-NVDPGD
Synechoco1   FPYPSGTLHMGHVRNYVITDVIARAQRMRGDAVLHPMGWDAFGLPAENAAIER-QIDPGI
Pchromatop   FPYPSGKLHMGHVRNYVITDVIARAQRMRGKRVLHPMGWDAFGLPAENAAIER-GIDPSK
Psyringae    FPYPSGKLHMGHVRNYTIGDVISRYQRMLGKNVLQPLGWDAFGMPAENAAIDN-NVAPAK
Ymollareti   LPYPSGRLHMGHVRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAVKN-NTAPAP
Fnucleatum   LPYPSGKLHVGHARNYTIGDVISRYKRMKGYNVLQPMGWDSFGLPAENAAIQN-GTHPAI
                                                                         
Prim.cons.   FPYPSGNLHMGHVRNYVITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAIERGGIPPA2

                    130       140       150       160       170       180
                      |         |         |         |         |         |
Chydrogeno   WTWDNIANMRRQLKELGISYDWRREIATCHPEYYRWTQWLFLQFYKKGLAYKKKAPVNWC
Fnodosum     WTLDNINVIRGQIKKIGISYDWNREVITCTEDYYKWTQWVFLKLYEAGLAYKKPGAVNWC
GOS_687010   ------------------------------------------------------------
Pmarinus1    WTKQNISHMRSQLKLLGLSVDWDREFATCDENYYIWTQYLFLELYKAGLVYQKESEVNWD
Pmarinus2    WTKKNISHMKSQLKLLGLSVDWDREFATCDENYYVWTQYLFLELYKAGLVYQKESEVNWD
Pmarinus3    WTKKNIAHMKSQLKLLGLSVDWDKEFATCDENYYLWTQFLFLELHKSGLVYQKESEVNWD
Pmarinus4    WTKQNIAHMKSQLKLLGLSVDWDREFATCDENYYVWTQFLFLELHKAGLVYQKESEVNWD
Pmarinus5    WTYKNIEDMRNQLNRLGLSIDWDKEVTTCKEEYYKWTQYIFLELYEAGLAYQKSATVNWD
Nostoc       WTYQNITQMRQQLQRLGLSIDWDSEVATCSPDYYKWTQWIFLQFLQAGLAYQKEAAVNWD
Avariabili   WTYQNITQMRQQLQRLGLSIDWDSEVATCSPDYYKWTQWIFLQFLQAGLAYQKEAAVNWD
Nspumigena   WTYQNIAQMRQQLQRLGLAIDWETELATCSPDYYKWTQWIFLQFWQAGLAYQKEAAVNWD
Mchthonopl   WTYQNITQMQSELKRLGLSYDWNRELATCAPDYYKWTQWIFLQFLHAGLAYQKEAAVNWD
Amaxima      WTYQNIAQMREQLQRLGFSIDWDAEVTTCSPEYYRWTQWIFLQFFQAGLAYQKESAVNWD
Cwatsonii    WTKQNIAQMRQQLQTLGLSIDWDREVATCFPDYYKWTQWLFLQFYQSGLAYQKEAAVNWD
Cyanothec2   WTYKNIAQMKQQLQTLGLSIDWDREVATCSPDYYKWTQWLFLQFYQAGLAYQKEAAVNWD
Cyanothec1   WTYQNIAQMKQQLQQLGLSIDWNREVTTCSPDYYKWTQWLFLQFFQAGLAYQKEAAVNWD
Amarina      WTYANMAQMKKQLEPLGLSIDWSREIATCSPDYYRWTQWIFLQFLDMGLAYQKEAAVNWD
Telongatus   WTQQNIGQMRQELQRLGLSYDWEREVTTCHPDYYRWTQWLFLEFFEAGLAYQKEAAVNWD
Selongatus   WTYQNVAQMREQLKQLGLSYDWDREVTTCSPDYYRWTQWLFLQFFEAGLAYQKEATVNWD
Synechoco2   WTLKNIAQMRDQLKALGLSYDWNLEVATCLPNYYRWTQWIFLQFFESGLAYQKEAAVNWD
Pmarinus6    WTDQNIAQMRAQLDRLGLSIDWDRQQATCHQDYYRWTQWLFLELFAGGLAYQKEATVNWD
Pmarinus7    WTDQNIAQMRAQLDRLGLSIDWDRQQATCHQDYYRWTQWLFLELFAGGLAYQKEATVNWD
Synechoco1   WTDRNIEQMKAQLDRLGLSIDWSREQATCHADYYRWTQWLFLELLDQGLAYQKDATVNWD
Pchromatop   WTNTNIQQMRKQLDQLGLSIDWEREISTCNEDYYRWTQWLFLQFYDAGLAYQQEATVNWD
Psyringae    WTYENIAYMKNQLKSLGLAVDWSREVTTCKPDYYRWEQWLFTRLFEKGVIYRKNGTVNWD
Ymollareti   WTYDNIEYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYEKGMVYKKTSAVNWC
Fnucleatum   WTKSNIENMRRQLKLMGFSYDWEREIASYTPEYYKWNQWLFKRMYEKGLIYKKKSLVNWC
                                                                         
Prim.cons.   WTYQNIAQMRQQLKRLGLSIDWDREVATCSPDYYRWTQWLFLQFYEAGLAYQKEAAVNWD

                    190       200       210       220       230       240
                      |         |         |         |         |         |
Chydrogeno   PGCQTVLANEQVI-DGECERCHSRVEKKELEQWFFKITAYAERLLQDIKKLTG-WPEKVK
Fnodosum     PSCQTVLANEQVK-DGKCERCGTTVTMKYLEQWYFKITDYAEKLLEGLDRLPG-WPEHVK
GOS_687010   ------------------------------------------------------------
Pmarinus1    PVDNTVLANEQVDSEGKSWRSGAVVEKKLLKQWFLRITNYADELLKDLEKLDN-WPERVK
Pmarinus2    PIDNTVLANEQVDSEGKSWRSGAIVEKKLLKQWFLRITNYADELLKDLEKLDN-WPERVK
Pmarinus3    PIDNTVLANEQVDSEGKSWRSGAKVEKKLLTQWFLKITNYTEELLQDLEKLSE-WPERVK
Pmarinus4    PIDNTVLANEQVDSEGKSWRSGAIVEKKLLTQWFLKITDYAEELLQDLEKLNE-WPERVK
Pmarinus5    PIDKTVLANEQVDANGRSWRSGALVEKKKLKQWFLKITDFADELLEDIELLSG-WPQNVK
Nostoc       PIDQTVLANEQVDNEGRSWRSGAIVERKLLRQWFLKITDYAEELLNDLDKLTG-WPERVK
Avariabili   PIDQTVLANEQVDNEGRSWRSGAIVERKLLRQWFLKITDYAEELLNDLDKLTG-WPERVK
Nspumigena   PIDQTVIANEQVDNEGRSWRSGAKVERKLLRQWFLKITDYAEELLNDLDKLTG-WPERVK
Mchthonopl   PIDQTVLANEQVDSEGRSWRSGAKVERKLLRQWFLKITDYAEQLLNDLDKLDG-WPERVK
Amaxima      PIDQTVLANEQVDNEGRSWRSGAIVERKLLRQWFLKITDYAEELLNDLEKLPG-WPERVK
Cwatsonii    PIDQTVLANEQVDSEGYSWRSGAKVERKLLRQWFLKITDYAEQLLTDLDKLSG-WPDRVK
Cyanothec2   PIDQTVLANEQVDSEGYSWRSGAKVERKLLRQWFFKITDYAEQLLTDLDKLSG-WPDRVK
Cyanothec1   PIDQTVLANEQVDAEGKSWRSGAKVERKLLRQWFLKITDYAEQLLNDLDKLTG-WPERVK
Amarina      PVDQTVLANEQVDNEGRSWRSGAKVERKLLRQWFLKITDYAEELLTDLDKLTG-WPERVK
Telongatus   PVDQTVLANEQVDSEGRSWRSGALVERRLLKQWFLKITAYAEELLNDLEQLTG-WPERVK
Selongatus   PIDQTVLANEQVDSEGRSWRSGAKVERRQLKQWFLKITDYAEELLQDLDQLTG-WPERVR
Synechoco2   PIDQTVLANEQVDSEGRSWRSGAKVERKLLKQWFFKITEYADQLLNDLDKLPG-WPNRVK
Pmarinus6    PVDKTVLANEQVDGEGRSWRSGALVEQRQLKQWFLRITDYADALIDDLDELTG-WPERVR
Pmarinus7    PIDKTVLANEQVDGEGRSWRSGALVEQRQLKQWFLRITDYADALIDDLDELTG-WPERVR
Synechoco1   PVDQTVLANEQVDSEGRSWRSGALVEQKNLRQWFLRITHYADALLDDLDLLNG-WPERVR
Pchromatop   PIDQTVLANEQVNGDGCSWRSGAKVEKRKLRQWFLRITNYAEILLRDLDQLTG-WPERVR
Psyringae    PIDQTVLANEQVIDGRGWR-SGALIEKREIPMYYFKITAYADELLESLDELPG-WPEQVK
Ymollareti   PHDLTVLANEQVIDGCCWR-CDTKVERKEIPQWFIKITDYADQLLNDLDTLES-WPEQVK
Fnucleatum   PDCQTVLANEQVEDGMCWRHSKTHVIQKELEQWFFKITDYVDELLEGHEEIKDGWPEKVL
                                                                         
Prim.cons.   PIDQTVLANEQVDSEGRSWRSGAKVERKLLRQWFLKITDYAEELLNDLDKLTGGWPERVK

                    250       260       270       280       290       300
                      |         |         |         |         |         |
Chydrogeno   IMQENWIGRSEGAEITFKIKG-----HEETISVFTTRPDTIFGVTYMVLAPEHPLVEKIS
Fnodosum     TMQRNWIGKSTGAEVDFPVDG-----MDRKIRIFTTRPDTIYGVTFMAIAPESPLVMELV
GOS_687010   ------------------------------------------------------------
Pmarinus1    IMQDNWIGKSIGTNINFNLNT----NPEEKITVFTTRPDTLFGVTYLAISVNHSLIKYIS
Pmarinus2    IMQDNWIGKSIGTNINFNINT----HPEKKLTVFTTRPDTLFGVTYLAISVNHSLIKNIS
Pmarinus3    IMQENWIGKSKGANIIFKINE----FENEKIKVFTTRPDTLFGVTYIAISINNPLINKIS
Pmarinus4    IMQENWIGKSIGTNINFKIKE----FKKEKIQVFTTRPDTLFGVTYLAISVNHPLIKKIS
Pmarinus5    TMQQNWIGRSNGTEIDFYIKG----KNNIFITVFTTRPDTLHGTEYLVLAPDHELINSII
Nostoc       LMQANWIGKSSGAYLEFPIVG-----SNEKIAVYTTRPDTVYGVSYVVLAPEHPLTKQVT
Avariabili   LMQANWIGKSVGAYLEFPIVG-----STEKIAVYTTRPDTVYGVSYVVLAPEHPLTKQVT
Nspumigena   LMQANWIGKSTGAYLEFPVVG-----MDEKIAVYTTRPDTIYGVSYLVLAPEHPLTQVVT
Mchthonopl   LMQANWIGKSVGAYLEFPIIG-----LEEKIGVFTTRPDTVYGVTYVVLAPEHPLTPKVT
Amaxima      LMQANWIGKSVGARLDFPIVG-----VDDQISVFTTRPDTVYGVTYVVLAPEHPLVAQVT
Cwatsonii    LMQENWIGKSVGAYLEFPVKD-----SDEKIAVFTTRPDTVYGVTYVVLAPEHPLTQKVT
Cyanothec2   LMQENWIGKSVGAYLEFPVKD-----SDEKIAVFTTRPDTVYGVTYVVLAPEHPLTPKVT
Cyanothec1   LMQANWIGKSIGAYLEFPVVG-----MDEKIAVFTTRPDTVYGVTYVVLAPEHPLTPKVT
Amarina      TMQANWIGKSVGAYLEFPIVG-----MDEKVAVFTTRPDTVYGVTYVVLAPEHPLTPQVT
Telongatus   LMQANWIGQSRGAYLEFPIVG-----SDEKIGVFTTRPDTVYGVTYVVLAPEHPLTLKVT
Selongatus   LMQANWIGKSTGAYLEFPIVN-----SSDRVKVFTTRPDTVYGVSYVVLAPEHPLVTQVT
Synechoco2   TMQANWIGKSKGAQVTFQTG-------AGELEVYTTRPDTLWGATFMVVSPEHPLMEKLT
Pmarinus6    TMQANWIGRSHGAEIKFRVAG----VANSIITVFTTRPDTLHGASYVVLAPEHPLVESLT
Pmarinus7    TMQANWIGRSHGAEIKFRVAG----QTNSIITVFTTRPDTLHGASYVVLAPEHPLVEALT
Synechoco1   TMQANWIGRSIGAEIDFRVSG----HDDALITVFTTRADTLHGVSYVVLAPEHPLVDALT
Pchromatop   TMQANWIGRSKGCELSFLIYNEEDRLTDQFITVFTTRPDTICGISYIAVSVDHDIVSQSL
Psyringae    TMQRNWIGRSRGMEVQFPYDQASI-GEAGALKVFTTRPDTLMGATYVAVAAEHPLATLAA
Ymollareti   TMQRNWIGRSEGVDIVFDVADS-----EDKLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA
Fnucleatum   TMQKNWIGKSFGTELKLKVVET-----GEDLPIFTTRIDTIYGVSYAVVAPEHPIVEKIL
                                                                         
Prim.cons.   TMQANWIGKSVGAYLEFPIVG422R2SDEKI2VFTTRPDT2YGVTYVVLAPEHPL22KVT

                    310       320       330       340       350       360
                      |         |         |         |         |         |
Chydrogeno   RGTQYEKDVLEFKRKMMYLSEIERTAETAEKEGVFTGAYAINPFTGEEIPILLANYVLVE
Fnodosum     TEDK-KKEVEEFLAKVALEDRFKRTSVEAKKEGVFLGRYAINPLTNEKIPIYVANYILYE
GOS_687010   ------------------------------------------------------------
Pmarinus1    DQET-IQDIENLKQYLKNNKNNELE-----KIGIKTSLIAINPINSEPIPIWVASYVLDE
Pmarinus2    DQET-IQHIENLKKYLKKNKNNELE-----KIGIKTSLIAINPVNSEPIPIWVASYVLDE
Pmarinus3    DNEI-LSKLENLKIYLKKNQDKDQK-----KIGIPTNLKAINPINSNEIPIWIASYVLDE
Pmarinus4    DNKI-LSKLENLKIYLQESKDKDQK-----KIGIPTNLIAINPINSKEIPILIASYVLDE
Pmarinus5    DKNK-ITELEQFRTEISILTDQERTSDGNNKRGMFLGCHAINPINKKIIPIWVGEYVLSS
Nostoc       TKTQ-QAAVDTFIQEVTNQSELERTAEDKPKRGIATGGKAINPFTGEEVPIWIADYVLYE
Avariabili   SKTQ-QAVVDTFIQEVTNQSELERTAEDKPKRGVATGGKAINPFTGEEVPIWIADYVLYE
Nspumigena   TPEQ-KTAVAAFIQEVSQQSELERTAEDKPKRGIPTGGKVFNPFTGEEVPIWIADYVLYE
Mchthonopl   TPDR-KTEVDAFIQEVTQESELERTAEDKPKRGIPTGGKAINPFTGEEIPIWIADYVLYE
Amaxima      TKDR-KAEVEAFIKQVTAESEMERTAEDKPKRGIPTGGKAINPFTKKEVPIWIADYVLYE
Cwatsonii    VAQQ-KAAVDAFIEEVSNESEIERTAEDKPKRGILTGGTVINPFNGEEIPILIADYVLYE
Cyanothec2   TEEQ-KTAVEAFIEAVSNESEIERTAEDKPKRGILTGGTAINPFNGEEIPILIADYVLYE
Cyanothec1   TPKN-KKAVEKFIKEVTSESEIERTAEDKPKKGILTGGKAINPFTGEQVPILIANYVLYE
Amarina      SKAQ-KKAVDKFIEAVGAESEMDRTAEDKPKKGIPTGGKAINPFTGEEIPIWIADYVLYE
Telongatus   TSRR-RKTVEAFIASVQQESELERTAGDRPKRGVATGGKALNPFTGEEIPIWIANYVLYE
Selongatus   TPEQ-QTAVAAFAAEVSQTSELERTAEDRPKRGVPTGGFVTNPFTGQAVPIWIADYVLVE
Synechoco2   TSEQ-AEAVQAYRAAAAELSTIDRTDEGREKTGVWTGSMATNPVNGEEIPIWTADYVMMD
Pmarinus6    SPEQ-RLAVTAFCDLISQLSVKDRTAEDQPKRGVPIGAQVINPVNGESLPVWIADYVLAD
Pmarinus7    SPQQ-RIAVTAFCDLISQLSVKDRTAEDQPKRGVPIGAQVINPVNGESLPVWIADYVLAD
Synechoco1   SDKQ-RESVAAFRDLVSELSADERTADDRPKRGVPIGATAVNPVNGESIPIWIADYVLAG
Pchromatop   MTND-RSRIQRFCKEISFQKDNNHISSDQIKQGIPLGKYACHPLNGRRIPIWIADYVLAD
Psyringae    QGNP---ALQAFIDECKGGSVAEADVATQEKKGQPTSLFVEHPLTGEKLPVWVANYVLMH
Ymollareti   ETNP---ALADFVAECRNTKVAEAEMATMEKKGMATGLYAIHPLTGEKLAIWAANFVLMD
Fnucleatum   KVNP---SIKDKVTEMKNTDIIERGAEGREKNGIDSGWHIENPVNKEIVPLWIADYVLMN
                                                                         
Prim.cons.   TPEQYK2AVEAFI2EVSNESE2ERTAEDKPKRGIPTGGKAINPF2GEEIPIWIADYVLYE

                    370       380       390       400       410       420
                      |         |         |         |         |         |
Chydrogeno   YGTGAVMGVPAHDQRDFLFAKKYNLPIKVVITPPGQELKAEELTE---------------
Fnodosum     YGTGAIMAVPAHDQRDYDFAKTYNLPIKQVIKPKDGEWNINER-----------------
GOS_687010   ------------------------------------------------------------
Pmarinus1    YGTGAVMGVPAHDQRDFEFAKKNNIDIKQVIINDKS--EKTNELD---------------
Pmarinus2    YGTGAVMGVPAHDLRDFEFAKKNNIDIKQVIIKDKS--EQNKELD---------------
Pmarinus3    YGTGAVMGVPAHDQRDFEFAKINFIDIKQVIIKDKDNDKSTFKLK---------------
Pmarinus4    YGTGAVMGVPAHDERDFEFAKINSIDIKQVIIKEKD--KITSQLT---------------
Pmarinus5    YATGAVMGVPAHDKRDYKFAKKYSLPIQYVIKSPSQ-EASDLEAS---------------
Nostoc       YGTGAVMGVPAHDVRDFKFAQRYDLPIDFVIAAPDDVAGFDLSPTSETEEVTQVVQIEYN
Avariabili   YGTGAVMGVPAHDVRDFKFAQRYDLPIDFVIAAPDDVAGFDLSPTSETEEVTQVVQIEYN
Nspumigena   YGTGAVMGVPAHDVRDFKFARVYNLPIEFVIASPEDVADFDLTPTSETEEITKLIKIEYN
Mchthonopl   YGTGAVMGVPAHDARDFQFAKEQQLPIKTVIV-PADAADPKAEPK---------------
Amaxima      YGTGAVMGVPAHDVRDFAFATQYNLPIRQVIV--PDDADNDNDPDDE-----------VK
Cwatsonii    YGTGAVMGVPAHDTRDFKFATEKQLPIKVVIVP-ENSEDNNPTLT---------------
Cyanothec2   YGTGAVMGVPAHDTRDFKFATEKQLPIKVVIVP-ENSEDSNPTLT---------------
Cyanothec1   YGTGAVMGVPAHDVRDFKFAKENKLPIRVVIVP-EDAGDKDTPLT---------------
Amarina      YGTGAVMGVPAHDTRDFVFAQQNKLPIQTVIVP-E-GGDAETPLE---------------
Telongatus   YGTGAVMGVPAHDERDFQFAKAHRLPIRQVIIPPD--GKASTRLR---------------
Selongatus   YGTGAVMGVPAHDSRDFAFAQRYGLPVQPVIQPTE--GAIAEPWP---------------
Synechoco2   YGTGAIMAVPAHDQRDFEFARKFDLPIKVVVQP-EGESFEGATMS---------------
Pmarinus6    YGSGAVMGVPAHDERDFIFARSHELPIRIVVQLPDTDE----HHNDG-------------
Pmarinus7    YGSGAVMGVPAHDERDFIFARSHELPIRIVVQMPDSDE----HHNDG-------------
Synechoco1   YGTGAVMGVPAHDERDFLFARTYELPVKRVILAAGANE----HLSDG-------------
Pchromatop   HGTGAVMGVPAHDQRDFIFAHSYGLIIKPVIISENTNHNQLSFSNIQ-------------
Psyringae    YGDGAVMAVPAHDERDFEFASKYDLPIKPVVRTSAGDET--PAPW--------------Q
Ymollareti   YGTGAVMAVPGHDARDWEFATKYNLPIKPVILAADGSE---PDVT--------------K
Fnucleatum   YGTGAVMGVPAHDERDFVFAGKYNLPVKQVITSKKADE----KV---------------E
                                                                         
Prim.cons.   YGTGAVMGVPAHDERDF2FAKKYNLPIKQVI2PP2DDED4D22LTDETEEVTQVVQIEYN

                    430       440       450       460       470       480
                      |         |         |         |         |         |
Chydrogeno   -AYTGEGILVNSGEFTGLANKEAIR----IITQEAEKRGFGKYRVNYRLRDWLISRQRYW
Fnodosum     -PYEEEGIMINSGPFDGLESSKGIE----EVTKYIEEKGFGKKSVQYKLRDWLISRQRYW
GOS_687010   ------------------------------------------------------------
Pmarinus1    KAYVENGYLMNSDQYNFMENTIAKL----KISEEGVDNGWAENKIQYRLRDWLISRQRYW
Pmarinus2    EAYVENGYLINSNQYDGVANTIAKL----KISEEGVNNRWAENKTQYRLRDWLISRQRYW
Pmarinus3    NAFTDNGFLINSNNFNGLCNNDAKK----QILEQGKINGWAEEEIHYRLRDWLISRQRYW
Pmarinus4    NAFTDNGFLINSNNFDGLNNSDAKK----HISEHGERNGWAENKIQFRLRDWLISRQRYW
Pmarinus5    SAYVKEGIMINSGEFNGINSKEAGF----MITKLGVKQGWAKNKVTYKLRDWLISRQRMW
Nostoc       QAYTEPGILINSGAFTGMTSTDAKQ----AIVKYATEKGFGKERIQYRLRDWLISRQRYW
Avariabili   QAYTEPGILINSGAFTGMTSTDAKQ----AIVKYATEKGFGKERIQYRLRDWLISRQRYW
Nspumigena   EAYTEPGILINSGSFTGMNSPDAKA----AIIKYAEEQNFGKLRIQYRLRDWLISRQRYW
Mchthonopl   QAYTEPGVVVNSDLFNGMESISAKA----EIVNYAERKGWGKARIQYRLRDWLISRQRYW
Amaxima      QAYTEPGIMVDSGPFSGEHSSHGKQ----AVIEYAEDEGYGEGRVQYRLRDWLISRQRYW
Cwatsonii    EAYTEPGIMVNSGDFDGMQSTEGKT----AIIDYAEKQGYGKARIQYRLRDWLISRQRYW
Cyanothec2   EAYTEPGIMVNSGEFDGMPSTEGKT----AIVNHAEKQGYGKARIQYRLRDWLISRQRYW
Cyanothec1   EAYTDPGIMVNSDSFNGMDSTKGKT----AIIDYAENNGFGKARVQYRLRDWLISRQRYW
Amarina      AAYTEPGLMVNSGEFDGKVSTEGKQ----AIIAKAETKGWGKARVQYRLRDWLISRQRYW
Telongatus   AAYTEPGKLINSGQFDGMDSTAAKV----AITEYATAQGWGREHVQYRLRDWLISRQRYW
Selongatus   APFTEAGVMVNSGQFDGLSSTEAKA----KIIAFAEEQGWGQAHVQYRLRDWLISRQRYW
Synechoco2   AAYPHDGVMVNSGPLDGVPAGKGKKKSVGRAIAYLQEHSLGKGTTNYRLRDWLVSRQRYW
Pmarinus6    QAWTGAGVLVNSGAFDGLSTEEAKV----AITTHGASEGWAQSKVQYRLRDWLISRQRYW
Pmarinus7    QAWTGAGVLVNSGAFDGLSTEEGKV----AITTHGASKGWAQSKVQYRLRDWLISRQRYW
Synechoco1   EAWTGPGILLNSGRFDGQSSDDARQ----AITAHGHDLGWARPKRQFRLRDWLISRQRYW
Pchromatop   SAFIDLGKLIKSGIFDSLSSEEAGE----AILSQAQLARWGQSKITYKLHDWLISRQRYW
Psyringae    AEYNEQGPLINSGEFTGLHFQDAFD----AIEAALVKKALGQSRTQFRLRDWGISRQRYW
Ymollareti   EALTEKGVLFNSGEFDGLDYEEGFN----AIADKLVALGVGQRKVNYRLRDWGVSRQRYW
Fnucleatum   LPYIEEGVMINSGEFNGLSSKDALV----KIAEYVEEKSYGQRTYKYRLKDWGISRQRYW
                                                                         
Prim.cons.   EAYTEPGILINSGEFDGLSSTEAKQKSVGAI2EYAEEKGWGKARVQYRLRDWLISRQRYW

                    490       500       510       520       530       540
                      |         |         |         |         |         |
Chydrogeno   GAPIPVLYCEKCGIVPVPEDQLPVVLPYNVEFRPTGESPLKYVPEFLNATCPECGGPATR
Fnodosum     GAPIPIVYCEKCGIVPVPEKDLPVRLPENVEFLPTGQSPLTLSEEFKHTTCPKCGGPAHR
GOS_687010   ------------------------------------------------------------
Pmarinus1    GCPIPIVNCKKCGSVPLKQSELPVALPKDIDISANKINALGDNNHWINTTCPKCGIAAKK
Pmarinus2    GCPIPIVNCKKCGSVPLNQSELPVALPKDIDISANKINALGDNKNWVNTTCPKCGIAAKK
Pmarinus3    GCPIPIIKCNNCGSIPVNKKNLPVKLPKEIEISSNKINSLGSYKDWVKTTCPKCGNLASR
Pmarinus4    GCPIPIIKCTNCGSVPVNKKDIPVRLPNEIKISSNKINSLGSNQSWINTTCPKCGNLASR
Pmarinus5    GCPIPIIYCPDCGSVPVKREELPVKLTNPSVIGKSQEN----KNNIPIMKCSKCNKDSIL
Nostoc       GAPIPVIHCPNCGIVPVPDKDLPVILPEEVEFTGRGGSPLAQLESWVNVPCPTCGTPAKR
Avariabili   GAPIPVIHCPNCGIVPVPDKDLPVILPEEVEFTGRGGSPLAQLESWVNVPCPTCGSPAKR
Nspumigena   GAPIPVIHCPNCGIVPVPDEDLPVKLPEEVELTGRGGSPLTQLESWVNVPCPTCGTPAKR
Mchthonopl   GAPIPVIYCPDCGIVPVPEQDLPVALPENVAMSGGRVASLSQVEGWVDVPCPTCGTAAKR
Amaxima      GCPIPIIHCPDCGAVPVPDGDLPVKLPQNVEFSGRGPSPLATLEDWVNVPCPSCGTPAKR
Cwatsonii    GCPIPVVHCPNCGTVPVPDADLPVKLPENVEFTGRGASPLAKMDDWINVPCPNCSGPAKR
Cyanothec2   GCPIPVVHCPSCGTVPVPNADLPVKLPENVEFTGRGASPLAKMEDWINVPCPSCGEPAKR
Cyanothec1   GCPIPVIHCPSCGTVPVPDADLPVKLPEDVEFSGRGASPLAKLDHWINVSCPSCGEPAKR
Amarina      GVPIPVIHCPNCGAVPVPEADLPVELPEDVEFSAQGGSPLAKLESWVNVACPNCGADAKR
Telongatus   GVPIPIIHCPQCGPVPVPRSELPVLLPEEVEFTGRGPSPLAKLAAWRDVPCPKCGGPAQR
Selongatus   GCPIPIVHCPDCG--PVAAADLPVQLPDSVQFSGRGPSPLAQLEDWVTTTCPSCGKPARR
Synechoco2   GAPIPVIHCPKCGTVPVPEVDLPVKLPENVEFTGKSVPSLAKFDDWVNVACPSCGTGAQR
Pmarinus6    GCPIPIIHCASCGIVPVPQEDLPVTLPRDIDLSGKGGSPIAQEQAWVEVKCPICGEKAHR
Pmarinus7    GCPIPIIHCASCGIVPVPQEDLPVTLPRDIDLSGKGGSPLAQEQDWVEVKCPICGEKAHR
Synechoco1   GCPIPVIHCDHCGAVPVPADQLPVTLPKDVDLQGKGGSPLASLESWVAVDCPTCGRPARR
Pchromatop   GCPIPIIHCQSCGTVPVPTTDLPVELPKNLNLQGKGGSPLSLVSKWVKTSCPKCGQIAQR
Psyringae    GCPIPIVHCDTCGDVPVPEDQLPVILPEDVVPDGAGSP-LARMPQFYECSCPKCGAPAKR
Ymollareti   GAPIPMVTLEDGTVVPTPEDQLPVILPEDVVMDGISSP-IKADPEWAKTTVN--GMPGLR
Fnucleatum   GTPIPVLYCEKCGEVLEKDENLPVLLPDDIEFSGNGNP-LETSNKFKEATCPCCGGKARR
                                                                         
Prim.cons.   GCPIPIIHCPNCGIVPVP23DLPVKLPEDVEFSGRGGSPLAQLEDWVNVTCPKCG2PAKR

                    550       560       570       580       590       600
                      |         |         |         |         |         |
Chydrogeno   ETDTMDTFICSSWYYYRYTSPRDKQQPWSKEKVERWLPVDQYIGGVEHAILHLLYSRFFT
Fnodosum     EVETMDTFVDSSWYFLRYVNPKLDDKPFESDDVNYWLPVDQYIGGVEHAVLHLLYSRFIT
GOS_687010   ----------------RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFT
Pmarinus1    ETDTMDTFMCSSWYFLRYPSSKCSNKPFEKIEINKWLPVDQYVGGVEHAILHLLYARFFT
Pmarinus2    ETDTMDTFMCSSWYFLRYPSSKCPNKPFEKIEINKWLPVDQYVGGVEHAILHLLYARFFT
Pmarinus3    ETDTMDTFMCSSWYFLRYPSSKCKTKPFEKDNVNKWLPVDQYVGGVEHAILHLLYARFLT
Pmarinus4    ETDTMDTFMCSSWYFLRYPSSKSLTKPFEKEKINKWLPVDQYVGGVEHAILHLLYARFLT
Pmarinus5    ETDTMDTFMCSSWYFLRYIDVENNKLPFTKTEVDKWLPVDQYVGGIEHAILHLLYSRFLI
Nostoc       ETDTMDTFIDSSWYFLRFTDARNEAQVFESAKTNDWMPVDQYVGGIEHAILHLLYSRFFT
Avariabili   ETDTMDTFIDSSWYFLRFTDARNEAQVFESAKTNDWMPVDQYVGGIEHAILHLLYSRFFT
Nspumigena   ETDTMDTFIDSSWYFLRYPDAQNEQQVFDPAKTNDWMPVDQYVGGIEHAILHLLYSRFFT
Mchthonopl   ETDTMDTFIDSSWYFLRYPDANNDQQVFDSSKTNDWMPVDQYVGGIEHAILHLLYSRFFT
Amaxima      ETDTMDTFIDSSWYFLRYPDAKNADQVFDVAQTNDWMPVDQYVGGIEHAILHLLYSRFFT
Cwatsonii    ETDTMDTFVDSSWYYLRYTDAINDQEAFKLEKANDWMNVDQYVGGIEHAILHLLYSRFFT
Cyanothec2   ETDTMDTFIDSSWYYLRYTDAMNDQEAFKLEKANDWMNVDQYVGGIEHAILHLLYSRFFT
Cyanothec1   ETDTMDTFIDSSWYFLRYSDANNEQEAFNLKEVNDWMAVDQYVGGIEHAILHLLYSRFFT
Amarina      ETDTMDTFIDSSWYFLRYPDAKNDKAVFDSAKTNDWLPVDQYVGGIEHAILHLLYSRFFT
Telongatus   ETDTMDTFIDSSWYYFRYADARNSEAPFDPAAIKDWLPVDQYVGGIEHAILHLLYSRFFT
Selongatus   ETDTMDTFMCSSWYYLRYSDASNPEIAFTKDKVNDWLPVDQYVGGIEHAILHLLYSRFFT
Synechoco2   ETDTMDTFLDSSWYFLRYADANNEENVFSKDRVNKWLPVDQYVGGIEHAILHLLYSRFFT
Pmarinus6    ETDTMDTFMCSSWYYLRFADPLNSQRPFDKDIVDEWLPVDQYVGGIEHAILHLLYARFFT
Pmarinus7    ETDTMDTFMCSSWYYLRFADPLNSQRPFDKDIVDEWLPVDQYVGGIEHAILHLLYARFFT
Synechoco1   ESDTMDTFMCSSWYFLRFADPHNMERPFDPDAVERWLPVQQYVGGIEHAILHLLYSRFFT
Pchromatop   ETDTMDTFMCSSWYFLRYSDPSNKKEPFSSEKIQDWLPVNHYVGGIEHAILHLLYSRFFT
Psyringae    ETDTMDTFVESSWYYARYASPHYEGGLVEPNAANHWLPVDQYIGGIEHAILHLLYARFFH
Ymollareti   ETDTFDTFMESSWYYARYTCPQYDEGMLDPAAANYWLPVDQYVGGIEHAIMHLMYFRFFH
Fnucleatum   DTDTMDTFVDSSWYFLRYCDPKNINLPFSKEIVDKWTPVDQYIGGVEHAVMHLLYARFFY
                             *:               . *  *::*:**:***::**:* **: 
Prim.cons.   ETDTMDTFMDSSWYFLRYPDAKN2Q2PF2K2KVNDWLPVDQYVGGIEHAILHLLYSRFFT

                    610       620       630       640       650       660
                      |         |         |         |         |         |
Chydrogeno   KVLYDLGLVHVDEPFTNLLTQGMVL-------KDG-------------------------
Fnodosum     KVLHDLGYLKFDEPFENLFTQGMIY-------KDG-------------------------
GOS_687010   KALRDNELFDIDEPFKKLLTQGMVQAAAYKNNKTG---KYVSPSDISDLSN---PTDPID
Pmarinus1    KALRDNELFEIDEPFKKLLTQGMVQAAAYKNNKTG---KYVSPSDINDLSN---PTDPID
Pmarinus2    KALRDNQLFEIDEPFKKLLTQGMVQAAAYKNNKTG---KYVSPSDINDLSN---PTDPID
Pmarinus3    KALRDNNLFDIDEPFKKLLTQGMVQAAAYKNTKTG---KYISPKDIKDFNN---PTDPND
Pmarinus4    KALRDNNLFDIDEPFKRLLTQGMVQSAAYKNSITG---KYISPTDIKDITN---PKDPKD
Pmarinus5    KALRNRGLLNIKEPFSNLLTQGMVQGVTFKNPKTS---KYISPDHINDINT---PLDPET
Nostoc       KVLRDRGLLNFDEPFERLLTQGMVQGLTYFNPNKGGKDKWVPSHLVN-PND---PRDPQT
Avariabili   KVLRDRGLLNFDEPFERLLTQGMVQGLTYFNPNKGGKDKWVPSHLVN-PND---PRDPQT
Nspumigena   KVLRDRGLLNFDEPFQRLLTQGMVQGLTYMNPNKGGKDKWVPSNLVN-AAD---PRDPQT
Mchthonopl   KVLRDRGLLNFDEPFQRLLTQGMVQGLTYMNPKTG---KWVPSVDVN-PSD---PKDPET
Amaxima      KVLRDRNLLKFDEPFQRLLTQGMVQGITYKNPKTG---KYIPPNLVN-TNE---PKDPET
Cwatsonii    KVLRDRGLVNVDEPFNRLLTQGMVQAMAYKNPKTG---KYIPVDKVN-PES---PKDPDT
Cyanothec2   KVLRDRGLVNVDEPFNRLLTQGMVQGITYKNRKAD---KYIPVDKVN-PES---PKDPDT
Cyanothec1   KVVRDRGLVNIDEPFQRLLTQGMVQGMTYKNPKTG---KYIPSAQVN-PND---PKDPET
Amarina      KVMRDRKLLNFDEPFKKLLTQGMVQALTYKNPETG---QYIAPINVD-ADD---PKDPET
Telongatus   KVLRDRQLVHVSEPFQRLLTQGMVQGRTYKNPRTG---KYVIPSRIADLNQ---PTDPDT
Selongatus   KVLRDRGLLSFDEPFKRLLTQGMVQGLTYKNPKTG---KYVPSDRISDPSQ---PVDPDT
Synechoco2   KVLRDRGLLDFDEPFERLLTQGMVQAITYKTSDGQ----FIVPENIADLNN---PVDPDT
Pmarinus6    KALHDRNLIGFKEPFNRLLTQGMVQGLTYRNAKNG---SYISPELVSDDSD---PRDPES
Pmarinus7    KALHDRNLIGFKEPFNTLLTQGMVQGLTYRNTKNG---SYISPELVSDEGD---PRDPES
Synechoco1   KALRDRGLLNIREPFERLLTQGMVQGVTYRNPRTG---RYVAPSEVSDESA---PKDPLD
Pchromatop   KVLNDRGLLNFSEPFIRLLPQGMVQGITYKVPSTG---EYIPVDNITDLDN---PIDPNS
Psyringae    KLMRDEGLVTSNEPFKNLLTQGMVNAETYFRMETSGKKTWINPADVTLERDAKAKVISAT
Ymollareti   KLLRDAGLVDSDEPAKRLLCQGMVLADAFYYTGTGGERIWVSPVDAIVERDDKGRIIKAT
Fnucleatum   KVLRDLGLLSSNEPFKRLLTQGMVLGPSYYSEK---ENKYLFSKDVVIKGD---KAYSQS
             * : :   .   **   *: ***:                                    
Prim.cons.   KVLRDRGLLNFDEPFKRLLTQGMVQGLTYKNPKTGGKDKYIPP2DVNDPND2K2PKDPET

                    670       680       690       700       710       720
                      |         |         |         |         |         |
Chydrogeno   -------------AKMSKSKGNVVSPEEIVEKYGADTARLFILFAAPPERDLEWSDQGVE
Fnodosum     -------------WKMSKSKGNVVSPDDMINKYGADTLRMYILFMAPPEKDAEWNDAGID
GOS_687010   ----NSKLEVL-FEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVE
Pmarinus1    ----NTKLEVL-FEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVE
Pmarinus2    ----NTKLEIL-FEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVE
Pmarinus3    ----DSKLEVL-FEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDSDVE
Pmarinus4    ----NSKLEVL-FEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDSDVE
Pmarinus5    ----GEPLDVL-YEKMSKSKYNGVDPASVIDKYGTDTARMFILFKAPPEKDLEWDESDVE
Nostoc       ----GEPLQRL-YATMSKSKGNGVAPEDVIAKYGVDTARMFILFKAPPEKDLEWDEADVE
Avariabili   ----GEPLQRL-YATMSKSKGNGVAPEDVIAKYGVDTARMFILFKAPPEKDLEWDEADVE
Nspumigena   ----GEPLQRL-YATMSKSKGNGVAPEDVISKYGVDTARMFILFKAPPEKDLEWDEADVE
Mchthonopl   ----GETLEVS-YKTMSKSKYNGVAPEAVINKYGADTARMFILFKAPPEKDLEWDDADVE
Amaxima      ----GDRLQVF-FEKMSKSKYNGVDPLLVMEKYGADTARMFILFKAPPEKDLEWDDADVE
Cwatsonii    ----GDDLEVF-YEKMSKSKYNGVDPKTVLGKYGADTARMFILFKAPPEKDLEWDDADVE
Cyanothec2   ----GDDLDVF-YEKMSKSKYNGVDPQEVLGKYGADTARMFILFKAPPEKDLEWDDADVE
Cyanothec1   ----GDPLEVF-YEKMSKSKYNGVDPKQVLGKYGADTARMFILFKAPPEKDLEWDDADVE
Amarina      ----GAPLEAF-YEKMSKSKYNGVPPEEVTNKYGADTARLFTLFKAPPEKDLEWEGADVE
Telongatus   ----GEALEVV-YEKMSKSKYNGVAPGDVIQQYGADTARMFILFKAPPEKDLEWDDADVE
Selongatus   ----GDRLEVF-FEKMSKSKYNGVDPARVLDRYGADTARMFILFKAPPEKDLEWDDADVE
Synechoco2   ----GAPLKVS-FEKMSKSKFNGISPIAVLEKYGADTARMFILFKAPPEKDLEWDDADVE
Pmarinus6    ----GDRLEVL-FEKMSKSKYNGVDPAVVIDRYGADTARMFILFKAPPEKDLEWDDADVE
Pmarinus7    ----GDKLEIL-FEKMSKSKYNGVDPAVVIDRYGADTARMFILFKAPPEKDLEWDDADVE
Synechoco1   ----GGDLEVL-FEKMSKSKYNGVDPAAVIDRYGADTARMFILFKAPPEKDLEWDDADVE
Pchromatop   ----GEVLEVI-FEKMSKSKGNGVDPTRVIEHFGADTARMFILFKAPPEKDLEWNESDVE
Psyringae    LTSDGLPVEIGGTEKMSKSKKNGIDPQTMIDQYGADTCRLFMMFASPPDMSLEWSDSGVE
Ymollareti   -DAEGHELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVE
Fnucleatum   ----GEELQVK-VEKMSKSKNNGVDPEEMLDKYGADTTRLFIMFAAPPEKELEWNENGLA
                           .***** * : *  :  ::*.** *:: :* :*.:   **   .: 
Prim.cons.   L222GEPLEVLGFEKMSKSKYNGVDPESVIDKYGADTARMFILFKAPPEKDLEWDDADVE

                    730       740       750       760       770       780
                      |         |         |         |         |         |
Chydrogeno   GSFRFLNRVWRLIYQTKDRIS-------------DELREFSAKDKELNRLLHATIKKVTE
Fnodosum     GVNRFIKRLWNNYYKILDIINSN------DT---KNENEFGKEEKNLRRKLHAMIKKIKE
GOS_687010   GQFRFLSRIWKLYINCAKD--INSKSNSYP-----------DKEKSLIKSINIAIKEISN
Pmarinus1    GQFRFLNRIWKLYINCAKD--INSKSNSYP-----------DREKSLIKSMNIAIKEISN
Pmarinus2    GQFRFLSRIWKLYINCAKN--VNIKSNSYP-----------DKEKSLIKSMNIAIKEISN
Pmarinus3    GQYRFLCRIWKLFLDYRNNESWDNQKNYNR-----------EKENSLTKSINIAIKEISN
Pmarinus4    GQYRFLCRIWKLFLDYSNNDITHEADKLKK-----------ENESSLLKSINIAIKEISN
Pmarinus5    GQYRFLNRLWRIVIYSIETKDINISNCTQEI----LLNDLSDKERKLIKVLNNTIKEVTN
Nostoc       GQFRFLNRVWRLVTDYVASGVN-------PK---NKSGELSKSEKDLRRAIHTAIQSVTE
Avariabili   GQFRFLNRVWRLVTDYVASGVN-------PK---NKSGELSKSEKDLRRAIHSAIQSVTE
Nspumigena   GQFRFLNRVWRLVTDYATAGVSR------KK---AQLSDLSKPEKELRRAIHTAIQAVTE
Mchthonopl   GQFRFLNRVWRLVEEFAAKVTNR------ST---TIPPELSKPEKDLRRAVHTAIKEVTD
Amaxima      GQFRFLNRVWRLVTEFAANHSVS-----STK---STTGNLNKAEKDLRRAIHNAIKEVTE
Cwatsonii    GQFRFLNRVWRLVNGYAE---KQ-----PEV---ISNKELSKEEKGLRRAIHTAIKEISE
Cyanothec2   GQFRFLNRVWRLVNGYAE---KQ-----GEV---ISNQELSKEEKDLRRAIHTAIKEISE
Cyanothec1   GQFRFLNRVWRLVGDYIAN--HK-----PSK---KKNDSLTKVEQDLRRAIHIAIKEISD
Amarina      GQFRFLNRVWRLVSEHAAQAKGK-----KAK---VNKAKLSKTEKELRRSIHIAIKETSE
Telongatus   GQFRFLNRVWRLVQTFKAKGGRL----G--Q---PLPATLTKAEKDLRRAIHTAIKEISE
Selongatus   GQFRFLNRVWRLVQTASQVEATT--------------AADDKAEKDLRRAVHTAIQAFTE
Synechoco2   GQYRFLNRVWRAVIEFAQSDNAANLVSASDK---IDQSTLNKAEKTLRRATHTAIKEITE
Pmarinus6    GQFRFLQRLIRLIDSFAWPKTDGENASISSANLIIDSADLSEEEINMRRATHKAIEAITE
Pmarinus7    GQFRFLQRLIRLIDSFVWPKTDEDNASISSANLTISSADLSEEEINMRRATHMAIEAITE
Synechoco1   GQFRFLQRLWRLIES---VRSDHQDQLLSEPTVVPEGSVLSEQESGIRRAVHTAIEAVSD
Pchromatop   GQFRFLQRISRLVEMV--LKKGIRLNLKEDLSTTINSKKLNKDEQEVHRATHYAIAAITE
Psyringae    GSHRFLRRVWRLAQAHV----------GQGASGSLDIAALTDEQKAVRRSIHQAIKQASQ
Ymollareti   GANRFLKRVWRLVFDHT----------AKGATAPLDIASLTDEQKSLRRDLHKTIAKVTD
Fnucleatum   GAYRFLTRVWRLVFENSEL--------VKNANDEIDYNKLSKEDKALLIKLNQTIKKVTD
             *  **: *: .                                :  :    :  *   .:
Prim.cons.   GQFRFLNRVWRLVIDYAAN2S3N4KSNSSPKNLTIDSAELSKEEKDLRRAIHTAIKEITE

                    790       800       810       820       830       840
                      |         |         |         |         |         |
Chydrogeno   DIEERFNFNTAISAIMELVNGLYQY--KEGEINPG--LLKEALNKLVILLAPFAPHIAEE
Fnodosum     DIEGGFKFNTAIAGLMEFNNQLSDY--LENTKSPNKKLLREIAEKVVLILSPFAPHMAEE
GOS_687010   DILNN-QFNTAISELMKFYNSLSNS--INYVNNNLK---IDALKTFCILLAPFAPHIAEE
Pmarinus1    DILNN-QFNTAISELMKFYNSLANS--INDVNNTLK---IEALKTFCILLAPFAPHIAEE
Pmarinus2    DILNN-QFNTAISELMKFYNSLSNS--INDVNNNLK---IDALKTFCILLAPFAPHIAEE
Pmarinus3    DIKNN-QFNTAISELMKFYNSLSSS--MIYVNKDLR---KDAFKKFCILLAPFAPHIAEE
Pmarinus4    DIKNN-QFNTAISELMKFYNSISSN--LNYVNKDLR---RESLMKFCILLAPFAPHISDE
Pmarinus5    DLVNDFQFNTAISELMILCNSIYEN--IDDCGDYIV---TETFKKLTLLLAPFAPHIAEE
Nostoc       DLEDDYQFNTAISELMKLSNALTD---ANGKDSRVY---AEGIKTLVVLLAPFAPHIAEE
Avariabili   DLEDEYQFNTAISELMKLSNALTD---ANGKDSRVY---AEGIHTLVVLLAPFAPHIAEE
Nspumigena   DLEDEYQFNTAVSELMKLSNALTD---ADCKNSPIY---AEGIQTLVIMLAPFAPHIADE
Mchthonopl   DLDGEYQFNTAVSELMKLSNALGD---AKCKDSPVY---AEGIETLILLLAPFAPHIAEE
Amaxima      DLEGDYQFNTAVSEMMKLSNALSDN--SKIQDSPIY---QEGIETLLKLLAPFSPHITED
Cwatsonii    DLEGDYQFNTAVSELMKLSNTLND---AKSINSGVY---QEGIGILLILLAPFAPHIAEE
Cyanothec2   DLEGDYQFNTAVSELMKLSNALND---AKCINSTVY---QEGIETLLILLAPFAPHIAEE
Cyanothec1   DLEGEYQFNTAVSELMKLNNALSE---AKCYESPVY---TEGVETLLILLAPFAPHIAEE
Amarina      DLDGDYQFNTAVSELMKLSNALSD---SKEKASPVY---AEGVETLLLLLTPFAPHISEE
Telongatus   DIEGDYQLNTAVAELMKLSNALSS---ADCYTSGVY---SEGIQTLLTLLAPFAPHISEE
Selongatus   DLEEDYQLNTAIAELMKLTNALND---APMPGSPAY---LKGVQTLVLLLAPFAPHIAEE
Synechoco2   DIEGDYQFNTAVSELMKLSNAIND---TKDKATPVF---AEAICALVRLIAPFAPHIADE
Pmarinus6    DLSGDIQLNTAISELMKLSNSLSGK--LDKVRNEVA---AEALSVLVRLMAPFAPHLAEE
Pmarinus7    DLSGDIQLNTAISELMKLSNSLGGK--LDKVRTEVA---AEALSVLVRLMAPFAPHLAEE
Synechoco1   DLRGEYQFNTAISELMKLSNALSGS--LAEASRSVQ---AEAISALIRLLAPFAPHLAEE
Pchromatop   DLDGEVQLNTAIAELMKLNNILSSV--SDSISEPII---LEGLKTLIILLAPFAPHLSEE
Psyringae    DIGQNQKFNTAVAQVMTLMNVLE---KAPQATPQDRALLQEGLETVTLLLAPITPHISHE
Ymollareti   DVGRRQTFNTAIAAVMELMNKLG---RSPQETEQDRALLQEALLAVVRMLYPFTPHVCFT
Fnucleatum   AIENNYHFNTAIAANMELINEVQTYVASSMNSEQAAKILGYTLKKIIIMLSPFVPHFCDE
              :     :***::  * : * :                       .  :: *: **.   
Prim.cons.   DLEGDYQFNTAISELMKLSNALSDSV3AKCVNSPVY2LLAEGLKTLVILLAPFAPHIAEE

                    850       860       870       880       890       900
                      |         |         |         |         |         |
Chydrogeno   LWEAL----GNKQSVHLEKWPEYDEEALITEEVEIVIQVNGKVKDRVMVPRNAAEDELKE
Fnodosum     MWHDL----GKETLIVEEKWPEYDPEALKEDELTIVVQVNGKVRGKITVPADASEEEIKN
GOS_687010   IWHLI----GFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNINNDM-------
Pmarinus1    IWHLI----GFKKSVHLEYWPSFNAEALKEDSYELVIQVNGKVRDKVKINNDMSEDQIKE
Pmarinus2    IWHLI----GFKKSVHLEHWPSFNAEALKEDSYELVIQVNGKVREKVNINHDMNEDQIKE
Pmarinus3    IWNLI----GYQKSVHLERWPIFNEDALKEDCYELVIQINGKVRDKINVGIDISEDQIKQ
Pmarinus4    IWHLI----GNSKSVHLEKWPVFDEDALKENSFELVIQINGKVRDKINVEINISDDEIKE
Pmarinus5    FWIKL----KGKGSVHENSWPTYDPKALLEDSYKLIIQINGKVRGNISVNHEDSELELKN
Nostoc       LWRLL----GNSESVHTQTWPAFDPAALVADEITLVIQVNGKKRADIQVPSQADKAELEK
Avariabili   LWQLL----GNSESVHTQTWPAFDPAALVADEITLVIQVNGKKRADIQVPSQADKAELEK
Nspumigena   LWQSL----GNTNSIHTQTWPSFDPAALVADEITLIIQINGKKRADIEVPAQADKAELEK
Mchthonopl   LWHGI----GHTDSVHLQPWCTFEPEALVADEITLVIQIMGKTRGTIQVPADSDKSALEQ
Amaxima      LWHQI----GHSDSVHLQSWPTFDPSALVVDEITLVIQINGKTRGTIQVASGADKSTLEQ
Cwatsonii    LWHNL----GHENSIHLQTWPEVDPDALVVDEITLVIQIMGKTRGTIQVPANSSKEELEK
Cyanothec2   LWHNL----GHETSIHLQTWPEVNPDALVVDEITLVIQIMGKTRGTIQVPANSSKEELEK
Cyanothec1   LWHQL----GNSDSVHRQSWPQFDPSALVVDEITLVIQVMGKTRGTIQVPSSASKEELEK
Amarina      LWENL----GHSESILGQTWPQVDEEALVADEITLVIQIMGKTRGTIQVPAGSSREDLEQ
Telongatus   LWHQL----GGTDSIHRQPWPKADPTALVADEITLVIQVMGKTRGAIQVPATASQAELEE
Selongatus   LWQQL----GGERSVHLEGWPVLDESALIVDEIPLVIQIMGKTRGTITVPASADRDQLQQ
Synechoco2   LWSALTISSGFTDSVHRQPWPKVESAALVADEITLVIQVMGKTRGTLQVPASADKAALEN
Pmarinus6    FWLKLH---GHG-SIHQQSWPVIDPSALVLETIELVIQVKGKVRGKIQVPANADKKTLEE
Pmarinus7    FWMKLH---GQG-SIHQQSWPIIDPSALVLETIELVIQVKGKVRGTIQVPANADKTALEE
Synechoco1   FWFSLG---GQG-SVHNQPWPVHDPAALRRDTVDLVIQVKGKVRGSISVPADCSKEKLEE
Pchromatop   LWSRLV---NDSNSIHNQRWPILDPSALIQENIKLVIQVNGRVRGFIDVPANADKEKLEK
Psyringae    LWTQL----GHNEPVIDAGWPVFDAHALVQDSLQLVIQVNGKLRGHIEMPASASREEVEA
Ymollareti   LWQAL----GGEGDIDTAPWPIADEQAMVEDSKLVVVQVNGKVRGRITVPADATEEQVRE
Fnucleatum   IWEEL----GEKGYLFNEKWPEYDEKMLSSDETTIAVQVNGKVRGSFEIAKDSEQALVEK
             :*  :         :    *   :   :  :   : :*: *: :  . :           
Prim.cons.   LWHLLHISSGHS2SVHLQTWP2FDPEALVEDEITLVIQVNGKVRGTIQVPADASKEELEE

                    910       920       930
                      |         |         |
Chydrogeno   IALNTPKIKELTADKKIIKVIIVPEKLINIVVAG--
Fnodosum     RAVEN--AGKFLEGKTIVNTIYVKGKLVNIVIK---
GOS_687010   ------------------------------------
Pmarinus1    LTLKRPNILKWTQDKEIRKIIIVKGKIINIVV----
Pmarinus2    LTLKRPNILKWTKDKEIRKIIIVKGKIMNIVV----
Pmarinus3    KTLTRPNVRKWIDQKTIRKIIIVKGKIMNIVV----
Pmarinus4    KTLIRPNVKKWIDNKTIRKIIIVKGRIINIVV----
Pmarinus5    KALACETTQKWLNGIEPKRIIIVKGKIINIVF----
Nostoc       YARESEVVQRHLEGKEIKKVIVVPGKLVNFVVG---
Avariabili   YARESEVVQRHLEGKEIKKVIVVPGKLVNFVVG---
Nspumigena   YARESELVQRYIEGKEIKKVIVVPGRLVNFVVV---
Mchthonopl   YARESEVAQRYITGKTVKKVIVVPGKLVNFVVTG--
Amaxima      LAKDSEIAQRHLEGKQLRKVIVVPGKLVNFVVG---
Cwatsonii    LARDSDIGKRNLEGKEVKKVIVVPGKLVNFVVPK--
Cyanothec2   LARESDIGKRNLGGKEVKKVIVVPGKLVNFVVPK--
Cyanothec1   LALNSELAQRYLKDQEVKKVIVVPGKLVNFVVGK--
Amarina      LARESEVAQRYIAGKEVKKVIVVPGKLVNFVVPK--
Telongatus   AAQHSEIGQRYLAGKTIKKIIVVPGKLVNFVLESSR
Selongatus   LAKNSEIAQRWLDGQTIRKVIVVPGKLVNFVIASP-
Synechoco2   YARGSEIAQRYLDGKEIKKVIVVPGKLVNFVAT---
Pmarinus6    LALNSDIAVKWLEGQSPRRIIIVPGKLVNLVP----
Pmarinus7    LALKSDIAVKWLEGQSPRRVIIVPGKLVNLVP----
Synechoco1   LALASEVAERWLEGKPPRRVIVVPGKLVNLVPS---
Pchromatop   LALNSESAQKWISGKLPKRVITVPGKLVNIVL----
Psyringae    AARINENVLRFTDGLTIRKVIVVPGKLVNIVAS---
Ymollareti   RAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG---
Fnucleatum   TALELPNVAKHLEGMNVVKVIVIPNRIVNIVVKPQ-
                                                                         
Prim.cons.   LALESEIAQRWLEGKEIKKVIVVPGKLVNFVVGK3R                        



--------------------------------------------------------------------------------
Alignment data :
Alignment length : 936
Identity (*) : 53 is 5.66 %
Strongly similar (:) : 50 is 5.34 %
Weakly similar (.) : 11 is 1.18 %
Different : 822 is 87.82 %
Sequence 0001 : Chydrogeno ( 821 residues).
Sequence 0002 : Fnodosum ( 819 residues).
Sequence 0003 : GOS_687010 ( 303 residues).
Sequence 0004 : Pmarinus1 ( 856 residues).
Sequence 0005 : Pmarinus2 ( 856 residues).
Sequence 0006 : Pmarinus3 ( 864 residues).
Sequence 0007 : Pmarinus4 ( 858 residues).
Sequence 0008 : Pmarinus5 ( 870 residues).
Sequence 0009 : Nostoc ( 872 residues).
Sequence 0010 : Avariabili ( 872 residues).
Sequence 0011 : Nspumigena ( 873 residues).
Sequence 0012 : Mchthonopl ( 855 residues).
Sequence 0013 : Amaxima ( 859 residues).
Sequence 0014 : Cwatsonii ( 853 residues).
Sequence 0015 : Cyanothec2 ( 853 residues).
Sequence 0016 : Cyanothec1 ( 854 residues).
Sequence 0017 : Amarina ( 855 residues).
Sequence 0018 : Telongatus ( 857 residues).
Sequence 0019 : Selongatus ( 865 residues).
Sequence 0020 : Synechoco2 ( 868 residues).
Sequence 0021 : Pmarinus6 ( 878 residues).
Sequence 0022 : Pmarinus7 ( 878 residues).
Sequence 0023 : Synechoco1 ( 878 residues).
Sequence 0024 : Pchromatop ( 878 residues).
Sequence 0025 : Psyringae ( 868 residues).
Sequence 0026 : Ymollareti ( 860 residues).
Sequence 0027 : Fnucleatum ( 862 residues).

---------------------------------------------------------------------------------------------------

BLAST

PROTOCOLE:

a)Blastp contre swissprot, paramètres par défaut au NCBI sauf "Number of descriptions=500".

b)Blastp contre nr, paramètres par défaut au NCBI sauf "Number of descriptions=500".


---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

a)On trouve un grand nombre de séquences homologues ayant un très faible e-value (jusqu'à 7e-169)
et de très bons scores (jusqu'à 592). Avec 500 résultats,notre moins bon homologue a encore un bon e-value de 1e-11 et
un score de 70,5 . Néanmoins, on ne constate pas de rupture significative dans les e-values et il faut déterminer un
score seuil pour séparer les homologues (vrais positifs) des non-homologues (faux positifs).
Pour cela, il faut observer les fonctions : les 15 dernières séquences sont des Valyl-tRNA synthetases et non 
des Leucyl-tRNA synthetases comme les premiers homologues.Les domaines conservés nous ayant indiqué que notre séquence
correspond à une Leucyl-tRNA synthétase,cela nous permet de déterminer un score seuil de 100.


b)Comme précédemment,on trouve un grand nombre de séquences homologues ayant un très faible e-value : le dernier des 
500 résultats a encore un très bon e-value de 9e-50 et un score de 201.
On ne constate pas de rupture significative dans les e-value,ni dans les fonctions. Nous avons essayé de faire des blasts
avec plus de résultats mais nous n'avons pas plus trouvé de rupture donc nous considererons plutôt les résultats du blast
p contre swissprot qui sont plus facilement interprétables.

---------------------------------------------------------------------------------------------------

RÉSULTATS BRUTS:

                                                               
a)                                                                 Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|A8G4T7.1|SYL_PROM2  Leucyl-tRNA synthetase (Leucine--tRNA l...   592    7e-169 Gene info
sp|A3PCW8.1|SYL_PROM0  Leucyl-tRNA synthetase (Leucine--tRNA l...   592    1e-168 Gene info
sp|A2BR45.1|SYL_PROMS  Leucyl-tRNA synthetase (Leucine--tRNA l...   585    7e-167 Gene info
sp|Q31AX4.1|SYL_PROM9  Leucyl-tRNA synthetase (Leucine--tRNA l...   559    6e-159 Gene info
sp|A2BWL7.1|SYL_PROM5  Leucyl-tRNA synthetase (Leucine--tRNA l...   503    7e-142 Gene info
sp|Q7V1I2|SYL_PROMP  Leucyl-tRNA synthetase (Leucine--tRNA lig...   486    5e-137 Gene info
sp|Q46L15.1|SYL_PROMT  RecName: Full=Leucyl-tRNA synthetase; A...   363    5e-100 Gene info
sp|A2C242.1|SYL_PROM1  Leucyl-tRNA synthetase (Leucine--tRNA l...   363    6e-100 Gene info
sp|Q3AJU8.1|SYL_SYNSC  Leucyl-tRNA synthetase (Leucine--tRNA l...   355    2e-97  Gene info
sp|A5GL71.1|SYL_SYNPW  Leucyl-tRNA synthetase (Leucine--tRNA l...   354    3e-97  Gene info
sp|Q7VBZ5|SYL_PROMA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   354    4e-97 
sp|Q7U6T1|SYL_SYNPX  Leucyl-tRNA synthetase (Leucine--tRNA lig...   352    1e-96  Gene info
sp|Q0IAE0.1|SYL_SYNS3  Leucyl-tRNA synthetase (Leucine--tRNA l...   350    5e-96  Gene info
sp|Q8DH61|SYL_SYNEL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   346    7e-95 
sp|Q31LW9.1|SYL_SYNP7  Leucyl-tRNA synthetase (Leucine--tRNA l...   345    2e-94  Gene info
sp|Q3AXV7.1|SYL_SYNS9  Leucyl-tRNA synthetase (Leucine--tRNA l...   345    2e-94 
sp|Q5N006|SYL_SYNP6  Leucyl-tRNA synthetase (Leucine--tRNA lig...   343    9e-94  Gene info
sp|Q7TV01|SYL_PROMM  Leucyl-tRNA synthetase (Leucine--tRNA lig...   328    3e-89  Gene info
sp|A5GT82.1|SYL_SYNR3  Leucyl-tRNA synthetase (Leucine--tRNA l...   327    5e-89  Gene info
sp|A2C9U0.1|SYL_PROM3  Leucyl-tRNA synthetase (Leucine--tRNA l...   325    2e-88  Gene info
sp|B0C1R1.1|SYL_ACAM1  RecName: Full=Leucyl-tRNA synthetase; A...   321    3e-87  Gene info
sp|Q8YS09|SYL_ANASP  Leucyl-tRNA synthetase (Leucine--tRNA lig...   320    7e-87  Gene info
sp|Q2JHX0.1|SYL_SYNJB  Leucyl-tRNA synthetase (Leucine--tRNA l...   318    2e-86  Gene info
sp|Q3M3A3.1|SYL_ANAVT  Leucyl-tRNA synthetase (Leucine--tRNA l...   317    6e-86  Gene info
sp|P73274|SYL_SYNY3  Leucyl-tRNA synthetase (Leucine--tRNA lig...   310    9e-84  Gene info
sp|Q2JV13.1|SYL_SYNJA  Leucyl-tRNA synthetase (Leucine--tRNA l...   309    1e-83  Gene info
sp|Q7NE01|SYL_GLOVI  Leucyl-tRNA synthetase (Leucine--tRNA lig...   281    4e-75 
sp|Q3AF30.1|SYL_CARHZ  Leucyl-tRNA synthetase (Leucine--tRNA l...   268    2e-71  Gene info
sp|Q87VX3|SYL_PSESM  Leucyl-tRNA synthetase (Leucine--tRNA lig...   256    7e-68 
sp|Q48DN1.1|SYL_PSE14  Leucyl-tRNA synthetase (Leucine--tRNA l...   255    2e-67  Gene info
sp|Q4ZN90.1|SYL_PSEU2  Leucyl-tRNA synthetase (Leucine--tRNA l...   254    5e-67  Gene info
sp|Q2RKZ1.1|SYL_MOOTA  RecName: Full=Leucyl-tRNA synthetase; A...   247    6e-65  Gene info
sp|Q15VK0.1|SYL_PSEA6  RecName: Full=Leucyl-tRNA synthetase; A...   247    6e-65  Gene info
sp|Q8RIQ3|SYL_FUSNN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   246    8e-65 
sp|A4J7H2.1|SYL_DESRM  RecName: Full=Leucyl-tRNA synthetase; A...   244    4e-64  Gene info
sp|A4XYW8.2|SYL_PSEMY  RecName: Full=Leucyl-tRNA synthetase; A...   243    1e-63 
sp|Q1I4G7.1|SYL_PSEE4  Leucyl-tRNA synthetase (Leucine--tRNA l...   242    2e-63  Gene info
sp|A1SU60.1|SYL_PSYIN  Leucyl-tRNA synthetase (Leucine--tRNA l...   242    2e-63  Gene info
sp|A0LK15.1|SYL_SYNFM  Leucyl-tRNA synthetase (Leucine--tRNA l...   242    2e-63  Gene info
sp|A6V0C2.1|SYL_PSEA7  RecName: Full=Leucyl-tRNA synthetase; A...   242    2e-63  Gene info
sp|B0KJW8.1|SYL_PSEPG  RecName: Full=Leucyl-tRNA synthetase; A...   241    4e-63  Gene info
sp|A4XKG9.1|SYL_CALS8  Leucyl-tRNA synthetase (Leucine--tRNA l...   241    4e-63  Gene info
sp|Q24SP5.1|SYL_DESHY  RecName: Full=Leucyl-tRNA synthetase; A...   241    5e-63  Gene info
sp|A7HN82.1|SYL_FERNB  RecName: Full=Leucyl-tRNA synthetase; A...   240    5e-63  Gene info
sp|Q0AWK4.1|SYL_SYNWW  Leucyl-tRNA synthetase (Leucine--tRNA l...   240    7e-63  Gene info
sp|A4VQZ0.2|SYL_PSEU5  Leucyl-tRNA synthetase (Leucine--tRNA l...   240    8e-63 
sp|Q5QYD1|SYL_IDILO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   240    8e-63 
sp|A5W9H9.2|SYL_PSEP1  RecName: Full=Leucyl-tRNA synthetase; A...   239    1e-62 
sp|Q88DN1|SYL_PSEPK  Leucyl-tRNA synthetase (Leucine--tRNA lig...   239    1e-62  Gene info
sp|Q3A4P8.1|SYL_PELCD  Leucyl-tRNA synthetase (Leucine--tRNA l...   238    2e-62  Gene info
sp|Q9HX33|SYL_PSEAE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   238    2e-62 
sp|Q02SF5.1|SYL_PSEAB  Leucyl-tRNA synthetase (Leucine--tRNA l...   238    3e-62  Gene info
sp|A4SJW8.1|SYL_AERS4  Leucyl-tRNA synthetase (Leucine--tRNA l...   237    4e-62  Gene info
sp|A3DEU0.1|SYL_CLOTH  Leucyl-tRNA synthetase (Leucine--tRNA l...   237    6e-62  Gene info
sp|Q8EHP4|SYL_SHEON  Leucyl-tRNA synthetase (Leucine--tRNA lig...   236    1e-61 
sp|Q484Q5.1|SYL_COLP3  Leucyl-tRNA synthetase (Leucine--tRNA l...   236    1e-61  Gene info
sp|Q74AZ0|SYL_GEOSL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   236    2e-61 
sp|A0KTW7.1|SYL_SHESA  Leucyl-tRNA synthetase (Leucine--tRNA l...   235    2e-61  Gene info
sp|Q0HXU4.1|SYL_SHESR  Leucyl-tRNA synthetase (Leucine--tRNA l...   235    2e-61  Gene info
sp|Q0HLJ0.1|SYL_SHESM  Leucyl-tRNA synthetase (Leucine--tRNA l...   235    2e-61  Gene info
sp|Q3SG58.1|SYL_THIDA  Leucyl-tRNA synthetase (Leucine--tRNA l...   235    2e-61  Gene info
sp|A5EWD6.1|SYL_DICNV  Leucyl-tRNA synthetase (Leucine--tRNA l...   234    4e-61  Gene info
sp|Q39T99.1|SYL_GEOMG  Leucyl-tRNA synthetase (Leucine--tRNA l...   233    7e-61  Gene info
sp|Q114V5.1|SYL_TRIEI  Leucyl-tRNA synthetase (Leucine--tRNA l...   233    1e-60  Gene info
sp|A0KN87.2|SYL_AERHH  Leucyl-tRNA synthetase (Leucine--tRNA l...   232    2e-60 
sp|A0L4R4.1|SYL_MAGSM  Leucyl-tRNA synthetase (Leucine--tRNA l...   232    2e-60  Gene info
sp|Q1MS17.1|SYL_LAWIP  Leucyl-tRNA synthetase (Leucine--tRNA l...   231    3e-60  Gene info
sp|Q7P0R1|SYL_CHRVO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   231    4e-60 
sp|A1RGU5.1|SYL_SHESW  Leucyl-tRNA synthetase (Leucine--tRNA l...   231    5e-60  Gene info
sp|A8GB21.1|SYL_SERP5  RecName: Full=Leucyl-tRNA synthetase; A...   230    6e-60  Gene info
sp|Q9WY15|SYL_THEMA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   230    6e-60 
sp|A4Y9E9.1|SYL_SHEPC  Leucyl-tRNA synthetase (Leucine--tRNA l...   230    6e-60  Gene info
sp|A5IKQ3.1|SYL_THEP1  RecName: Full=Leucyl-tRNA synthetase; A...   230    7e-60  Gene info
sp|A5D416.1|SYL_PELTS  RecName: Full=Leucyl-tRNA synthetase; A...   230    7e-60  Gene info
sp|Q1C521.1|SYL_YERPA  Leucyl-tRNA synthetase (Leucine--tRNA l...   230    8e-60  Gene info
sp|A6WRJ9.2|SYL_SHEB8  Leucyl-tRNA synthetase (Leucine--tRNA l...   230    8e-60 
sp|A8F8B7.1|SYL_THELT  RecName: Full=Leucyl-tRNA synthetase; A...   229    1e-59  Gene info
sp|A1KAH5.1|SYL_AZOSB  Leucyl-tRNA synthetase (Leucine--tRNA l...   229    1e-59  Gene info
sp|Q67SB4|SYL_SYMTH  Leucyl-tRNA synthetase (Leucine--tRNA lig...   229    1e-59 
sp|Q1QV15.1|SYL_CHRSD  Leucyl-tRNA synthetase (Leucine--tRNA l...   229    2e-59  Gene info
sp|A1JQ25.1|SYL_YERE8  Leucyl-tRNA synthetase (Leucine--tRNA l...   229    2e-59  Gene info
sp|Q2LQK5.1|SYL_SYNAS  Leucyl-tRNA synthetase (Leucine--tRNA l...   228    3e-59  Gene info
sp|A3D7N6.2|SYL_SHEB5  Leucyl-tRNA synthetase (Leucine--tRNA l...   228    3e-59 
sp|A1APS3.1|SYL_PELPD  Leucyl-tRNA synthetase (Leucine--tRNA l...   228    4e-59  Gene info
sp|Q087K2.2|SYL_SHEFN  Leucyl-tRNA synthetase (Leucine--tRNA l...   227    5e-59 
sp|A3QH47.1|SYL_SHELP  Leucyl-tRNA synthetase (Leucine--tRNA l...   227    5e-59  Gene info
sp|A9L001.2|SYL_SHEB9  RecName: Full=Leucyl-tRNA synthetase; A...   227    6e-59 
sp|Q87RQ0|SYL_VIBPA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   227    6e-59 
sp|Q31IE8.1|SYL_THICR  Leucyl-tRNA synthetase (Leucine--tRNA l...   227    6e-59  Gene info
sp|A4G8E6.1|SYL_HERAR  Leucyl-tRNA synthetase (Leucine--tRNA l...   226    8e-59  Gene info
sp|Q8DFE2|SYL_VIBVU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   226    9e-59 
sp|Q2RN70.1|SYL_RHORT  Leucyl-tRNA synthetase (Leucine--tRNA l...   226    9e-59  Gene info
sp|Q7MN06|SYL_VIBVY  Leucyl-tRNA synthetase (Leucine--tRNA lig...   226    1e-58  Gene info
sp|Q72CT7|SYL_DESVH  Leucyl-tRNA synthetase (Leucine--tRNA lig...   226    1e-58  Gene info
sp|A1VEL2.1|SYL_DESVV  Leucyl-tRNA synthetase (Leucine--tRNA l...   226    1e-58  Gene info
sp|Q12R39.2|SYL_SHEDO  RecName: Full=Leucyl-tRNA synthetase; A...   226    1e-58 
sp|Q2SBE7.1|SYL_HAHCH  Leucyl-tRNA synthetase (Leucine--tRNA l...   226    2e-58  Gene info
sp|Q122Q4.1|SYL_POLSJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   224    3e-58  Gene info
sp|A6LJM9.1|SYL_THEM4  RecName: Full=Leucyl-tRNA synthetase; A...   224    3e-58  Gene info
sp|Q0ABN3.1|SYL_ALHEH  Leucyl-tRNA synthetase (Leucine--tRNA l...   224    3e-58  Gene info
sp|A1S8S8.2|SYL_SHEAM  Leucyl-tRNA synthetase (Leucine--tRNA l...   224    4e-58 
sp|B0TR44.2|SYL_SHEHH  RecName: Full=Leucyl-tRNA synthetase; A...   224    4e-58 
sp|Q608N7|SYL_METCA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   224    5e-58 
sp|Q8XVT3|SYL_RALSO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   224    5e-58 
sp|A8FZ10.1|SYL_SHESH  RecName: Full=Leucyl-tRNA synthetase; A...   224    6e-58  Gene info
sp|A5G677.1|SYL_GEOUR  RecName: Full=Leucyl-tRNA synthetase; A...   224    6e-58  Gene info
sp|A1U4A0.2|SYL_MARAV  Leucyl-tRNA synthetase (Leucine--tRNA l...   223    7e-58 
sp|A8H7C2.2|SYL_SHEPA  RecName: Full=Leucyl-tRNA synthetase; A...   223    1e-57 
sp|Q9KTE6|SYL_VIBCH  Leucyl-tRNA synthetase (Leucine--tRNA lig...   223    1e-57 
sp|A5F2X0.2|SYL_VIBC3  RecName: Full=Leucyl-tRNA synthetase; A...   223    1e-57 
sp|A9M162.2|SYL_NEIM0  RecName: Full=Leucyl-tRNA synthetase; A...   223    1e-57 
sp|Q3IJ93.1|SYL_PSEHT  Leucyl-tRNA synthetase (Leucine--tRNA l...   222    2e-57  Gene info
sp|Q6D7L6|SYL_ERWCT  Leucyl-tRNA synthetase (Leucine--tRNA lig...   222    2e-57 
sp|B0URM9.1|SYL_HAES2  RecName: Full=Leucyl-tRNA synthetase; A...   222    2e-57  Gene info
sp|Q0I5C5.1|SYL_HAES1  Leucyl-tRNA synthetase (Leucine--tRNA l...   222    2e-57  Gene info
sp|A1KS07.1|SYL_NEIMF  Leucyl-tRNA synthetase (Leucine--tRNA l...   222    2e-57  Gene info
sp|Q9JXT2|SYL_NEIMB  Leucyl-tRNA synthetase (Leucine--tRNA lig...   221    3e-57 
sp|A7HSL7.1|SYL_PARL1  RecName: Full=Leucyl-tRNA synthetase; A...   221    3e-57  Gene info
sp|A7MY86.1|SYL_VIBHB  Leucyl-tRNA synthetase (Leucine--tRNA l...   221    3e-57  Gene info
sp|Q0VN53.2|SYL_ALCBS  RecName: Full=Leucyl-tRNA synthetase; A...   221    4e-57 
sp|A6T239.1|SYL_JANMA  Leucyl-tRNA synthetase (Leucine--tRNA l...   220    7e-57  Gene info
sp|A1TVU7.1|SYL_ACIAC  Leucyl-tRNA synthetase (Leucine--tRNA l...   220    9e-57  Gene info
sp|Q7VM66|SYL_HAEDU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   219    1e-56 
sp|Q220P5.1|SYL_RHOFD  Leucyl-tRNA synthetase (Leucine--tRNA l...   219    1e-56  Gene info
sp|A3N0N2.1|SYL_ACTP2  Leucyl-tRNA synthetase (Leucine--tRNA l...   219    1e-56  Gene info
sp|Q9JW39|SYL_NEIMA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   219    1e-56 
sp|Q1LJ30.1|SYL_RALME  Leucyl-tRNA synthetase (Leucine--tRNA l...   219    1e-56  Gene info
sp|Q7N755|SYL_PHOLL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   219    2e-56 
sp|Q5E6U8.1|SYL_VIBF1  Leucyl-tRNA synthetase (Leucine--tRNA l...   219    2e-56  Gene info
sp|Q5FAJ3.2|SYL_NEIG1  RecName: Full=Leucyl-tRNA synthetase; A...   219    2e-56 
sp|A1VTV4.1|SYL_POLNA  Leucyl-tRNA synthetase (Leucine--tRNA l...   219    2e-56  Gene info
sp|Q2NUU7.1|SYL_SODGM  Leucyl-tRNA synthetase (Leucine--tRNA l...   218    2e-56  Gene info
sp|Q820M7|SYL_NITEU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   218    3e-56 
sp|Q11DE4.1|SYL_MESSB  Leucyl-tRNA synthetase (Leucine--tRNA l...   218    4e-56  Gene info
sp|A5UDF4.1|SYL_HAEIE  Leucyl-tRNA synthetase (Leucine--tRNA l...   217    7e-56  Gene info
sp|A6VZE7.1|SYL_MARMS  RecName: Full=Leucyl-tRNA synthetase; A...   216    1e-55  Gene info
sp|Q30YL0.1|SYL_DESDG  Leucyl-tRNA synthetase (Leucine--tRNA l...   216    1e-55  Gene info
sp|P57923|SYL_PASMU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   216    1e-55 
sp|P43827|SYL_HAEIN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   216    2e-55 
sp|Q4QLY8|SYL_HAEI8  Leucyl-tRNA synthetase (Leucine--tRNA lig...   215    2e-55  Gene info
sp|A5UI62.1|SYL_HAEIG  Leucyl-tRNA synthetase (Leucine--tRNA l...   215    3e-55  Gene info
sp|Q0AG57.1|SYL_NITEC  Leucyl-tRNA synthetase (Leucine--tRNA l...   214    3e-55  Gene info
sp|Q65VR5|SYL_MANSM  Leucyl-tRNA synthetase (Leucine--tRNA lig...   214    4e-55 
sp|Q2YBQ2.1|SYL_NITMU  Leucyl-tRNA synthetase (Leucine--tRNA l...   214    4e-55  Gene info
sp|Q57B80.1|SYL_BRUAB  Leucyl-tRNA synthetase (Leucine--tRNA l...   214    5e-55 
sp|A9MUK3.1|SYL_SALPB  RecName: Full=Leucyl-tRNA synthetase; A...   214    7e-55 
sp|A4JBI1.1|SYL_BURVG  Leucyl-tRNA synthetase (Leucine--tRNA l...   214    7e-55  Gene info
sp|Q2YLH9.1|SYL_BRUA2  Leucyl-tRNA synthetase (Leucine--tRNA l...   213    8e-55  Gene info
sp|Q6AJZ7|SYL_DESPS  Leucyl-tRNA synthetase (Leucine--tRNA lig...   213    8e-55 
sp|Q57RS7.2|SYL_SALCH  RecName: Full=Leucyl-tRNA synthetase; A...   213    8e-55 
sp|Q8Z8H5|SYL_SALTI  Leucyl-tRNA synthetase (Leucine--tRNA lig...   213    9e-55 
sp|Q5PM88.1|SYL_SALPA  Leucyl-tRNA synthetase (Leucine--tRNA l...   213    9e-55 
sp|A6VMB8.1|SYL_ACTSZ  RecName: Full=Leucyl-tRNA synthetase; A...   213    9e-55  Gene info
sp|A2SC91.1|SYL_METPP  Leucyl-tRNA synthetase (Leucine--tRNA l...   213    1e-54  Gene info
sp|Q8ZQZ6|SYL_SALTY  Leucyl-tRNA synthetase (Leucine--tRNA lig...   213    1e-54 
sp|Q6LN98|SYL_PHOPR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   213    1e-54 
sp|Q0T6Q2.2|SYL_SHIF8  RecName: Full=Leucyl-tRNA synthetase; A...   213    1e-54 
sp|Q46XD8.2|SYL_RALEJ  RecName: Full=Leucyl-tRNA synthetase; A...   213    1e-54  Gene info
sp|A9WWT1.1|SYL_BRUSI  Leucyl-tRNA synthetase (Leucine--tRNA l...   212    2e-54  Gene info
sp|Q83LX5|SYL_SHIFL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   212    2e-54 
sp|A6WXW1.1|SYL_OCHA4  Leucyl-tRNA synthetase (Leucine--tRNA l...   212    2e-54  Gene info
sp|Q5NMK1|SYL_ZYMMO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   212    2e-54 
sp|A4SVD9.1|SYL_POLSQ  RecName: Full=Leucyl-tRNA synthetase; A...   212    2e-54  Gene info
sp|Q6FYL6|SYL_BARQU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   212    2e-54 
sp|B1IYG6.1|SYL_ECOLC  RecName: Full=Leucyl-tRNA synthetase; A...   211    3e-54  Gene info
sp|Q6F817|SYL_ACIAD  Leucyl-tRNA synthetase (Leucine--tRNA lig...   211    3e-54  Gene info
sp|P07813.2|SYL_ECOLI  Leucyl-tRNA synthetase (Leucine--tRNA l...   211    4e-54 
sp|Q32IT9.1|SYL_SHIDS  Leucyl-tRNA synthetase (Leucine--tRNA l...   211    4e-54  Gene info
sp|A7ZXR8.1|SYL_ECOHS  RecName: Full=Leucyl-tRNA synthetase; A...   211    4e-54  Gene info
sp|A7ZJ31.1|SYL_ECO24  RecName: Full=Leucyl-tRNA synthetase; A...   211    4e-54  Gene info
sp|Q324Q2.1|SYL_SHIBS  Leucyl-tRNA synthetase (Leucine--tRNA l...   211    4e-54  Gene info
sp|Q0TK31.1|SYL_ECOL5  Leucyl-tRNA synthetase (Leucine--tRNA l...   211    4e-54  Gene info
sp|Q8XBN8|SYL_ECO57  Leucyl-tRNA synthetase (Leucine--tRNA lig...   211    5e-54 
sp|Q8FJY9|SYL_ECOL6  Leucyl-tRNA synthetase (Leucine--tRNA lig...   211    5e-54 
sp|Q1RER9.2|SYL_ECOUT  RecName: Full=Leucyl-tRNA synthetase; A...   211    5e-54 
sp|Q98EU7|SYL_RHILO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   211    5e-54 
sp|Q3Z4F0.1|SYL_SHISS  Leucyl-tRNA synthetase (Leucine--tRNA l...   211    6e-54  Gene info
sp|A7MQS0.1|SYL_ENTS8  Leucyl-tRNA synthetase (Leucine--tRNA l...   210    8e-54  Gene info
sp|A9M845.1|SYL_BRUC2  RecName: Full=Leucyl-tRNA synthetase; A...   210    8e-54 
sp|Q8FYQ7|SYL_BRUSU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   210    8e-54 
sp|Q0BIB5.1|SYL_BURCM  Leucyl-tRNA synthetase (Leucine--tRNA l...   210    1e-53  Gene info
sp|A6T6A3.1|SYL_KLEP7  Leucyl-tRNA synthetase (Leucine--tRNA l...   209    1e-53  Gene info
sp|A9MKC8.1|SYL_SALAR  RecName: Full=Leucyl-tRNA synthetase; A...   209    1e-53 
sp|Q5PB38.1|SYL_ANAMM  Leucyl-tRNA synthetase (Leucine--tRNA l...   209    1e-53  Gene info
sp|A8AJG0.2|SYL_CITK8  Leucyl-tRNA synthetase (Leucine--tRNA l...   209    1e-53 
sp|Q9A217|SYL_CAUCR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   209    1e-53 
sp|Q3J7S8.1|SYL_NITOC  Leucyl-tRNA synthetase (Leucine--tRNA l...   209    1e-53  Gene info
sp|A9IYY8.1|SYL_BART1  Leucyl-tRNA synthetase (Leucine--tRNA l...   209    1e-53  Gene info
sp|A6UEE2.1|SYL_SINMW  Leucyl-tRNA synthetase (Leucine--tRNA l...   208    2e-53  Gene info
sp|Q1BZ70.1|SYL_BURCA  Leucyl-tRNA synthetase (Leucine--tRNA l...   208    3e-53  Gene info
sp|Q1MA25.1|SYL2_RHIL3  Leucyl-tRNA synthetase 2 (Leucine--tRN...   208    3e-53  Gene info
sp|Q13U82.1|SYL_BURXL  Leucyl-tRNA synthetase (Leucine--tRNA l...   208    3e-53 
sp|Q2K2S7.1|SYL_RHIEC  Leucyl-tRNA synthetase (Leucine--tRNA l...   208    3e-53  Gene info
sp|Q1QDA4.2|SYL_PSYCK  RecName: Full=Leucyl-tRNA synthetase; A...   207    7e-53 
sp|Q8UBV2|SYL_AGRT5  Leucyl-tRNA synthetase (Leucine--tRNA lig...   206    9e-53  Gene info
sp|Q1RJS2|SYL_RICBR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   206    1e-52  Gene info
sp|A4W827.1|SYL_ENT38  RecName: Full=Leucyl-tRNA synthetase; A...   205    2e-52  Gene info
sp|Q2S415.1|SYL_SALRD  Leucyl-tRNA synthetase (Leucine--tRNA l...   205    3e-52  Gene info
sp|Q8K9B9|SYL_BUCAP  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    3e-52 
sp|Q21FG6.1|SYL_SACD2  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    4e-52 
sp|Q1GZB5.1|SYL_METFK  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    4e-52  Gene info
sp|Q92KW8|SYL_RHIME  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    4e-52 
sp|Q898V2|SYL_CLOTE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    5e-52 
sp|Q5WWZ8|SYL_LEGPL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    5e-52  Gene info
sp|A3MPH9.1|SYL_BURM7  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    5e-52  Gene info
sp|Q3IZL4.1|SYL_RHOS4  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    5e-52  Gene info
sp|A5IBJ1.1|SYL_LEGPC  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    5e-52 
sp|Q5X5L8|SYL_LEGPA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    5e-52  Gene info
sp|Q6G1W2|SYL_BARHE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    6e-52 
sp|A3PMN4.1|SYL_RHOS1  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    6e-52  Gene info
sp|Q5ZVU2|SYL_LEGPH  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    6e-52  Gene info
sp|A5N399.1|SYL_CLOK5  RecName: Full=Leucyl-tRNA synthetase; A...   204    6e-52  Gene info
sp|A1V0G7.1|SYL_BURMS  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    6e-52  Gene info
sp|A3NDK5.1|SYL_BURP6  Leucyl-tRNA synthetase (Leucine--tRNA l...   204    7e-52  Gene info
sp|A3NZB6.1|SYL_BURP0  Leucyl-tRNA synthetase (Leucine--tRNA l...   203    7e-52  Gene info
sp|Q3JNN1.2|SYL_BURP1  Leucyl-tRNA synthetase (Leucine--tRNA l...   203    8e-52 
sp|Q0AKF5.1|SYL_MARMM  Leucyl-tRNA synthetase (Leucine--tRNA l...   203    9e-52  Gene info
sp|Q47IN0.2|SYL_DECAR  RecName: Full=Leucyl-tRNA synthetase; A...   203    1e-51 
sp|Q9PBG8|SYL_XYLFA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   203    1e-51 
sp|A8F1J5.1|SYL_RICM5  Leucyl-tRNA synthetase (Leucine--tRNA l...   203    1e-51  Gene info
sp|Q0BWB5.1|SYL_HYPNA  RecName: Full=Leucyl-tRNA synthetase; A...   203    1e-51  Gene info
sp|A8IMK0.1|SYL_AZOC5  RecName: Full=Leucyl-tRNA synthetase; A...   203    1e-51  Gene info
sp|A8GS16.1|SYL_RICRS  Leucyl-tRNA synthetase (Leucine--tRNA l...   203    1e-51  Gene info
sp|P57519|SYL_BUCAI  Leucyl-tRNA synthetase (Leucine--tRNA lig...   202    1e-51 
sp|Q87C65|SYL_XYLFT  Leucyl-tRNA synthetase (Leucine--tRNA lig...   202    1e-51 
sp|A5VA89.1|SYL_SPHWW  RecName: Full=Leucyl-tRNA synthetase; A...   202    1e-51  Gene info
sp|Q1QRZ8.1|SYL_NITHX  Leucyl-tRNA synthetase (Leucine--tRNA l...   202    2e-51  Gene info
sp|Q39JM5.1|SYL_BURS3  Leucyl-tRNA synthetase (Leucine--tRNA l...   202    2e-51  Gene info
sp|A4YJS8.1|SYL_BRASO  Leucyl-tRNA synthetase (Leucine--tRNA l...   202    2e-51  Gene info
sp|Q8PIW4.1|SYL_XANAC  RecName: Full=Leucyl-tRNA synthetase; A...   202    2e-51 
sp|Q7W9M4|SYL_BORPA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   202    2e-51 
sp|Q2SZ91.2|SYL_BURTA  RecName: Full=Leucyl-tRNA synthetase; A...   202    3e-51 
sp|Q21CM7.1|SYL_RHOPB  Leucyl-tRNA synthetase (Leucine--tRNA l...   202    3e-51  Gene info
sp|Q01U81.1|SYL_SOLUE  Leucyl-tRNA synthetase (Leucine--tRNA l...   202    3e-51  Gene info
sp|A1WCP8.1|SYL_ACISJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   201    3e-51  Gene info
sp|A5CY09.1|SYL_VESOH  Leucyl-tRNA synthetase (Leucine--tRNA l...   201    3e-51  Gene info
sp|Q92I35|SYL_RICCN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   201    3e-51 
sp|Q89WQ1|SYL_BRAJA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   201    3e-51 
sp|Q7WH33|SYL_BORBR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   201    3e-51 
sp|Q7VWY7|SYL_BORPE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   201    3e-51 
sp|Q3BRE4.2|SYL_XANC5  RecName: Full=Leucyl-tRNA synthetase; A...   201    3e-51 
sp|A7NFJ2.1|SYL_ROSCS  RecName: Full=Leucyl-tRNA synthetase; A...   201    4e-51  Gene info
sp|Q5HBM8.1|SYL_EHRRW  Leucyl-tRNA synthetase (Leucine--tRNA l...   201    6e-51  Gene info
sp|Q492Z3.1|SYL_BLOPB  Leucyl-tRNA synthetase (Leucine--tRNA l...   200    6e-51  Gene info
sp|Q4UWK8.2|SYL_XANC8  RecName: Full=Leucyl-tRNA synthetase; A...   200    6e-51 
sp|Q4ULS1|SYL_RICFE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   200    7e-51 
sp|Q28VD4.1|SYL_JANSC  Leucyl-tRNA synthetase (Leucine--tRNA l...   200    7e-51  Gene info
sp|Q5FHG5.1|SYL_EHRRG  Leucyl-tRNA synthetase (Leucine--tRNA l...   200    7e-51  Gene info
sp|A1UR39.1|SYL_BARBK  Leucyl-tRNA synthetase (Leucine--tRNA l...   200    7e-51  Gene info
sp|A9HWW6.1|SYL_BORPD  RecName: Full=Leucyl-tRNA synthetase; A...   200    8e-51  Gene info
sp|B0U0E8.1|SYL_FRAP2  RecName: Full=Leucyl-tRNA synthetase; A...   200    8e-51  Gene info
sp|A8EZ02.1|SYL_RICCK  Leucyl-tRNA synthetase (Leucine--tRNA l...   200    9e-51  Gene info
sp|Q97LB6|SYL_CLOAB  Leucyl-tRNA synthetase (Leucine--tRNA lig...   199    1e-50 
sp|B0RR06.2|SYL_XANCB  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    1e-50 
sp|Q3SWI2.1|SYL_NITWN  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    1e-50  Gene info
sp|Q1LTM9.1|SYL_BAUCH  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    1e-50  Gene info
sp|A1WYZ7.1|SYL_HALHL  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    1e-50  Gene info
sp|B0T6E7.1|SYL_CAUSK  RecName: Full=Leucyl-tRNA synthetase; A...   199    1e-50  Gene info
sp|Q07UN5.1|SYL_RHOP5  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    2e-50  Gene info
sp|A5V1W3.1|SYL_ROSS1  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    2e-50  Gene info
sp|P59433|SYL_BUCBP  Leucyl-tRNA synthetase (Leucine--tRNA lig...   199    2e-50 
sp|Q2WBE4.1|SYL_MAGMM  RecName: Full=Leucyl-tRNA synthetase; A...   199    2e-50  Gene info
sp|Q3YSH6.1|SYL_EHRCJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   199    2e-50  Gene info
sp|Q5GXI8.1|SYL_XANOR  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    2e-50 
sp|Q2P0N0.1|SYL_XANOM  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    2e-50  Gene info
sp|Q837N5|SYL_ENTFA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   198    3e-50 
sp|A5E8H4.1|SYL_BRASB  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    3e-50  Gene info
sp|Q4FU71.1|SYL_PSYA2  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    3e-50  Gene info
sp|Q73IT7|SYL_WOLPM  Leucyl-tRNA synthetase (Leucine--tRNA lig...   198    3e-50 
sp|A7FPP5.1|SYL_CLOB1  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    3e-50  Gene info
sp|Q8XML8|SYL_CLOPE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   198    3e-50 
sp|Q0SV78.1|SYL_CLOPS  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    3e-50  Gene info
sp|Q0TTD0.1|SYL_CLOP1  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    4e-50  Gene info
sp|Q1GKN8.1|SYL_SILST  Leucyl-tRNA synthetase (Leucine--tRNA l...   198    4e-50  Gene info
sp|Q2GG41.1|SYL_EHRCR  RecName: Full=Leucyl-tRNA synthetase; A...   197    4e-50  Gene info
sp|A1WGU0.1|SYL_VEREI  Leucyl-tRNA synthetase (Leucine--tRNA l...   197    4e-50  Gene info
sp|Q5GS31.1|SYL_WOLTR  Leucyl-tRNA synthetase (Leucine--tRNA l...   197    5e-50  Gene info
sp|Q13E15.1|SYL_RHOPS  Leucyl-tRNA synthetase (Leucine--tRNA l...   197    5e-50  Gene info
sp|Q1MFI6.1|SYL1_RHIL3  Leucyl-tRNA synthetase 1 (Leucine--tRN...   197    5e-50  Gene info
sp|A4IXU1.1|SYL_FRATW  Leucyl-tRNA synthetase (Leucine--tRNA l...   197    6e-50  Gene info
sp|Q83DY1|SYL_COXBU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   197    7e-50 
sp|A7G9T9.1|SYL_CLOBL  Leucyl-tRNA synthetase (Leucine--tRNA l...   197    7e-50  Gene info
sp|A9NC49.1|SYL_COXBR  RecName: Full=Leucyl-tRNA synthetase; A...   197    7e-50  Gene info
sp|Q04MJ2.1|SYL_STRP2  Leucyl-tRNA synthetase (Leucine--tRNA l...   197    7e-50  Gene info
sp|Q8Y6M4|SYL_LISMO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   197    8e-50 
sp|Q2KXE5.1|SYL_BORA1  RecName: Full=Leucyl-tRNA synthetase; A...   197    8e-50  Gene info
sp|A5WGH9.1|SYL_PSYWF  RecName: Full=Leucyl-tRNA synthetase; A...   197    9e-50  Gene info
sp|Q8DS85|SYL_STRMU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   196    9e-50 
sp|A9KCQ4.1|SYL_COXBN  RecName: Full=Leucyl-tRNA synthetase; A...   196    9e-50  Gene info
sp|Q2G3C3.1|SYL_NOVAD  RecName: Full=Leucyl-tRNA synthetase; A...   196    1e-49  Gene info
sp|Q92AZ9|SYL_LISIN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   196    1e-49 
sp|Q73K81|SYL_TREDE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   196    1e-49 
sp|A0Q693.1|SYL_FRATN  Leucyl-tRNA synthetase (Leucine--tRNA l...   196    1e-49  Gene info
sp|Q14HL6.1|SYL_FRAT1  Leucyl-tRNA synthetase (Leucine--tRNA l...   196    1e-49  Gene info
sp|Q816T0|SYL_BACCR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   196    2e-49  Gene info
sp|A4WXA5.1|SYL_RHOS5  Leucyl-tRNA synthetase (Leucine--tRNA l...   196    2e-49  Gene info
sp|Q72YY8|SYL_BACC1  Leucyl-tRNA synthetase (Leucine--tRNA lig...   196    2e-49  Gene info
sp|A7GU19.1|SYL_BACCN  RecName: Full=Leucyl-tRNA synthetase; A...   196    2e-49  Gene info
sp|A0AJB5.1|SYL_LISW6  Leucyl-tRNA synthetase (Leucine--tRNA l...   195    2e-49  Gene info
sp|Q8CNU8|SYL_STAES  Leucyl-tRNA synthetase (Leucine--tRNA lig...   195    2e-49 
sp|Q97SS0|SYL_STRPN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   195    2e-49 
sp|Q5M1L6.1|SYL_STRT1  Leucyl-tRNA synthetase (Leucine--tRNA l...   195    3e-49  Gene info
sp|Q9ZDB1|SYL_RICPR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   195    3e-49 
sp|A1B5Q5.1|SYL_PARDP  Leucyl-tRNA synthetase (Leucine--tRNA l...   194    3e-49  Gene info
sp|Q71Z07|SYL_LISMF  Leucyl-tRNA synthetase (Leucine--tRNA lig...   194    3e-49  Gene info
sp|Q8D333|SYL_WIGBR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   194    4e-49  Gene info
sp|Q6HCE2|SYL_BACHK  Leucyl-tRNA synthetase (Leucine--tRNA lig...   194    5e-49 
sp|A0RJX2.1|SYL_BACAH  Leucyl-tRNA synthetase (Leucine--tRNA l...   194    5e-49  Gene info
sp|Q7VRA6|SYL_BLOFL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   194    7e-49  Gene info
sp|Q6ND22|SYL_RHOPA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   193    7e-49 
sp|A6M268.1|SYL_CLOB8  RecName: Full=Leucyl-tRNA synthetase; A...   193    8e-49  Gene info
sp|A5CCT4.1|SYL_ORITB  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    9e-49  Gene info
sp|A5G068.1|SYL_ACICJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    9e-49  Gene info
sp|Q2YTH9.1|SYL_STAAB  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    1e-48  Gene info
sp|Q2FXH2.1|SYL_STAA8  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    1e-48  Gene info
sp|Q0BLI7.1|SYL_FRATO  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    1e-48  Gene info
sp|A4IRY3.2|SYL_GEOTN  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    1e-48 
sp|Q49YI8.1|SYL_STAS1  Leucyl-tRNA synthetase (Leucine--tRNA l...   193    1e-48  Gene info
sp|A6U2M4.1|SYL_STAA2  RecName: Full=Leucyl-tRNA synthetase; A...   192    1e-48  Gene info
sp|Q6G8G9|SYL_STAAS  Leucyl-tRNA synthetase (Leucine--tRNA lig...   192    1e-48  Gene info
sp|Q8NW17|SYL_STAAW  Leucyl-tRNA synthetase (Leucine--tRNA lig...   192    1e-48  Gene info
sp|Q6GFU3|SYL_STAAR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   192    1e-48  Gene info
sp|Q662B4|SYL_BORGA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   192    1e-48 
sp|A7X3J9.1|SYL_STAA1  Leucyl-tRNA synthetase (Leucine--tRNA l...   192    1e-48  Gene info
sp|A1AV52.1|SYL_RUTMC  Leucyl-tRNA synthetase (Leucine--tRNA l...   192    1e-48  Gene info
sp|Q2J364.1|SYL_RHOP2  Leucyl-tRNA synthetase (Leucine--tRNA l...   192    2e-48  Gene info
sp|A5VL28.1|SYL_LACRD  RecName: Full=Leucyl-tRNA synthetase; A...   191    3e-48 
sp|Q5KW09|SYL_GEOKA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   191    4e-48 
sp|A8GNE3.1|SYL_RICAH  Leucyl-tRNA synthetase (Leucine--tRNA l...   191    5e-48  Gene info
sp|Q5L5Q6.1|SYL_CHLAB  Leucyl-tRNA synthetase (Leucine--tRNA l...   191    6e-48 
sp|Q1GNP7.1|SYL_SPHAL  RecName: Full=Leucyl-tRNA synthetase; A...   190    7e-48 
sp|Q0BW99.1|SYL_GRABC  Leucyl-tRNA synthetase (Leucine--tRNA l...   190    7e-48  Gene info
sp|A0PYK3.1|SYL_CLONN  Leucyl-tRNA synthetase (Leucine--tRNA l...   190    8e-48  Gene info
sp|Q1AR71.1|SYL_RUBXD  RecName: Full=Leucyl-tRNA synthetase; A...   190    1e-47  Gene info
sp|Q0SNR0.1|SYL_BORAP  Leucyl-tRNA synthetase (Leucine--tRNA l...   190    1e-47  Gene info
sp|Q68WV8|SYL_RICTY  Leucyl-tRNA synthetase (Leucine--tRNA lig...   189    1e-47 
sp|Q9K7S8|SYL_BACHD  Leucyl-tRNA synthetase (Leucine--tRNA lig...   189    1e-47 
sp|A8LJY0.1|SYL_DINSH  RecName: Full=Leucyl-tRNA synthetase; A...   189    2e-47  Gene info
sp|O51267|SYL_BORBU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   189    2e-47 
sp|Q04Q48.1|SYL_LEPBJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   188    4e-47  Gene info
sp|Q65FX8|SYL_BACLD  Leucyl-tRNA synthetase (Leucine--tRNA lig...   188    4e-47  Gene info
sp|A1R6X5.2|SYL_ARTAT  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    5e-47 
sp|Q03GG4.1|SYL_PEDPA  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    5e-47  Gene info
sp|A6WDL7.1|SYL_KINRD  RecName: Full=Leucyl-tRNA synthetase; A...   187    5e-47  Gene info
sp|Q3JYR6.1|SYL_STRA1  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    6e-47 
sp|P67515|SYL_STRA5  Leucyl-tRNA synthetase (Leucine--tRNA lig...   187    6e-47 
sp|Q057G3.1|SYL_BUCCC  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    6e-47  Gene info
sp|Q16E06.1|SYL_ROSDO  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    6e-47  Gene info
sp|Q8RCT6|SYL_THETN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   187    7e-47 
sp|Q1J8Q8.1|SYL_STRPF  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    7e-47  Gene info
sp|A0JX57.1|SYL_ARTS2  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    8e-47  Gene info
sp|Q9A1P0.1|SYL_STRP1  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    8e-47 
sp|Q1JIV9.1|SYL_STRPD  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    8e-47  Gene info
sp|Q8K8S1|SYL_STRP3  Leucyl-tRNA synthetase (Leucine--tRNA lig...   187    8e-47 
sp|Q5XE35|SYL_STRP6  Leucyl-tRNA synthetase (Leucine--tRNA lig...   187    8e-47 
sp|Q1JNR2.1|SYL_STRPC  Leucyl-tRNA synthetase (Leucine--tRNA l...   187    8e-47  Gene info
sp|Q5LMY0|SYL_SILPO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   187    9e-47 
sp|Q48VJ7.1|SYL_STRPM  Leucyl-tRNA synthetase (Leucine--tRNA l...   186    9e-47 
sp|Q4L7A3.1|SYL_STAHJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   186    9e-47  Gene info
sp|Q15031|SYLM_HUMAN  Probable leucyl-tRNA synthetase, mitocho...   186    1e-46  Gene info
sp|A2RCB2.1|SYL_STRPG  Leucyl-tRNA synthetase (Leucine--tRNA l...   186    1e-46  Gene info
sp|A0LSY4.1|SYL_ACIC1  Leucyl-tRNA synthetase (Leucine--tRNA l...   186    1e-46  Gene info
sp|A8FGG0.2|SYL_BACP2  Leucyl-tRNA synthetase (Leucine--tRNA l...   186    1e-46 
sp|Q8P2T2|SYL_STRP8  Leucyl-tRNA synthetase (Leucine--tRNA lig...   186    2e-46 
sp|Q254X5.1|SYL_CHLFF  Leucyl-tRNA synthetase (Leucine--tRNA l...   185    2e-46  Gene info
sp|P36430|SYL_BACSU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   185    2e-46 
sp|A8AZ43.1|SYL_STRGC  RecName: Full=Leucyl-tRNA synthetase; A...   185    2e-46 
sp|Q11VK7.1|SYL_CYTH3  RecName: Full=Leucyl-tRNA synthetase; A...   185    3e-46  Gene info
sp|Q5RDP4.1|SYLM_PONAB  Probable leucyl-tRNA synthetase, mitoc...   185    3e-46  Gene info
sp|A4VY58.2|SYL_STRSY  Leucyl-tRNA synthetase (Leucine--tRNA l...   185    3e-46 
sp|A4W4F3.2|SYL_STRS2  Leucyl-tRNA synthetase (Leucine--tRNA l...   185    3e-46 
sp|Q822R7|SYL_CHLCV  Leucyl-tRNA synthetase (Leucine--tRNA lig...   184    3e-46 
sp|A7Z7V7.1|SYL_BACA2  Leucyl-tRNA synthetase (Leucine--tRNA l...   184    5e-46  Gene info
sp|A3CKP1.2|SYL_STRSV  Leucyl-tRNA synthetase (Leucine--tRNA l...   184    5e-46 
sp|A6Q512.1|SYL_NITSB  Leucyl-tRNA synthetase (Leucine--tRNA l...   183    8e-46  Gene info
sp|Q7UMC0|SYL_RHOBA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   183    8e-46 
sp|Q03YH4.1|SYL_LEUMM  Leucyl-tRNA synthetase (Leucine--tRNA l...   182    2e-45  Gene info
sp|Q38VP5.1|SYL_LACSS  Leucyl-tRNA synthetase (Leucine--tRNA l...   182    2e-45  Gene info
sp|Q9Z930|SYL_CHLPN  Leucyl-tRNA synthetase (Leucine--tRNA lig...   182    3e-45 
sp|Q9PKI4|SYL_CHLMU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   181    3e-45 
sp|O84211|SYL_CHLTR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   181    4e-45 
sp|Q88XA9|SYL_LACPL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   181    4e-45 
sp|Q8EP12|SYL_OCEIH  Leucyl-tRNA synthetase (Leucine--tRNA lig...   181    4e-45 
sp|Q3KMF3.1|SYL_CHLTA  Leucyl-tRNA synthetase (Leucine--tRNA l...   181    6e-45  Gene info
sp|Q1WUT3.1|SYL_LACS1  Leucyl-tRNA synthetase (Leucine--tRNA l...   180    7e-45  Gene info
sp|Q72UY6|SYL_LEPIC  Leucyl-tRNA synthetase (Leucine--tRNA lig...   180    8e-45 
sp|Q030E7.1|SYL_LACLS  Leucyl-tRNA synthetase (Leucine--tRNA l...   180    8e-45  Gene info
sp|Q1J0W5.1|SYL_DEIGD  RecName: Full=Leucyl-tRNA synthetase; A...   180    8e-45  Gene info
sp|Q8EZY7.2|SYL_LEPIN  Leucyl-tRNA synthetase (Leucine--tRNA l...   180    9e-45 
sp|Q9RSF0|SYL_DEIRA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   180    9e-45 
sp|O83595|SYL_TREPA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   180    1e-44 
sp|Q8P7J1|SYL_XANCP  Leucyl-tRNA synthetase (Leucine--tRNA lig...   179    1e-44 
sp|Q6MQU3|SYL_BDEBA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   179    1e-44 
sp|Q6MCC8|SYL_PARUW  Leucyl-tRNA synthetase (Leucine--tRNA lig...   178    3e-44  Gene info
sp|A2RLY6.1|SYL_LACLM  Leucyl-tRNA synthetase (Leucine--tRNA l...   178    3e-44  Gene info
sp|Q9CHB6|SYL_LACLA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   178    3e-44 
sp|Q8VDC0|SYLM_MOUSE  Probable leucyl-tRNA synthetase, mitocho...   178    3e-44  Gene info
sp|A9WS85.2|SYL_RENSM  RecName: Full=Leucyl-tRNA synthetase; A...   177    6e-44 
sp|Q54ET5.1|SYLM_DICDI  RecName: Full=Leucyl-tRNA synthetase, ...   177    8e-44 
sp|Q03AT8.1|SYL_LACC3  Leucyl-tRNA synthetase (Leucine--tRNA l...   177    8e-44  Gene info
sp|A9EYY7.1|SYL_SORC5  RecName: Full=Leucyl-tRNA synthetase; A...   176    1e-43  Gene info
sp|A1SHV9.1|SYL_NOCSJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   176    1e-43  Gene info
sp|A7GZ81.1|SYL_CAMC5  RecName: Full=Leucyl-tRNA synthetase; A...   174    6e-43  Gene info
sp|Q1G971.1|SYL_LACDA  RecName: Full=Leucyl-tRNA synthetase; A...   173    9e-43  Gene info
sp|Q049B7.1|SYL_LACDB  Leucyl-tRNA synthetase (Leucine--tRNA l...   173    9e-43  Gene info
sp|A6KZH6.1|SYL_BACV8  RecName: Full=Leucyl-tRNA synthetase; A...   173    1e-42  Gene info
sp|Q5WE05|SYL_BACSK  Leucyl-tRNA synthetase (Leucine--tRNA lig...   172    3e-42  Gene info
sp|Q17YZ0.1|SYL_HELAH  RecName: Full=Leucyl-tRNA synthetase; A...   172    3e-42  Gene info
sp|Q8KBY2|SYL_CHLTE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   172    3e-42 
sp|Q8A329.1|SYL_BACTN  RecName: Full=Leucyl-tRNA synthetase; A...   171    3e-42 
sp|Q2GDQ6.2|SYL_NEOSM  RecName: Full=Leucyl-tRNA synthetase; A...   171    5e-42 
sp|A5FMG2.1|SYL_FLAJO  RecName: Full=Leucyl-tRNA synthetase; A...   171    5e-42  Gene info
sp|Q3APY5.1|SYL_CHLCH  Leucyl-tRNA synthetase (Leucine--tRNA l...   171    6e-42  Gene info
sp|A6LGA2.1|SYL_PARD8  RecName: Full=Leucyl-tRNA synthetase; A...   170    8e-42  Gene info
sp|Q04FL2.2|SYL_OENOB  Leucyl-tRNA synthetase (Leucine--tRNA l...   170    8e-42 
sp|A6H244.1|SYL_FLAPJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   169    1e-41  Gene info
sp|Q8G4D8|SYL_BIFLO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   169    1e-41 
sp|Q5FTV3.1|SYL_GLUOX  RecName: Full=Leucyl-tRNA synthetase; A...   169    1e-41 
sp|Q47MY0.1|SYL_THEFY  Leucyl-tRNA synthetase (Leucine--tRNA l...   169    2e-41  Gene info
sp|Q03RH7.1|SYL_LACBA  Leucyl-tRNA synthetase (Leucine--tRNA l...   168    3e-41  Gene info
sp|Q09828|SYLM_SCHPO  Putative leucyl-tRNA synthetase, mitocho...   168    3e-41  Gene info
sp|A7ZE39.1|SYL_CAMC1  RecName: Full=Leucyl-tRNA synthetase; A...   168    3e-41  Gene info
sp|P56457|SYL_HELPY  Leucyl-tRNA synthetase (Leucine--tRNA lig...   168    3e-41 
sp|Q82C66|SYL_STRAW  Leucyl-tRNA synthetase (Leucine--tRNA lig...   167    5e-41 
sp|A0RNX3.1|SYL_CAMFF  Leucyl-tRNA synthetase (Leucine--tRNA l...   167    7e-41  Gene info
sp|Q8FLM0|SYL_COREF  Leucyl-tRNA synthetase (Leucine--tRNA lig...   167    7e-41 
sp|Q7MW49.1|SYL_PORGI  RecName: Full=Leucyl-tRNA synthetase; A...   167    8e-41 
sp|A4SG27.1|SYL_PROVI  RecName: Full=Leucyl-tRNA synthetase; A...   166    1e-40  Gene info
sp|Q3B2E1.1|SYL_PELLD  Leucyl-tRNA synthetase (Leucine--tRNA l...   166    1e-40  Gene info
sp|A4T4R2.1|SYL_MYCGI  RecName: Full=Leucyl-tRNA synthetase; A...   166    2e-40  Gene info
sp|Q0SAL1.1|SYL_RHOSR  RecName: Full=Leucyl-tRNA synthetase; A...   166    2e-40  Gene info
sp|A0M5T1.1|SYL_GRAFK  Leucyl-tRNA synthetase (Leucine--tRNA l...   165    2e-40  Gene info
sp|Q8NLC4|SYL_CORGL  Leucyl-tRNA synthetase (Leucine--tRNA lig...   165    2e-40 
sp|A4QI59.1|SYL_CORGB  Leucyl-tRNA synthetase (Leucine--tRNA l...   165    3e-40  Gene info
sp|Q7M926|SYL_WOLSU  Leucyl-tRNA synthetase (Leucine--tRNA lig...   164    4e-40 
sp|Q5YN65.1|SYL_NOCFA  RecName: Full=Leucyl-tRNA synthetase; A...   164    5e-40 
sp|Q5L7B4.1|SYL_BACFN  RecName: Full=Leucyl-tRNA synthetase; A...   164    5e-40  Gene info
sp|A5CR89.1|SYL_CLAM3  Leucyl-tRNA synthetase (Leucine--tRNA l...   164    6e-40  Gene info
sp|Q64MG4.1|SYL_BACFR  RecName: Full=Leucyl-tRNA synthetase; A...   164    7e-40 
sp|A0Q8W7.2|SYL_MYCA1  Leucyl-tRNA synthetase (Leucine--tRNA l...   163    1e-39 
sp|Q4JSF0.1|SYL_CORJK  Leucyl-tRNA synthetase (Leucine--tRNA l...   163    1e-39  Gene info
sp|B0RDA6.1|SYL_CLAMS  RecName: Full=Leucyl-tRNA synthetase; A...   163    1e-39  Gene info
sp|A1BDY0.1|SYL_CHLPD  Leucyl-tRNA synthetase (Leucine--tRNA l...   163    1e-39  Gene info
sp|Q744V3|SYL_MYCPA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   163    1e-39 
sp|A3Q8Q1.2|SYL_MYCSJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   162    2e-39 
sp|A1UPA5.2|SYL_MYCSK  Leucyl-tRNA synthetase (Leucine--tRNA l...   162    2e-39 
sp|A0PKG2.1|SYL_MYCUA  Leucyl-tRNA synthetase (Leucine--tRNA l...   162    3e-39  Gene info
sp|Q1CR59.1|SYL_HELPH  RecName: Full=Leucyl-tRNA synthetase; A...   162    3e-39  Gene info
sp|Q9RDL5|SYL_STRCO  Leucyl-tRNA synthetase (Leucine--tRNA lig...   161    4e-39 
sp|Q50192|SYL_MYCLE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   161    4e-39 
sp|Q83HV5|SYL_TROW8  Leucyl-tRNA synthetase (Leucine--tRNA lig...   161    4e-39  Gene info
sp|Q83GC6|SYL_TROWT  Leucyl-tRNA synthetase (Leucine--tRNA lig...   161    4e-39  Gene info
sp|A1A1R2.1|SYL_BIFAA  Leucyl-tRNA synthetase (Leucine--tRNA l...   161    5e-39  Gene info
sp|Q9PNK3|SYL_CAMJE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   160    6e-39 
sp|A1W078.1|SYL_CAMJJ  Leucyl-tRNA synthetase (Leucine--tRNA l...   160    7e-39  Gene info
sp|Q5HU13|SYL_CAMJR  Leucyl-tRNA synthetase (Leucine--tRNA lig...   160    7e-39  Gene info
sp|A7H2R6.1|SYL_CAMJD  RecName: Full=Leucyl-tRNA synthetase; A...   160    7e-39  Gene info
sp|A8FME4.1|SYL_CAMJ8  RecName: Full=Leucyl-tRNA synthetase; A...   160    1e-38  Gene info
sp|A7I0M0.1|SYL_CAMHC  Leucyl-tRNA synthetase (Leucine--tRNA l...   160    1e-38  Gene info
sp|A1TI06.1|SYL_MYCVP  Leucyl-tRNA synthetase (Leucine--tRNA l...   160    1e-38  Gene info
sp|A0R7H5.1|SYL_MYCS2  Leucyl-tRNA synthetase (Leucine--tRNA l...   158    3e-38  Gene info
sp|A1KEK9.1|SYL_MYCBP  Leucyl-tRNA synthetase (Leucine--tRNA l...   158    3e-38  Gene info
sp|P13503|SYLM_SACDO  Leucyl-tRNA synthetase, mitochondrial pr...   157    4e-38 
sp|Q0RCJ1.1|SYL_FRAAA  RecName: Full=Leucyl-tRNA synthetase; A...   157    5e-38  Gene info
sp|A8MJY6.1|SYL_ALKOO  RecName: Full=Leucyl-tRNA synthetase; A...   157    5e-38  Gene info
sp|Q7VIY7|SYL_HELHP  Leucyl-tRNA synthetase (Leucine--tRNA lig...   157    5e-38 
sp|P15181.1|SYLM_NEUCR  RecName: Full=Leucyl-tRNA synthetase, ...   157    6e-38 
sp|P11325.1|SYLM_YEAST  Leucyl-tRNA synthetase, mitochondrial ...   157    8e-38  Gene info
sp|Q2J641.1|SYL_FRASC  RecName: Full=Leucyl-tRNA synthetase; A...   157    9e-38  Gene info
sp|Q9ZJ63|SYL_HELPJ  Leucyl-tRNA synthetase (Leucine--tRNA lig...   157    9e-38  Gene info
sp|A8ERV3.1|SYL_ARCB4  RecName: Full=Leucyl-tRNA synthetase; A...   156    1e-37  Gene info
sp|Q6AEW2|SYL_LEIXX  Leucyl-tRNA synthetase (Leucine--tRNA lig...   155    2e-37 
sp|A8LX93.1|SYL_SALAI  RecName: Full=Leucyl-tRNA synthetase; A...   154    4e-37  Gene info
sp|A4FR54.1|SYL_SACEN  Leucyl-tRNA synthetase (Leucine--tRNA l...   154    5e-37  Gene info
sp|Q6NEF5|SYL_CORDI  Leucyl-tRNA synthetase (Leucine--tRNA lig...   153    1e-36 
sp|B1AJ10.1|SYL_UREP2  Leucyl-tRNA synthetase (Leucine--tRNA l...   153    1e-36  Gene info
sp|Q98RB6.1|SYL_MYCPU  RecName: Full=Leucyl-tRNA synthetase; A...   151    5e-36 
sp|Q6MSR0.2|SYL_MYCMS  RecName: Full=Leucyl-tRNA synthetase; A...   150    1e-35 
sp|A9NET8.1|SYL_ACHLI  RecName: Full=Leucyl-tRNA synthetase; A...   148    3e-35  Gene info
sp|Q9HN72|SYL_HALSA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   146    1e-34 
sp|O67646|SYLB_AQUAE  Leucyl-tRNA synthetase subunit beta (Leu...   145    2e-34 
sp|Q2SRI9.1|SYL_MYCCT  RecName: Full=Leucyl-tRNA synthetase; A...   145    2e-34  Gene info
sp|Q8EW18.1|SYL_MYCPE  RecName: Full=Leucyl-tRNA synthetase; A...   142    2e-33 
sp|Q6F0X5.1|SYL_MESFL  RecName: Full=Leucyl-tRNA synthetase; A...   141    4e-33 
sp|P47508.1|SYL_MYCGE  RecName: Full=Leucyl-tRNA synthetase; A...   132    3e-30 
sp|P75398.1|SYL_MYCPN  RecName: Full=Leucyl-tRNA synthetase; A...   125    2e-28 
sp|Q7NB47.1|SYL_MYCGA  RecName: Full=Leucyl-tRNA synthetase; A...   117    7e-26 
sp|O66680.1|SYLA_AQUAE  Leucyl-tRNA synthetase subunit alpha (...  87.4    8e-17 
sp|O58052|SYV_PYRHO  Valyl-tRNA synthetase (Valine--tRNA ligas...  82.8    2e-15 
sp|Q8U409|SYV_PYRFU  Valyl-tRNA synthetase (Valine--tRNA ligas...  82.8    2e-15 
sp|Q9UY55|SYV_PYRAB  Valyl-tRNA synthetase (Valine--tRNA ligas...  82.8    2e-15 
sp|Q46AW0.1|SYL_METBF  Leucyl-tRNA synthetase (Leucine--tRNA l...  81.6    5e-15  Gene info
sp|O30250|SYL_ARCFU  Leucyl-tRNA synthetase (Leucine--tRNA lig...  79.7    2e-14 
sp|Q5JGN7|SYV_PYRKO  Valyl-tRNA synthetase (Valine--tRNA ligas...  77.0    1e-13  Gene info
sp|Q8Q054|SYL_METMA  Leucyl-tRNA synthetase (Leucine--tRNA lig...  73.9    9e-13 
sp|Q8TQD3|SYL_METAC  Leucyl-tRNA synthetase (Leucine--tRNA lig...  73.2    2e-12 
sp|Q8RBN5|SYV_THETN  Valyl-tRNA synthetase (Valine--tRNA ligas...  73.2    2e-12 
sp|O58792|SYI_PYRHO  Isoleucyl-tRNA synthetase (Isoleucine--tR...  72.8    2e-12 
sp|O26861|SYV_METTH  Valyl-tRNA synthetase (Valine--tRNA ligas...  71.2    6e-12 
sp|O58698|SYL_PYRHO  Leucyl-tRNA synthetase (Leucine--tRNA lig...  70.5    1e-11 

>sp|A8G4T7.1|SYL_PROM2 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=856

 GENE ID: 5615845 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9215]

 Score =  592 bits (1526),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 288/303 (95%), Positives = 297/303 (98%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKCS KPFEK EINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELF+IDEPFK
Sbjct  515  RYPSSKCSNKPFEKIEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFEIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQAAAYKNNKTGKYVSPSDI+DLSNPTDPIDN+KLEVLFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQAAAYKNNKTGKYVSPSDINDLSNPTDPIDNTKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFL+RIWKLYINCAKDINSKSNSY
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLNRIWKLYINCAKDINSKSNSY  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            PD+EKSLIKS+NIAIKEISNDILNNQFNTAISELMKFYNSL+NSIN VNN LKI+ALKTF
Sbjct  695  PDREKSLIKSMNIAIKEISNDILNNQFNTAISELMKFYNSLANSINDVNNTLKIEALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHIAEEIWHLIGFKKSVHLE+WP FNAEALKEDSYELVIQVNGKVRDKV IN
Sbjct  755  CILLAPFAPHIAEEIWHLIGFKKSVHLEYWPSFNAEALKEDSYELVIQVNGKVRDKVKIN  814

Query  301  NDM  303
            NDM
Sbjct  815  NDM  817


>sp|A3PCW8.1|SYL_PROM0 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=856

 GENE ID: 4911693 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9301]

 Score =  592 bits (1525),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 287/303 (94%), Positives = 297/303 (98%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKC  KPFEK EINKWLPVDQYVGGVEHAILHLLYARFFTKALRDN+LF+IDEPFK
Sbjct  515  RYPSSKCPNKPFEKIEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNQLFEIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQAAAYKNNKTGKYVSPSDI+DLSNPTDPIDN+KLE+LFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQAAAYKNNKTGKYVSPSDINDLSNPTDPIDNTKLEILFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAK++N KSNSY
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKNVNIKSNSY  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            PDKEKSLIKS+NIAIKEISNDILNNQFNTAISELMKFYNSLSNSIN VNNNLKIDALKTF
Sbjct  695  PDKEKSLIKSMNIAIKEISNDILNNQFNTAISELMKFYNSLSNSINDVNNNLKIDALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHIAEEIWHLIGFKKSVHLEHWP FNAEALKEDSYELVIQVNGKVR+KVNIN
Sbjct  755  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPSFNAEALKEDSYELVIQVNGKVREKVNIN  814

Query  301  NDM  303
            +DM
Sbjct  815  HDM  817


>sp|A2BR45.1|SYL_PROMS Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=856

 GENE ID: 4717682 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. AS9601]

 Score =  585 bits (1509),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 294/303 (97%), Positives = 300/303 (99%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKCSTKPFEK EINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK
Sbjct  515  RYPSSKCSTKPFEKNEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQ+AAYKNNKTGKYVSPSDI+DLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQSAAYKNNKTGKYVSPSDITDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAK+INSKSNS+
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKNINSKSNSH  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            PDKEKSLIKS+NIAIKEISNDILNNQFNTAISELMKFYNSLSNSIN +NNNLKIDALKTF
Sbjct  695  PDKEKSLIKSMNIAIKEISNDILNNQFNTAISELMKFYNSLSNSINDINNNLKIDALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHIAEEIWHLIGFKKSVHLEHWP FNAEALKEDSYELVIQVNGKVRDKVNIN
Sbjct  755  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPSFNAEALKEDSYELVIQVNGKVRDKVNIN  814

Query  301  NDM  303
            NDM
Sbjct  815  NDM  817


>sp|Q31AX4.1|SYL_PROM9 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=856

 GENE ID: 3765713 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9312]

 Score =  559 bits (1441),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 278/303 (91%), Positives = 294/303 (97%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSS+CSTKPFEK EIN WLPVDQYVGGVEHAILHLLYARFFTKALRDNELF+IDEPFK
Sbjct  515  RYPSSRCSTKPFEKIEINNWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFEIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQ+AAYKNNKTGKY+SPSDI+DLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQSAAYKNNKTGKYISPSDINDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGD+DVEGQFRFLSRIWKLYI+C+KDINSKS SY
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQFRFLSRIWKLYISCSKDINSKSKSY  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            P+KEK+LIKS+NIAIKEI+NDI NNQFNTAISELMKFYNSLSN+IN VNNNLKIDALKTF
Sbjct  695  PNKEKTLIKSMNIAIKEITNDISNNQFNTAISELMKFYNSLSNNINDVNNNLKIDALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHI+EEIW LIGFK SVHLEHWP FNAEALKEDSY LVIQVNGKVRDK+NIN
Sbjct  755  CILLAPFAPHISEEIWLLIGFKNSVHLEHWPSFNAEALKEDSYVLVIQVNGKVRDKININ  814

Query  301  NDM  303
            N+M
Sbjct  815  NEM  817


>sp|A2BWL7.1|SYL_PROM5 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=864

 GENE ID: 4719204 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9515]

 Score =  503 bits (1294),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 244/305 (80%), Positives = 271/305 (88%), Gaps = 2/305 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKC TKPFEK  +NKWLPVDQYVGGVEHAILHLLYARF TKALRDN LFDIDEPFK
Sbjct  521  RYPSSKCKTKPFEKDNVNKWLPVDQYVGGVEHAILHLLYARFLTKALRDNNLFDIDEPFK  580

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQAAAYKN KTGKY+SP DI D +NPTDP D+SKLEVLFEKMSKSKYNGIDPE
Sbjct  581  KLLTQGMVQAAAYKNTKTGKYISPKDIKDFNNPTDPNDDSKLEVLFEKMSKSKYNGIDPE  640

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCA--KDINSKSN  178
            SVIKKYGADTARMFILFKAPPEKDLEWGD+DVEGQ+RFL RIWKL+++    +  +++ N
Sbjct  641  SVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQYRFLCRIWKLFLDYRNNESWDNQKN  700

Query  179  SYPDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALK  238
               +KE SL KSINIAIKEISNDI NNQFNTAISELMKFYNSLS+S+ YVN +L+ DA K
Sbjct  701  YNREKENSLTKSINIAIKEISNDIKNNQFNTAISELMKFYNSLSSSMIYVNKDLRKDAFK  760

Query  239  TFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVN  298
             FCILLAPFAPHIAEEIW+LIG++KSVHLE WP+FN +ALKED YELVIQ+NGKVRDK+N
Sbjct  761  KFCILLAPFAPHIAEEIWNLIGYQKSVHLERWPIFNEDALKEDCYELVIQINGKVRDKIN  820

Query  299  INNDM  303
            +  D+
Sbjct  821  VGIDI  825


>sp|Q7V1I2|SYL_PROMP Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=858

 GENE ID: 1726569 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus subsp. pastoris str. CCMP1986]
(10 or fewer PubMed links)

 Score =  486 bits (1252),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 234/301 (77%), Positives = 271/301 (90%), Gaps = 2/301 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSK  TKPFEK +INKWLPVDQYVGGVEHAILHLLYARF TKALRDN LFDIDEPFK
Sbjct  515  RYPSSKSLTKPFEKEKINKWLPVDQYVGGVEHAILHLLYARFLTKALRDNNLFDIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            +LLTQGMVQ+AAYKN+ TGKY+SP+DI D++NP DP DNSKLEVLFEKMSKSKYNGIDPE
Sbjct  575  RLLTQGMVQSAAYKNSITGKYISPTDIKDITNPKDPKDNSKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCA-KDINSKSNS  179
            SVIKKYGADTARMFILFKAPPEKDLEWGD+DVEGQ+RFL RIWKL+++ +  DI  +++ 
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQYRFLCRIWKLFLDYSNNDITHEADK  694

Query  180  Y-PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALK  238
               + E SL+KSINIAIKEISNDI NNQFNTAISELMKFYNS+S+++NYVN +L+ ++L 
Sbjct  695  LKKENESSLLKSINIAIKEISNDIKNNQFNTAISELMKFYNSISSNLNYVNKDLRRESLM  754

Query  239  TFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVN  298
             FCILLAPFAPHI++EIWHLIG  KSVHLE WP+F+ +ALKE+S+ELVIQ+NGKVRDK+N
Sbjct  755  KFCILLAPFAPHISDEIWHLIGNSKSVHLEKWPVFDEDALKENSFELVIQINGKVRDKIN  814

Query  299  I  299
            +
Sbjct  815  V  815


>sp|Q46L15.1|SYL_PROMT Gene info RecName: Full=Leucyl-tRNA synthetase; AltName: Full=Leucine--tRNA 
ligase; Short=LeuRS
Length=862

 GENE ID: 3605694 PMN2A_0321 | leucyl-tRNA synthetase
[Prochlorococcus marinus str. NATL2A]

 Score =  363 bits (933),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 226/307 (73%), Gaps = 4/307 (1%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RY +     KPF K+EI+KWLPV QYVGG+EHAILHLLY+RF TKAL+   L +IDEPFK
Sbjct  517  RYINPDNCEKPFLKSEIDKWLPVKQYVGGIEHAILHLLYSRFLTKALKKCGLINIDEPFK  576

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQA  +KN  T KY S   I D+ NP DP+    +E+++EKMSKSKYNG+DP 
Sbjct  577  KLLTQGMVQAVTFKNPNTNKYFSKDQIKDIDNPKDPLTGENIEIIYEKMSKSKYNGVDPS  636

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
             VI KYGADTARMFILFKAPPEKDLEW D+DVEGQ+RF+ R+WK  IN  K  N+ S S 
Sbjct  637  VVIDKYGADTARMFILFKAPPEKDLEWDDSDVEGQYRFIQRLWKFVINTFKLTNNNSRSN  696

Query  181  PDKEKS----LIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDA  236
             +KEKS     ++ INIAIKEI++D+ N QFNTAISELMK  N LS  +NY +N      
Sbjct  697  IEKEKSKDEEALRLINIAIKEITDDLDNLQFNTAISELMKVVNGLSLIVNYCSNETLNKV  756

Query  237  LKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDK  296
            +     + +PF+PHIAEE+W  IG  +S+HL+ WP F+A A+++D+++L+IQ+NGKVR  
Sbjct  757  ISILVKITSPFSPHIAEELWKTIGNTQSIHLQSWPEFDAGAIEQDTFKLMIQINGKVRGS  816

Query  297  VNINNDM  303
            +N + ++
Sbjct  817  INASKNL  823


>sp|A2C242.1|SYL_PROM1 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=862

 GENE ID: 4780516 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. NATL1A]

 Score =  363 bits (932),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 226/307 (73%), Gaps = 4/307 (1%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RY +     KPF K+EI+KWLPV QYVGG+EHAILHLLY+RF TKAL+   L +IDEPFK
Sbjct  517  RYINPDNCEKPFLKSEIDKWLPVKQYVGGIEHAILHLLYSRFLTKALKRCGLINIDEPFK  576

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQA  +KN  T KY S   I D+ NP DP+    +E+++EKMSKSKYNG+DP 
Sbjct  577  KLLTQGMVQAVTFKNPNTNKYFSKDQIKDIDNPKDPLTGENIEIIYEKMSKSKYNGVDPS  636

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
             VI KYGADTARMFILFKAPPEKDLEW D+DVEGQ+RF+ R+WK  IN  K  N+ S S 
Sbjct  637  VVIDKYGADTARMFILFKAPPEKDLEWDDSDVEGQYRFIQRLWKFVINTFKLTNNNSRSN  696

Query  181  PDKEKS----LIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDA  236
             +KEKS     ++ INIAIKEI++D+ N QFNTAISELMK  N LS  +NY +N      
Sbjct  697  IEKEKSKDEEALRLINIAIKEITDDLDNLQFNTAISELMKVVNGLSLIVNYCSNETLNKV  756

Query  237  LKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDK  296
            +     + +PF+PHIAEE+W  IG  +S+HL+ WP F+A A+++D+++L+IQ+NGKVR  
Sbjct  757  ISILVKITSPFSPHIAEELWKTIGNTQSIHLQSWPEFDAGAIEQDTFKLMIQINGKVRGS  816

Query  297  VNINNDM  303
            +N + ++
Sbjct  817  INASKNL  823


>sp|Q3AJU8.1|SYL_SYNSC Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=875

 GENE ID: 3735935 leuS | leucyl-tRNA synthetase [Synechococcus sp. CC9605]

 Score =  355 bits (910),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/306 (54%), Positives = 222/306 (72%), Gaps = 7/306 (2%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            R+     + KPF K  +N+WLPV QYVGG+EHAILHLLYARFFTKAL+D  L DI+EPF+
Sbjct  527  RFADPHNTEKPFSKEAVNRWLPVKQYVGGIEHAILHLLYARFFTKALKDRGLIDINEPFE  586

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            +LLTQGMVQ   Y+N  TGKY++P+D++D  +P DP    KLEVLFEKMSKSKYNG+DP 
Sbjct  587  RLLTQGMVQGVTYRNATTGKYIAPADVADAEDPRDPNTGDKLEVLFEKMSKSKYNGVDPA  646

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINS-----  175
            +VI +YGADTARMFILFKAPPEKDLEW D DVEGQFRFL R+W+L    +  I+S     
Sbjct  647  AVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFLQRLWRLVEAGSARIDSLEPMQ  706

Query  176  KSNSYPDKEKSLIKSINIAIKEISNDILNN-QFNTAISELMKFYNSLSNS-INYVNNNLK  233
            +     D +  + +++++AI+ +S D+ +  Q NTAISELMK  N++S++ I+ ++  + 
Sbjct  707  RPADLSDADSDVRRALHLAIEAVSEDLSDEIQLNTAISELMKLSNAISSTGIDALSAPVL  766

Query  234  IDALKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKV  293
             +AL     LLAPFAPH+AEE W+ +G   SVH + WP+ +  AL +DS E+VIQV GKV
Sbjct  767  QEALSGLVRLLAPFAPHLAEEFWNRLGGSGSVHRQSWPVLDPTALVQDSVEVVIQVKGKV  826

Query  294  RDKVNI  299
            R K+ +
Sbjct  827  RGKLQV  832


>sp|A5GL71.1|SYL_SYNPW Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
Length=878

 GENE ID: 5146257 leuS | leucyl-tRNA synthetase [Synechococcus sp. WH 7803]

 Score =  354 bits (909),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/313 (52%), Positives = 220/313 (70%), Gaps = 11/313 (3%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            R+     + + F+   + +WLPV QYVGG+EHAILHLLY+RFFTKALRD  L +I EPF+
Sbjct  525  RFADPHNTERAFDADAVERWLPVQQYVGGIEHAILHLLYSRFFTKALRDRGLLNIREPFE  584

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            +LLTQGMVQ   Y+N +TG+YV+PS++SD + P DP+D  +LEVLFEKMSKSKYNG+DP 
Sbjct  585  RLLTQGMVQGVTYRNPRTGRYVAPSEVSDENAPKDPVDGGELEVLFEKMSKSKYNGVDPA  644

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSK----  176
            +VI +YGADTARMFILFKAPPEKDLEW D DVEGQFRFL R+W+L  +   D   +    
Sbjct  645  AVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFLQRLWRLIESVRSDDQDQLLGD  704

Query  177  ------SNSYPDKEKSLIKSINIAIKEISNDILNN-QFNTAISELMKFYNSLSNSINYVN  229
                   +   DKE  + ++++ AI+ +S+D+  + QFNTAISELMK  N+LS ++   +
Sbjct  705  PVDPPEGSGLSDKEGEIRRAVHTAIEAVSDDLKGDFQFNTAISELMKLSNTLSGALPEAS  764

Query  230  NNLKIDALKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQV  289
              ++ +A+     LLAPFAPH+AEE W  +G + SVH + WPL +  AL  D+ +LVIQV
Sbjct  765  RAVQAEAVSALIRLLAPFAPHLAEEFWFSLGGQDSVHKQPWPLHDPAALVRDTVDLVIQV  824

Query  290  NGKVRDKVNINND  302
             GKVR  + +  D
Sbjct  825  KGKVRGTITVPAD  837



------------------------------------------------------------------------------------------
                                                                     Score     E

b)Sequences producing significant alignments:                       (Bits)  Value

ref|YP_001484204.1|  leucyl-tRNA synthetase [Prochlorococcus m...   592    1e-167 Gene info
ref|YP_001091194.1|  leucyl-tRNA synthetase [Prochlorococcus m...   592    2e-167 Gene info
ref|YP_001009363.1|  leucyl-tRNA synthetase [Prochlorococcus m...   585    1e-165 Gene info
ref|YP_397407.1|  leucyl-tRNA synthetase [Prochlorococcus mari...   559    9e-158 Gene info
ref|YP_001011285.1|  leucyl-tRNA synthetase [Prochlorococcus m...   503    1e-140 Gene info
ref|NP_893007.1|  leucyl-tRNA synthetase [Prochlorococcus mari...   486    8e-136 Gene info
ref|YP_291516.1|  leucyl-tRNA synthetase [Prochlorococcus mari...   363    8e-99  Gene info
ref|YP_001014817.1|  leucyl-tRNA synthetase [Prochlorococcus m...   363    9e-99  Gene info
ref|ZP_01124067.1|  t-RNA synthetase, class Ia:Leucyl-tRNA syn...   359    2e-97 
ref|ZP_01472104.1|  t-RNA synthetase, class Ia:Leucyl-tRNA syn...   357    9e-97 
ref|YP_381689.1|  leucyl-tRNA synthetase [Synechococcus sp. CC...   355    3e-96  Gene info
ref|YP_001224983.1|  leucyl-tRNA synthetase [Synechococcus sp....   354    5e-96  Gene info
ref|NP_875339.1|  leucyl-tRNA synthetase [Prochlorococcus mari...   354    5e-96  Gene info
ref|ZP_01085504.1|  t-RNA synthetase, class Ia:Leucyl-tRNA syn...   354    6e-96 
ref|NP_897348.1|  leucyl-tRNA synthetase [Synechococcus sp. WH...   352    2e-95  Gene info
ref|YP_730582.1|  leucyl-tRNA synthetase [Synechococcus sp. CC...   350    8e-95  Gene info
ref|NP_682888.1|  leucyl-tRNA synthetase [Thermosynechococcus ...   346    1e-93  Gene info
ref|YP_400937.1|  leucyl-tRNA synthetase [Synechococcus elonga...   345    2e-93  Gene info
ref|YP_377114.1|  leucyl-tRNA synthetase [Synechococcus sp. CC...   345    3e-93  Gene info

ref|YP_172884.1|  leucyl-tRNA synthetase [Synechococcus elonga...   343    1e-92  Gene info
ref|ZP_03272163.1|  leucyl-tRNA synthetase [Arthrospira maxima...   341    4e-92 
ref|ZP_03156048.1|  leucyl-tRNA synthetase [Cyanothece sp. PCC...   340    6e-92 
ref|ZP_01467815.1|  Leucyl-tRNA synthetase class Ia [Synechoco...   339    2e-91 
gb|EDX70933.1|  leucyl-tRNA synthetase [Microcoleus chthonopla...   338    2e-91 
ref|YP_001805651.1|  leucyl-tRNA synthetase [Cyanothece sp. AT...   337    5e-91  Gene info
ref|YP_001550760.1|  leucyl-tRNA synthetase [Prochlorococcus m...   337    7e-91  Gene info
gb|EDY38970.1|  leucyl-tRNA synthetase [Cyanobium sp. PCC 7001]     336    1e-90 
ref|ZP_00516188.1|  Leucyl-tRNA synthetase bacterial/mitochond...   331    4e-89 
ref|ZP_01080308.1|  leucyl-tRNA synthetase [Synechococcus sp. ...   330    8e-89 
ref|ZP_02973391.1|  leucyl-tRNA synthetase [Cyanothece sp. PCC...   330    8e-89 
ref|NP_894547.1|  leucyl-tRNA synthetase [Prochlorococcus mari...   328    4e-88  Gene info
ref|YP_001227444.1|  leucyl-tRNA synthetase [Synechococcus sp....   327    7e-88  Gene info
ref|ZP_01729399.1|  leucyl-tRNA synthetase [Cyanothece sp. CCY...   327    8e-88 
ref|ZP_02941007.1|  leucyl-tRNA synthetase [Cyanothece sp. PCC...   325    3e-87 
ref|YP_001017515.1|  leucyl-tRNA synthetase [Prochlorococcus m...   325    3e-87  Gene info
ref|ZP_03142822.1|  leucyl-tRNA synthetase [Cyanothece sp. PCC...   324    6e-87 
ref|YP_001515391.1|  leucyl-tRNA synthetase [Acaryochloris mar...   321    4e-86  Gene info
gb|EDX83630.1|  leucyl-tRNA synthetase [Synechococcus sp. PCC ...   320    1e-85 
ref|NP_487323.1|  leucyl-tRNA synthetase [Nostoc sp. PCC 7120]...   320    1e-85  Gene info
ref|YP_479064.1|  leucyl-tRNA synthetase [Synechococcus sp. JA...   318    3e-85  Gene info
ref|YP_001867477.1|  leucyl-tRNA synthetase [Nostoc punctiform...   317    5e-85  Gene info
ref|YP_325428.1|  leucyl-tRNA synthetase [Anabaena variabilis ...   317    9e-85  Gene info
ref|YP_001734939.1|  leucyl-tRNA synthetase [Synechococcus sp....   316    1e-84  Gene info
ref|ZP_01628215.1|  leucyl-tRNA synthetase [Nodularia spumigen...   310    7e-83 
ref|ZP_03139268.1|  leucyl-tRNA synthetase [Cyanothece sp. PCC...   310    1e-82 
ref|NP_440622.1|  leucyl-tRNA synthetase [Synechocystis sp. PC...   310    1e-82  Gene info
ref|YP_474702.1|  leucyl-tRNA synthetase [Synechococcus sp. JA...   309    2e-82  Gene info
ref|YP_001659573.1|  leucyl-tRNA synthetase [Microcystis aerug...   306    1e-81  Gene info
emb|CAO88726.1|  leuS [Microcystis aeruginosa PCC 7806]             305    4e-81 
ref|YP_002048815.1|  t-RNA synthetase, class Ia:Leucyl-tRNA sy...   301    4e-80  Gene info
ref|NP_927027.1|  leucyl-tRNA synthetase [Gloeobacter violaceu...   281    6e-74  Gene info
ref|YP_359254.1|  leucyl-tRNA synthetase [Carboxydothermus hyd...   268    3e-70  Gene info
ref|NP_794546.1|  leucyl-tRNA synthetase [Pseudomonas syringae...   256    1e-66  Gene info
ref|YP_276510.1|  leucyl-tRNA synthetase [Pseudomonas syringae...   255    2e-66  Gene info
ref|YP_002163975.1|  leucine--tRNA ligase [Fusobacterium nucle...   254    7e-66  Gene info
ref|YP_237420.1|  leucyl-tRNA synthetase [Pseudomonas syringae...   254    8e-66  Gene info
gb|ABV59084.1|  leucyl-tRNA synthetase [Pseudomonas syringae p...   252    2e-65 
ref|ZP_01188748.1|  Leucyl-tRNA synthetase bacterial/mitochond...   251    4e-65 
ref|ZP_00144237.1|  Leucyl-tRNA synthetase [Fusobacterium nucl...   250    8e-65 
ref|YP_429441.1|  leucyl-tRNA synthetase [Moorella thermoaceti...   247    9e-64  Gene info
ref|YP_661142.1|  leucyl-tRNA synthetase [Pseudoalteromonas at...   247    1e-63  Gene info
ref|NP_602344.1|  leucyl-tRNA synthetase [Fusobacterium nuclea...   246    1e-63  Gene info
ref|YP_262507.1|  leucyl-tRNA synthetase [Pseudomonas fluoresc...   246    2e-63  Gene info
ref|ZP_01217184.1|  leucyl-tRNA synthetase [Psychromonas sp. C...   246    2e-63 
ref|YP_001320130.1|  leucyl-tRNA synthetase [Alkaliphilus meta...   244    5e-63  Gene info
ref|YP_001113850.1|  leucyl-tRNA synthetase [Desulfotomaculum ...   244    6e-63  Gene info
ref|ZP_01135212.1|  leucyl-tRNA synthetase [Pseudoalteromonas ...   244    9e-63 
ref|YP_350685.1|  leucyl-tRNA synthetase [Pseudomonas fluoresc...   243    1e-62  Gene info
ref|YP_002125970.1|  leucyl-tRNA synthetase [Alteromonas macle...   243    1e-62  Gene info
sp|A4XYW8.2|SYL_PSEMY  RecName: Full=Leucyl-tRNA synthetase; A...   243    2e-62 
ref|YP_001189266.1|  leucyl-tRNA synthetase [Pseudomonas mendo...   242    2e-62  Gene info
ref|YP_610252.1|  leucyl-tRNA synthetase [Pseudomonas entomoph...   242    3e-62  Gene info
ref|YP_942624.1|  leucyl-tRNA synthetase [Psychromonas ingraha...   242    3e-62  Gene info
ref|YP_846202.1|  leucyl-tRNA synthetase [Syntrophobacter fuma...   242    3e-62  Gene info
ref|YP_001346507.1|  leucyl-tRNA synthetase [Pseudomonas aerug...   242    3e-62  Gene info
ref|ZP_01449513.1|  leucyl-tRNA synthetase [alpha proteobacter...   241    4e-62 
ref|ZP_01899737.1|  leucyl-tRNA synthetase [Moritella sp. PE36...   241    4e-62 
ref|YP_001747501.1|  leucyl-tRNA synthetase [Pseudomonas putid...   241    6e-62  Gene info
ref|YP_001671067.1|  leucyl-tRNA synthetase [Pseudomonas putid...   241    6e-62  Gene info
ref|YP_001180595.1|  leucyl-tRNA synthetase [Caldicellulosirup...   241    6e-62  Gene info
ref|YP_519391.1|  leucyl-tRNA synthetase [Desulfitobacterium h...   241    7e-62  Gene info
ref|YP_001411022.1|  leucyl-tRNA synthetase [Fervidobacterium ...   240    8e-62  Gene info
ref|ZP_01666607.1|  leucyl-tRNA synthetase [Thermosinus carbox...   240    8e-62 
ref|ZP_01313416.1|  leucyl-tRNA synthetase [Desulfuromonas ace...   240    9e-62 
ref|YP_754271.1|  leucyl-tRNA synthetase [Syntrophomonas wolfe...   240    1e-61  Gene info
ref|ZP_02211857.1|  hypothetical protein CLOBAR_01473 [Clostri...   240    1e-61 
sp|A4VQZ0.2|SYL_PSEU5  Leucyl-tRNA synthetase (Leucine--tRNA l...   240    1e-61 
ref|YP_155336.1|  leucyl-tRNA synthetase [Idiomarina loihiensi...   240    1e-61  Gene info
ref|YP_001174233.1|  leucyl-tRNA synthetase [Pseudomonas stutz...   240    1e-61  Gene info
sp|A5W9H9.2|SYL_PSEP1  RecName: Full=Leucyl-tRNA synthetase; A...   239    2e-61 
ref|YP_001269973.1|  leucyl-tRNA synthetase [Pseudomonas putid...   239    2e-61  Gene info
ref|NP_746899.1|  leucyl-tRNA synthetase [Pseudomonas putida K...   239    2e-61  Gene info
ref|YP_356829.1|  leucyl-tRNA synthetase [Pelobacter carbinoli...   238    3e-61  Gene info
ref|NP_252676.1|  leucyl-tRNA synthetase [Pseudomonas aerugino...   238    3e-61  Gene info
ref|YP_159513.1|  leucyl-tRNA synthetase [Azoarcus sp. EbN1] >...   238    4e-61  Gene info
ref|YP_789131.1|  leucyl-tRNA synthetase [Pseudomonas aerugino...   238    4e-61  Gene info
ref|ZP_01044049.1|  leucyl-tRNA synthetase [Idiomarina baltica...   238    6e-61 
ref|YP_001916721.1|  leucyl-tRNA synthetase [Natranaerobius th...   238    6e-61  Gene info
ref|YP_001140938.1|  leucyl-tRNA synthetase [Aeromonas salmoni...   237    7e-61  Gene info
ref|ZP_00415936.1|  Leucyl-tRNA synthetase bacterial/mitochond...   237    7e-61 
ref|YP_001037662.1|  leucyl-tRNA synthetase [Clostridium therm...   237    9e-61  Gene info
ref|NP_716799.1|  leucyl-tRNA synthetase [Shewanella oneidensi...   236    1e-60  Gene info
ref|YP_268460.1|  leucyl-tRNA synthetase [Colwellia psychreryt...   236    2e-60  Gene info
ref|ZP_03023436.1|  leucyl-tRNA synthetase [Geobacter sp. M21]...   236    2e-60 
ref|NP_953258.1|  leucyl-tRNA synthetase [Geobacter sulfurredu...   236    2e-60  Gene info
ref|YP_868642.1|  leucyl-tRNA synthetase [Shewanella sp. ANA-3...   235    3e-60  Gene info
ref|YP_737118.1|  leucyl-tRNA synthetase [Shewanella sp. MR-7]...   235    3e-60  Gene info
ref|YP_733134.1|  leucyl-tRNA synthetase [Shewanella sp. MR-4]...   235    3e-60  Gene info
ref|YP_316203.1|  leucyl-tRNA synthetase [Thiobacillus denitri...   235    4e-60  Gene info
ref|YP_001209169.1|  leucyl-tRNA synthetase [Dichelobacter nod...   234    5e-60  Gene info
ref|YP_001681217.1|  leucyl-tRNA synthetase [Heliobacterium mo...   234    7e-60  Gene info
ref|ZP_00826001.1|  COG0495: Leucyl-tRNA synthetase [Yersinia ...   234    9e-60 
ref|ZP_00834461.1|  COG0495: Leucyl-tRNA synthetase [Yersinia ...   233    1e-59 
ref|YP_385250.1|  leucyl-tRNA synthetase [Geobacter metallired...   233    1e-59  Gene info
ref|ZP_02843337.1|  leucyl-tRNA synthetase [Thauera sp. MZ1T] ...   233    2e-59 
ref|YP_721442.1|  leucyl-tRNA synthetase [Trichodesmium erythr...   233    2e-59  Gene info
ref|ZP_01165002.1|  Leucyl-tRNA synthetase [Oceanospirillum sp...   232    3e-59 
sp|A0KN87.2|SYL_AERHH  Leucyl-tRNA synthetase (Leucine--tRNA l...   232    3e-59 
ref|YP_864363.1|  leucyl-tRNA synthetase [Magnetococcus sp. MC...   232    3e-59  Gene info
ref|YP_594530.1|  leucyl-tRNA synthetase [Lawsonia intracellul...   231    4e-59  Gene info
emb|CAI44284.1|  leucyl-tRNA synthetase [Thermotoga naphthophila]   231    5e-59 
ref|YP_002249023.1|  leucyl-tRNA synthetase [Thermodesulfovibr...   231    5e-59  Gene info
ref|YP_002137573.1|  leucyl-tRNA synthetase [Geobacter bemidji...   231    5e-59  Gene info
ref|ZP_02132852.1|  leucyl-tRNA synthetase [Desulfatibacillum ...   231    5e-59 
ref|NP_900175.1|  leucyl-tRNA synthetase [Chromobacterium viol...   231    6e-59  Gene info
ref|ZP_01705326.1|  leucyl-tRNA synthetase [Shewanella putrefa...   231    7e-59 
ref|YP_962444.1|  leucyl-tRNA synthetase [Shewanella sp. W3-18...   231    7e-59  Gene info
ref|YP_001738815.1|  leucyl-tRNA synthetase [Thermotoga sp. RQ...   231    7e-59  Gene info
emb|CAI44428.1|  leucyl-tRNA synthetase [Thermotoga sp. RQ2]        231    8e-59 
ref|YP_001477439.1|  leucyl-tRNA synthetase [Serratia proteama...   230    8e-59  Gene info
emb|CAI44301.1|  leucyl-tRNA synthetase [Thermotoga petrophila]     230    8e-59 
ref|NP_227983.1|  leucyl-tRNA synthetase [Thermotoga maritima ...   230    8e-59  Gene info
ref|YP_001184381.1|  leucyl-tRNA synthetase [Shewanella putref...   230    9e-59  Gene info
ref|YP_001244352.1|  leucyl-tRNA synthetase [Thermotoga petrop...   230    1e-58  Gene info
ref|YP_001089035.1|  leucyl-tRNA synthetase [Clostridium diffi...   230    1e-58  Gene info
ref|ZP_03118416.1|  leucyl-tRNA synthetase [Clostridium diffic...   230    1e-58 
ref|ZP_02748401.1|  leucyl-tRNA synthetase [Clostridium diffic...   230    1e-58 
ref|YP_001211389.1|  leucyl-tRNA synthetase [Pelotomaculum the...   230    1e-58  Gene info
ref|YP_001367501.1|  leucyl-tRNA synthetase [Shewanella baltic...   230    1e-58  Gene info
ref|YP_001721741.1|  leucyl-tRNA synthetase [Yersinia pseudotu...   230    1e-58  Gene info
ref|YP_001606329.1|  leucyl-tRNA synthetase [Yersinia pestis A...   230    1e-58  Gene info
ref|NP_406136.1|  leucyl-tRNA synthetase [Yersinia pestis CO92...   230    1e-58  Gene info
sp|A6WRJ9.2|SYL_SHEB8  Leucyl-tRNA synthetase (Leucine--tRNA l...   230    1e-58 
ref|YP_001471465.1|  leucyl-tRNA synthetase [Thermotoga lettin...   229    2e-58  Gene info
ref|YP_934717.1|  hypothetical protein azo3215 [Azoarcus sp. B...   229    2e-58  Gene info
ref|YP_574392.1|  leucyl-tRNA synthetase [Chromohalobacter sal...   229    2e-58  Gene info
ref|ZP_01624670.1|  leucyl-tRNA synthetase [Lyngbya sp. PCC 81...   229    2e-58 
ref|YP_001007185.1|  leucyl-tRNA synthetase [Yersinia enteroco...   229    3e-58  Gene info
emb|CAI44328.1|  leucyl-tRNA synthetase [Thermotoga sp. RQ7]        228    3e-58 
ref|YP_001908271.1|  Leucyl-tRNA synthetase [Erwinia tasmanien...   228    4e-58  Gene info
emb|CAI44244.1|  leucyl-tRNA synthetase [Thermotoga neapolitana]    228    4e-58 
ref|YP_460226.1|  leucyl-tRNA synthetase [Syntrophus aciditrop...   228    4e-58  Gene info
ref|YP_001051618.1|  leucyl-tRNA synthetase [Shewanella baltic...   228    5e-58  Gene info
ref|ZP_01737951.1|  leucyl-tRNA synthetase [Marinobacter sp. E...   228    5e-58 
sp|A3D7N6.2|SYL_SHEB5  Leucyl-tRNA synthetase (Leucine--tRNA l...   228    5e-58 
ref|ZP_01844008.1|  leucyl-tRNA synthetase [Shewanella baltica...   228    5e-58 
ref|YP_001530319.1|  leucyl-tRNA synthetase [Desulfococcus ole...   228    6e-58  Gene info
ref|YP_901401.1|  leucyl-tRNA synthetase [Pelobacter propionic...   228    6e-58  Gene info
ref|YP_749401.1|  leucyl-tRNA synthetase [Shewanella frigidima...   228    7e-58  Gene info
sp|Q087K2.2|SYL_SHEFN  Leucyl-tRNA synthetase (Leucine--tRNA l...   227    7e-58 
ref|YP_001095054.1|  leucyl-tRNA synthetase [Shewanella loihic...   227    8e-58  Gene info
ref|ZP_00828590.1|  COG0495: Leucyl-tRNA synthetase [Yersinia ...   227    8e-58 
ref|YP_857738.1|  leucyl-tRNA synthetase [Aeromonas hydrophila...   227    8e-58  Gene info
ref|ZP_00821621.1|  COG0495: Leucyl-tRNA synthetase [Yersinia ...   227    8e-58 
ref|YP_001555869.1|  leucyl-tRNA synthetase [Shewanella baltic...   227    9e-58  Gene info
ref|YP_001952352.1|  leucyl-tRNA synthetase [Geobacter lovleyi...   227    9e-58  Gene info
ref|YP_002251273.1|  leucyl-tRNA synthetase [Dictyoglomus ther...   227    9e-58  Gene info
sp|A9L001.2|SYL_SHEB9  RecName: Full=Leucyl-tRNA synthetase; A...   227    9e-58 
ref|NP_797106.1|  leucyl-tRNA synthetase [Vibrio parahaemolyti...   227    9e-58  Gene info
ref|YP_390749.1|  leucyl-tRNA synthetase [Thiomicrospira cruno...   227    1e-57  Gene info
ref|YP_001100904.1|  leucine tRNA synthetase [Herminiimonas ar...   226    1e-57  Gene info
ref|NP_759279.1|  leucyl-tRNA synthetase [Vibrio vulnificus CM...   226    1e-57  Gene info
ref|YP_428712.1|  leucyl-tRNA synthetase [Rhodospirillum rubru...   226    1e-57  Gene info
ref|NP_933704.1|  leucyl-tRNA synthetase [Vibrio vulnificus YJ...   226    2e-57  Gene info
ref|YP_001762057.1|  leucyl-tRNA synthetase [Shewanella woodyi...   226    2e-57  Gene info
ref|YP_001567409.1|  leucyl-tRNA synthetase [Petrotoga mobilis...   226    2e-57  Gene info
ref|YP_561810.1|  leucyl-tRNA synthetase [Shewanella denitrifi...   226    2e-57  Gene info
ref|YP_010415.1|  leucyl-tRNA synthetase [Desulfovibrio vulgar...   226    2e-57  Gene info
ref|YP_967305.1|  leucyl-tRNA synthetase [Desulfovibrio vulgar...   226    2e-57  Gene info
sp|Q12R39.2|SYL_SHEDO  RecName: Full=Leucyl-tRNA synthetase; A...   226    2e-57 
ref|YP_436452.1|  leucyl-tRNA synthetase [Hahella chejuensis K...   226    2e-57  Gene info
ref|ZP_01895239.1|  leucyl-tRNA synthetase [Marinobacter algic...   226    2e-57 
ref|ZP_01262727.1|  leucyl-tRNA synthetase [Vibrio alginolytic...   226    2e-57 
ref|ZP_02159669.1|  leucyl-tRNA synthetase [Shewanella benthic...   226    2e-57 
ref|YP_551386.1|  leucyl-tRNA synthetase [Polaromonas sp. JS66...   224    5e-57  Gene info
ref|YP_001305515.1|  leucyl-tRNA synthetase [Thermosipho melan...   224    5e-57  Gene info
ref|YP_741244.1|  leucyl-tRNA synthetase [Alkalilimnicola ehrl...   224    5e-57  Gene info
ref|YP_001675434.1|  leucyl-tRNA synthetase [Shewanella halifa...   224    5e-57  Gene info
sp|A1S8S8.2|SYL_SHEAM  Leucyl-tRNA synthetase (Leucine--tRNA l...   224    6e-57 
ref|ZP_01978804.1|  leucyl-tRNA synthetase [Vibrio cholerae MZ...   224    6e-57 
sp|B0TR44.2|SYL_SHEHH  RecName: Full=Leucyl-tRNA synthetase; A...   224    6e-57 
ref|ZP_03294033.1|  hypothetical protein CLOHIR_01984 [Clostri...   224    6e-57 
ref|YP_928454.1|  leucyl-tRNA synthetase [Shewanella amazonens...   224    6e-57  Gene info
ref|YP_113910.1|  leucyl-tRNA synthetase [Methylococcus capsul...   224    7e-57  Gene info
ref|YP_002069683.1|  leucyl-tRNA synthetase [Vibrio cholerae R...   224    7e-57  Gene info
ref|NP_520865.1|  leucyl-tRNA synthetase [Ralstonia solanacear...   224    7e-57  Gene info
ref|ZP_01127145.1|  Leucyl-tRNA synthetase [Nitrococcus mobili...   224    9e-57 
ref|YP_001475211.1|  leucyl-tRNA synthetase [Shewanella sedimi...   224    9e-57  Gene info
ref|ZP_01949047.1|  leucyl-tRNA synthetase [Vibrio cholerae 15...   224    9e-57 
ref|YP_001231868.1|  leucyl-tRNA synthetase [Geobacter uraniir...   224    9e-57  Gene info
ref|ZP_03285707.1|  leucyl-tRNA synthetase [Dictyoglomus turgi...   224    1e-56 
ref|YP_960006.1|  leucyl-tRNA synthetase [Marinobacter aquaeol...   223    1e-56  Gene info
ref|ZP_02001778.1|  leucyl-tRNA synthetase [Beggiatoa sp. PS] ...   223    1e-56 
sp|A1U4A0.2|SYL_MARAV  Leucyl-tRNA synthetase (Leucine--tRNA l...   223    1e-56 
ref|ZP_01224786.1|  leucyl-tRNA synthetase [marine gamma prote...   223    1e-56 
ref|YP_001502994.1|  leucyl-tRNA synthetase [Shewanella pealea...   223    1e-56  Gene info
ref|ZP_02959607.1|  hypothetical protein PROSTU_01478 [Provide...   223    1e-56 
ref|ZP_01682256.1|  leucyl-tRNA synthetase [Vibrio cholerae V5...   223    2e-56 
ref|ZP_01307986.1|  leucyl-tRNA synthetase [Oceanobacter sp. R...   223    2e-56 
sp|A8H7C2.2|SYL_SHEPA  RecName: Full=Leucyl-tRNA synthetase; A...   223    2e-56 
sp|Q9KTE6|SYL_VIBCH  Leucyl-tRNA synthetase (Leucine--tRNA lig...   223    2e-56 
sp|A5F2X0.2|SYL_VIBC3  RecName: Full=Leucyl-tRNA synthetase; A...   223    2e-56 
ref|YP_001216429.1|  leucyl-tRNA synthetase [Vibrio cholerae O...   223    2e-56  Gene info
ref|NP_230603.1|  leucyl-tRNA synthetase [Vibrio cholerae O1 b...   223    2e-56  Gene info
sp|A9M162.2|SYL_NEIM0  RecName: Full=Leucyl-tRNA synthetase; A...   223    2e-56 
ref|ZP_02957904.1|  leucyl-tRNA synthetase [Vibrio cholerae MZ...   223    2e-56 
ref|YP_339552.1|  leucyl-tRNA synthetase [Pseudoalteromonas ha...   222    2e-56  Gene info
ref|YP_049415.1|  leucyl-tRNA synthetase [Pectobacterium atros...   222    2e-56  Gene info
ref|YP_001783813.1|  leucyl-tRNA synthetase [Haemophilus somnu...   222    3e-56  Gene info
ref|YP_719762.1|  leucyl-tRNA synthetase [Haemophilus somnus 1...   222    3e-56  Gene info
ref|YP_002173286.1|  leucine--tRNA ligase [Mannheimia haemolyt...   222    3e-56  Gene info
ref|YP_974439.1|  leucyl-tRNA synthetase [Neisseria meningitid...   222    3e-56  Gene info
ref|ZP_01613463.1|  leucyl-tRNA synthetase [Alteromonadales ba...   222    3e-56 
ref|ZP_02478563.1|  leucyl-tRNA synthetase [Haemophilus parasu...   221    4e-56 
ref|NP_274892.1|  leucyl-tRNA synthetase [Neisseria meningitid...   221    4e-56  Gene info
ref|YP_001412557.1|  leucyl-tRNA synthetase [Parvibaculum lava...   221    5e-56  Gene info
ref|YP_001444438.1|  leucyl-tRNA synthetase [Vibrio harveyi AT...   221    5e-56  Gene info
ref|YP_001715018.1|  leucyl-tRNA synthetase [Acinetobacter bau...   221    5e-56  Gene info
ref|ZP_01290267.1|  Leucyl-tRNA synthetase bacterial/mitochond...   221    5e-56 
ref|ZP_00993107.1|  leucyl-tRNA synthetase [Vibrio splendidus ...   221    5e-56 
ref|YP_693667.1|  leucine-tRNA synthetase [Alcanivorax borkume...   221    6e-56  Gene info
sp|Q0VN53.2|SYL_ALCBS  RecName: Full=Leucyl-tRNA synthetase; A...   221    6e-56 
ref|ZP_01678340.1|  leucyl-tRNA synthetase [Vibrio cholerae 27...   221    6e-56 
ref|ZP_01287014.1|  Leucyl-tRNA synthetase bacterial/mitochond...   221    7e-56 
ref|YP_001354586.1|  leucyl-tRNA synthetase [Janthinobacterium...   220    1e-55  Gene info
ref|YP_002246977.1|  leucyl-tRNA synthetase [Coprothermobacter...   220    1e-55  Gene info
ref|YP_972859.1|  leucyl-tRNA synthetase [Acidovorax avenae su...   220    1e-55  Gene info
ref|NP_873605.1|  leucyl-tRNA synthetase [Haemophilus ducreyi ...   219    2e-55  Gene info
ref|YP_522039.1|  leucyl-tRNA synthetase [Rhodoferax ferriredu...   219    2e-55  Gene info
ref|ZP_00133841.1|  COG0495: Leucyl-tRNA synthetase [Actinobac...   219    2e-55 
ref|NP_283374.1|  leucyl-tRNA synthetase [Neisseria meningitid...   219    2e-55  Gene info
ref|YP_585115.1|  leucyl-tRNA synthetase [Ralstonia metallidur...   219    2e-55  Gene info
ref|ZP_01237399.1|  leucyl-tRNA synthetase [Vibrio angustum S1...   219    2e-55 
ref|ZP_01066858.1|  leucyl-tRNA synthetase [Vibrio sp. MED222]...   219    2e-55 
ref|NP_928614.1|  leucyl-tRNA synthetase [Photorhabdus lumines...   219    2e-55  Gene info
ref|YP_204136.1|  leucyl-tRNA synthetase [Vibrio fischeri ES11...   219    3e-55  Gene info
gb|EDX90522.1|  leucyl-tRNA synthetase [Alcanivorax sp. DG881]      219    3e-55 
sp|Q5FAJ3.2|SYL_NEIG1  RecName: Full=Leucyl-tRNA synthetase; A...   219    3e-55 
ref|YP_207190.1|  leucyl-tRNA synthetase [Neisseria gonorrhoea...   219    3e-55  Gene info
ref|YP_002000634.1|  leucyl-tRNA synthetase [Neisseria gonorrh...   219    3e-55  Gene info
ref|ZP_01447456.1|  leucyl-tRNA synthetase [alpha proteobacter...   219    3e-55 
ref|YP_984003.1|  leucyl-tRNA synthetase [Polaromonas naphthal...   219    3e-55  Gene info
ref|YP_002155515.1|  leucyl-tRNA synthetase [Vibrio fischeri M...   219    3e-55  Gene info
ref|ZP_01816392.1|  leucyl-tRNA synthetase [Vibrionales bacter...   219    3e-55 
ref|YP_454483.1|  leucyl-tRNA synthetase [Sodalis glossinidius...   218    3e-55  Gene info
ref|ZP_01161412.1|  leucyl-tRNA synthetase [Photobacterium sp....   218    4e-55 
ref|NP_841196.1|  leucyl-tRNA synthetase [Nitrosomonas europae...   218    5e-55  Gene info
ref|YP_001598485.1|  leucyl-tRNA synthetase [Neisseria meningi...   218    5e-55  Gene info
ref|ZP_01016807.1|  leucyl-tRNA synthetase [Parvularcula bermu...   218    6e-55 
ref|YP_675746.1|  leucyl-tRNA synthetase [Mesorhizobium sp. BN...   218    6e-55  Gene info
ref|ZP_01783947.1|  DNA polymerase III subunit delta [Haemophi...   218    7e-55 
ref|ZP_01792609.1|  DNA polymerase III subunit delta [Haemophi...   217    8e-55 
gb|EDX79477.1|  leucyl-tRNA synthetase [Brevundimonas sp. BAL3]     217    9e-55 
ref|ZP_00155789.2|  COG0495: Leucyl-tRNA synthetase [Haemophil...   217    1e-54 
ref|YP_001980977.1|  leucyl-tRNA synthetase [Cellvibrio japoni...   217    1e-54  Gene info
ref|ZP_01114409.1|  leucyl-tRNA synthetase [Reinekea sp. MED29...   217    1e-54 
ref|YP_002219080.1|  leucyl-tRNA synthetase [Acidithiobacillus...   216    1e-54  Gene info
ref|ZP_01797460.1|  leucyl-tRNA synthetase [Haemophilus influe...   216    1e-54 
ref|ZP_00156612.2|  COG0495: Leucyl-tRNA synthetase [Haemophil...   216    2e-54 
ref|YP_001708122.1|  leucyl-tRNA synthetase [Acinetobacter bau...   216    2e-54  Gene info
ref|YP_001341761.1|  leucyl-tRNA synthetase [Marinomonas sp. M...   216    2e-54  Gene info
ref|YP_388931.1|  leucyl-tRNA synthetase [Desulfovibrio desulf...   216    2e-54  Gene info
ref|NP_246151.1|  leucyl-tRNA synthetase [Pasteurella multocid...   216    2e-54  Gene info
ref|ZP_00943813.1|  Leucyl-tRNA synthetase [Ralstonia solanace...   216    2e-54 
ref|YP_002252016.1|  leucyl-trna synthetase (leucine--trna lig...   216    2e-54  Gene info
ref|ZP_03278909.1|  leucyl-tRNA synthetase [Thioalkalivibrio s...   216    2e-54 
ref|ZP_02006975.1|  leucyl-tRNA synthetase [Ralstonia picketti...   216    3e-54 
ref|NP_439081.1|  leucyl-tRNA synthetase [Haemophilus influenz...   216    3e-54  GeoGene info
ref|ZP_02164547.1|  leucyl-tRNA synthetase [Hoeflea phototroph...   216    3e-54 
ref|YP_248619.1|  leucyl-tRNA synthetase [Haemophilus influenz...   215    3e-54  Gene info
ref|YP_001968725.1|  leucyl-tRNA synthetase [Actinobacillus pl...   215    3e-54  Gene info
ref|YP_002150205.1|  leucyl-tRNA synthetase [Proteus mirabilis...   215    3e-54  Gene info
gb|AAQ08614.1|  Leusyl-tRNA synthetase [Agrobacterium vitis]        215    3e-54 
ref|YP_001292851.1|  leucyl-tRNA synthetase [Haemophilus influ...   215    4e-54  Gene info
ref|YP_747640.1|  leucyl-tRNA synthetase [Nitrosomonas eutroph...   214    5e-54  Gene info
ref|ZP_01788034.1|  leucyl-tRNA synthetase [Haemophilus influe...   214    5e-54 
ref|YP_001416351.1|  leucyl-tRNA synthetase [Xanthobacter auto...   214    5e-54  Gene info
ref|YP_087530.1|  leucyl-tRNA synthetase [Mannheimia succinici...   214    5e-54  Gene info
ref|ZP_01389502.1|  leucyl-tRNA synthetase [Geobacter sp. FRC-...   214    6e-54 
ref|YP_411211.1|  leucyl-tRNA synthetase [Nitrosospira multifo...   214    7e-54  Gene info
ref|ZP_01228911.1|  leucyl-tRNA synthetase [Aurantimonas sp. S...   214    7e-54 
ref|YP_001900538.1|  leucyl-tRNA synthetase [Ralstonia pickett...   214    8e-54  Gene info
ref|YP_002225736.1|  leucyl-tRNA synthetase [Salmonella enteri...   214    8e-54  Gene info
ref|YP_222465.1|  leucyl-tRNA synthetase [Brucella abortus bv....   214    8e-54  Gene info
ref|YP_001589099.1|  leucyl-tRNA synthetase [Salmonella enteri...   214    1e-53  Gene info
ref|YP_001118469.1|  leucyl-tRNA synthetase [Burkholderia viet...   214    1e-53  Gene info
ref|YP_215665.1|  leucyl-tRNA synthetase [Salmonella enterica ...   214    1e-53  Gene info
emb|CAM77239.1|  Leucyl-tRNA synthetase [Magnetospirillum gryp...   213    1e-53 
ref|ZP_01438727.1|  leucyl-tRNA synthetase [Fulvimarina pelagi...   213    1e-53 
ref|YP_415161.1|  leucyl-tRNA synthetase [Brucella melitensis ...   213    1e-53  Gene info
ref|YP_002242765.1|  leucyl-tRNA synthetase [Salmonella enteri...   213    1e-53  Gene info
ref|YP_066336.1|  leucyl-tRNA synthetase [Desulfotalea psychro...   213    1e-53  Gene info
sp|Q57RS7.2|SYL_SALCH  RecName: Full=Leucyl-tRNA synthetase; A...   213    1e-53 
gb|EDY86041.1|  leucyl-tRNA synthetase [gamma proteobacterium ...   213    1e-53 
ref|ZP_02344570.1|  leucyl-tRNA synthetase [Salmonella enteric...   213    1e-53 
ref|ZP_03221557.1|  leucyl-tRNA synthetase [Salmonella enteric...   213    1e-53 
ref|NP_455224.1|  leucyl-tRNA synthetase [Salmonella enterica ...   213    1e-53  Gene info
ref|YP_151292.1|  leucyl-tRNA synthetase [Salmonella enterica ...   213    1e-53  Gene info
ref|YP_001344050.1|  leucyl-tRNA synthetase [Actinobacillus su...   213    1e-53  Gene info
ref|ZP_02886523.1|  leucyl-tRNA synthetase [Burkholderia grami...   213    1e-53 
ref|YP_001019415.1|  leucyl-tRNA synthetase [Methylibium petro...   213    2e-53  Gene info
ref|YP_001956272.1|  leucyl-tRNA synthetase [uncultured Termit...   213    2e-53  Gene info
ref|YP_001797163.1|  leucyl-tRNA synthetase [Polynucleobacter ...   213    2e-53  Gene info
ref|NP_459640.1|  leucyl-tRNA synthetase [Salmonella typhimuri...   213    2e-53  Gene info
ref|YP_688229.1|  leucyl-tRNA synthetase [Shigella flexneri 5 ...   213    2e-53  Gene info
ref|ZP_01222070.1|  leucyl-tRNA synthetase [Photobacterium pro...   213    2e-53 
ref|YP_131030.1|  leucyl-tRNA synthetase [Photobacterium profu...   213    2e-53  Gene info
ref|YP_001580913.1|  leucyl-tRNA synthetase [Burkholderia mult...   213    2e-53  Gene info
sp|Q0T6Q2.2|SYL_SHIF8  RecName: Full=Leucyl-tRNA synthetase; A...   213    2e-53 
ref|YP_297039.2|  leucyl-tRNA synthetase [Ralstonia eutropha J...   213    2e-53  Gene info
ref|NP_539160.1|  leucyl-tRNA synthetase [Brucella melitensis ...   212    2e-53  Gene info
ref|NP_836340.1|  leucyl-tRNA synthetase [Shigella flexneri 2a...   212    2e-53  Gene info
ref|YP_001369644.1|  leucyl-tRNA synthetase [Ochrobactrum anth...   212    3e-53  Gene info
ref|YP_163170.1|  leucyl-tRNA synthetase [Zymomonas mobilis su...   212    3e-53  Gene info
gb|AAZ62195.1|  leucyl-tRNA synthetase [Ralstonia eutropha JMP...   212    3e-53  Gene info
ref|YP_001259646.1|  leucyl-tRNA synthetase [Brucella ovis ATC...   212    3e-53  Gene info
gb|AAR38078.1|  leucyl-tRNA synthetase [uncultured marine bact...   212    3e-53 
ref|YP_001155017.1|  leucyl-tRNA synthetase [Polynucleobacter ...   212    3e-53  Gene info
ref|ZP_02777681.1|  leucyl-tRNA synthetase [Escherichia coli O...   212    3e-53 
ref|YP_002262481.1|  leucyl-tRNA synthetase [Aliivibrio salmon...   212    3e-53 
ref|YP_032759.1|  leucyl-tRNA synthetase [Bartonella quintana ...   212    4e-53  Gene info
ref|YP_001717990.1|  leucyl-tRNA synthetase [Candidatus Desulf...   211    4e-53  Gene info
ref|YP_001725955.1|  leucyl-tRNA synthetase [Escherichia coli ...   211    4e-53  Gene info
ref|YP_047620.1|  leucyl-tRNA synthetase [Acinetobacter sp. AD...   211    4e-53  Gene info
ref|ZP_03066711.1|  leucyl-tRNA synthetase [Shigella dysenteri...   211    4e-53 
ref|ZP_02999363.1|  leucyl-tRNA synthetase [Escherichia coli 5...   211    5e-53 
ref|ZP_03030460.1|  leucyl-tRNA synthetase [Escherichia coli B...   211    5e-53 
gb|AAB40843.1|  leucine tRNA synthetase [Escherichia coli]          211    5e-53 
ref|NP_415175.1|  leucyl-tRNA synthetase [Escherichia coli str...   211    5e-53  Gene info
ref|YP_402257.1|  leucyl-tRNA synthetase [Shigella dysenteriae...   211    6e-53  Gene info
ref|YP_001457455.1|  leucyl-tRNA synthetase [Escherichia coli ...   211    6e-53  Gene info
emb|CAA29642.1|  unnamed protein product [Escherichia coli]         211    6e-53 
ref|NP_752663.1|  leucyl-tRNA synthetase [Escherichia coli CFT...   211    6e-53  Gene info
ref|YP_001461810.1|  leucyl-tRNA synthetase [Escherichia coli ...   211    6e-53  Gene info
ref|YP_539676.1|  leucyl-tRNA synthetase [Escherichia coli UTI...   211    6e-53  Gene info
ref|YP_407034.1|  leucyl-tRNA synthetase [Shigella boydii Sb22...   211    6e-53  Gene info
ref|YP_668599.1|  leucyl-tRNA synthetase [Escherichia coli 536...   211    6e-53  Gene info
ref|ZP_03044426.1|  leucyl-tRNA synthetase [Escherichia coli E...   211    6e-53 
ref|ZP_03035499.1|  leucyl-tRNA synthetase [Escherichia coli F...   211    7e-53 
ref|ZP_02190451.1|  Leucyl-tRNA synthetase [alpha proteobacter...   211    7e-53 
ref|NP_286368.1|  leucyl-tRNA synthetase [Escherichia coli O15...   211    7e-53  Gene info
ref|ZP_01548832.1|  leucyl-tRNA synthetase [Stappia aggregata ...   211    7e-53 
sp|Q8FJY9|SYL_ECOL6  Leucyl-tRNA synthetase (Leucine--tRNA lig...   211    7e-53 
sp|Q1RER9.2|SYL_ECOUT  RecName: Full=Leucyl-tRNA synthetase; A...   211    7e-53 
ref|ZP_03071952.1|  leucyl-tRNA synthetase [Escherichia coli 1...   211    7e-53 
ref|NP_105034.1|  leucyl-tRNA synthetase [Mesorhizobium loti M...   211    8e-53  Gene info
ref|YP_001742758.1|  leucyl-tRNA synthetase [Escherichia coli ...   211    8e-53  Gene info
ref|YP_309597.1|  leucyl-tRNA synthetase [Shigella sonnei Ss04...   211    8e-53  Gene info
ref|YP_001879348.1|  leucyl-tRNA synthetase [Shigella boydii C...   210    9e-53  Gene info
ref|ZP_01075271.1|  leucyl-tRNA synthetase [Marinomonas sp. ME...   210    1e-52 
ref|YP_001438754.1|  leucyl-tRNA synthetase [Enterobacter saka...   210    1e-52  Gene info
ref|YP_001593614.1|  leucyl-tRNA synthetase [Brucella canis AT...   210    1e-52  Gene info
ref|NP_698787.1|  leucyl-tRNA synthetase [Brucella suis 1330] ...   210    1e-52  Gene info
ref|ZP_03266383.1|  leucyl-tRNA synthetase [Burkholderia sp. H...   210    1e-52 
ref|YP_002283412.1|  leucyl-tRNA synthetase [Rhizobium legumin...   210    1e-52  Gene info
ref|ZP_01303151.1|  leucyl-tRNA synthetase [Sphingomonas sp. S...   210    1e-52 
ref|YP_772442.1|  leucyl-tRNA synthetase [Burkholderia ambifar...   210    1e-52  Gene info
ref|ZP_02848834.1|  leucyl-tRNA synthetase [Paenibacillus sp. ...   209    2e-52 
ref|YP_001334354.1|  leucyl-tRNA synthetase [Klebsiella pneumo...   209    2e-52  Gene info
ref|YP_001571289.1|  leucyl-tRNA synthetase [Salmonella enteri...   209    2e-52  Gene info
ref|YP_153747.1|  leucyl-tRNA synthetase [Anaplasma marginale ...   209    2e-52  Gene info
ref|YP_001454059.1|  leucyl-tRNA synthetase [Citrobacter koser...   209    2e-52  Gene info
ref|ZP_02902105.1|  leucyl-tRNA synthetase [Escherichia albert...   209    2e-52 
ref|YP_002239703.1|  leucyl-tRNA synthetase [Klebsiella pneumo...   209    2e-52  Gene info
ref|YP_002006607.1|  leucine tRNA synthetase [Cupriavidus taiw...   209    2e-52  Gene info
sp|A8AJG0.2|SYL_CITK8  Leucyl-tRNA synthetase (Leucine--tRNA l...   209    2e-52 
ref|NP_422543.1|  leucyl-tRNA synthetase [Caulobacter crescent...   209    2e-52  Gene info
ref|YP_344648.1|  leucyl-tRNA synthetase [Nitrosococcus oceani...   209    2e-52  Gene info
ref|YP_001610448.1|  leucyl-tRNA synthetase [Bartonella triboc...   209    2e-52  Gene info
gb|AAN87542.1|  Leucyl-tRNA synthetase [Heliobacillus mobilis]      209    2e-52 
ref|YP_001980514.1|  leucyl-tRNA synthetase protein [Rhizobium...   209    2e-52  Gene info
ref|YP_001789519.1|  leucyl-tRNA synthetase [Leptothrix cholod...   209    2e-52  Gene info
ref|YP_590404.1|  leucyl-tRNA synthetase [Acidobacteria bacter...   209    3e-52  Gene info
ref|YP_001328857.1|  leucyl-tRNA synthetase [Sinorhizobium med...   208    3e-52  Gene info
ref|YP_620058.1|  leucyl-tRNA synthetase [Burkholderia cenocep...   208    4e-52  Gene info
ref|YP_001858806.1|  leucyl-tRNA synthetase [Burkholderia phym...   208    4e-52  Gene info
ref|YP_770294.1|  leucyl-tRNA synthetase [Rhizobium leguminosa...   208    4e-52  Gene info
ref|YP_560409.1|  leucyl-tRNA synthetase [Burkholderia xenovor...   208    4e-52  Gene info
ref|YP_471586.1|  leucyl-tRNA synthetase [Rhizobium etli CFN 4...   208    5e-52  Gene info
ref|YP_001763921.1|  leucyl-tRNA synthetase [Burkholderia ceno...   208    5e-52  Gene info
ref|YP_001896995.1|  leucyl-tRNA synthetase [Burkholderia phyt...   207    6e-52  Gene info
ref|YP_002232475.1|  leucyl-tRNA synthetase [Burkholderia ceno...   207    6e-52  Gene info
ref|ZP_01103455.1|  Leucyl-tRNA synthetase [gamma proteobacter...   207    6e-52 
gb|EDZ39413.1|  Leucyl-tRNA synthetase [Leptospirillum sp. Gro...   207    8e-52 
ref|YP_001547179.1|  leucyl-tRNA synthetase [Herpetosiphon aur...   207    8e-52  Gene info
ref|YP_001756761.1|  leucyl-tRNA synthetase [Methylobacterium ...   207    1e-51  Gene info
ref|YP_001567016.1|  leucyl-tRNA synthetase [Delftia acidovora...   207    1e-51  Gene info
sp|Q1QDA4.2|SYL_PSYCK  RecName: Full=Leucyl-tRNA synthetase; A...   207    1e-51 
ref|ZP_01924508.1|  leucyl-tRNA synthetase [Victivallis vadens...   207    1e-51 
ref|YP_002099263.1|  Leucyl-tRNA synthetase [Burkholderia dolo...   207    1e-51  Gene info
ref|YP_727582.1|  leucyl-tRNA synthetase fused to ISAE1 Orf2 f...   206    1e-51  Gene info
gb|AAY82597.1|  predicted leucyl-tRNA synthetase LeuS [uncultu...   206    1e-51 
ref|YP_579833.1|  leucyl-tRNA synthetase [Psychrobacter cryoha...   206    1e-51  Gene info
ref|NP_355678.1|  leucyl-tRNA synthetase [Agrobacterium tumefa...   206    1e-51  Gene info
ref|YP_002298744.1|  leucyl-tRNA synthetase LeuS [Rhodospirill...   206    1e-51  Gene info
ref|YP_537481.1|  leucyl-tRNA synthetase [Rickettsia bellii RM...   206    2e-51  Gene info
ref|ZP_01617638.1|  leucyl-tRNA synthetase [marine gamma prote...   206    2e-51 
ref|ZP_02357015.1|  leucyl-tRNA synthetase [Burkholderia oklah...   206    2e-51 
ref|ZP_02378502.1|  leucyl-tRNA synthetase [Burkholderia ubone...   206    2e-51 
ref|ZP_02892600.1|  leucyl-tRNA synthetase [Burkholderia ambif...   206    2e-51 
ref|ZP_02291482.1|  leucyl-tRNA synthetase [Rhizobium legumino...   206    2e-51 
ref|YP_001175908.1|  leucyl-tRNA synthetase [Enterobacter sp. ...   205    3e-51  Gene info
ref|YP_001975501.1|  leucyl-tRNA synthetase [Wolbachia pipient...   205    3e-51  Gene info
ref|ZP_01520031.1|  leucyl-tRNA synthetase [Comamonas testoste...   205    3e-51 
ref|ZP_02439473.1|  hypothetical protein CLOSS21_01939 [Clostr...   205    3e-51 
ref|ZP_01552546.1|  Leucyl-tRNA synthetase [Methylophilales ba...   205    3e-51 
ref|ZP_03290924.1|  hypothetical protein CLONEX_03143 [Clostri...   205    4e-51 
ref|YP_002210175.1|  leucyl-tRNA synthetase [Oligotropha carbo...   205    4e-51  Gene info
ref|YP_445066.1|  leucyl-tRNA synthetase [Salinibacter ruber D...   205    4e-51  Gene info
ref|ZP_00055790.1|  COG0495: Leucyl-tRNA synthetase [Magnetosp...   205    4e-51 
ref|ZP_01863413.1|  leucyl-tRNA synthetase [Erythrobacter sp. ...   204    5e-51 
ref|NP_660761.1|  leucyl-tRNA synthetase [Buchnera aphidicola ...   204    5e-51  Gene info
ref|YP_528775.1|  leucyl-tRNA synthetase [Saccharophagus degra...   204    5e-51  Gene info
ref|YP_001973197.1|  putative leucyl-tRNA synthetase [Stenotro...   204    6e-51  Gene info
ref|ZP_01453284.1|  Leucyl-tRNA synthetase [Mariprofundus ferr...   204    6e-51 
ref|NP_001099171.1|  hypothetical protein LOC100126021 [Danio ...   204    6e-51  UniGene infoGene info
ref|NP_781040.1|  leucyl-tRNA synthetase [Clostridium tetani E...   204    6e-51  Gene info
ref|NP_387437.1|  leucyl-tRNA synthetase [Sinorhizobium melilo...   204    7e-51  Gene info
ref|YP_001831370.1|  leucyl-tRNA synthetase [Beijerinckia indi...   204    7e-51  Gene info
sp|Q898V2|SYL_CLOTE  Leucyl-tRNA synthetase (Leucine--tRNA lig...   204    7e-51 
ref|YP_002029294.1|  leucyl-tRNA synthetase [Stenotrophomonas ...   204    8e-51  Gene info
ref|YP_001807288.1|  leucyl-tRNA synthetase [Burkholderia ambi...   204    8e-51  Gene info
ref|ZP_03281608.1|  hypothetical protein ENTCAN_01372 [Enterob...   204    8e-51 
ref|YP_126651.1|  leucyl-tRNA synthetase [Legionella pneumophi...   204    8e-51  Gene info
ref|YP_001027213.1|  leucyl-tRNA synthetase [Burkholderia mall...   204    8e-51  Gene info
ref|YP_353921.1|  leucyl-tRNA synthetase [Rhodobacter sphaeroi...   204    8e-51  Gene info
ref|YP_001250087.1|  leucyl-tRNA synthetase [Legionella pneumo...   204    8e-51  Gene info
ref|YP_123626.1|  leucyl-tRNA synthetase [Legionella pneumophi...   204    8e-51  Gene info
ref|YP_034235.1|  leucyl-tRNA synthetase [Bartonella henselae ...   204    8e-51  Gene info
ref|YP_001044372.1|  leucyl-tRNA synthetase [Rhodobacter sphae...   204    8e-51  Gene info
ref|YP_095377.1|  leucyl-tRNA synthetase [Legionella pneumophi...   204    9e-51  Gene info
ref|YP_001396966.1|  leucyl-tRNA synthetase [Clostridium kluyv...   204    9e-51  Gene info
gb|EAY57643.1|  Leucyl-tRNA synthetase [Leptospirillum sp. Gro...   204    9e-51 
ref|YP_104000.1|  leucyl-tRNA synthetase [Burkholderia mallei ...   204    9e-51  Gene info
ref|YP_307365.1|  leucyl-tRNA synthetase [Dehalococcoides sp. ...   204    1e-50  Gene info
ref|YP_001060426.1|  leucyl-tRNA synthetase [Burkholderia pseu...   204    1e-50  Gene info
ref|ZP_01767016.1|  leucyl-tRNA synthetase [Burkholderia pseud...   204    1e-50 
ref|YP_001213628.1|  leucyl-tRNA synthetase [Dehalococcoides s...   203    1e-50  Gene info
ref|YP_109532.1|  leucyl-tRNA synthetase [Burkholderia pseudom...   203    1e-50  Gene info
gb|EDZ64156.1|  leucyl-tRNA synthetase [beta proteobacterium K...   203    1e-50 
ref|ZP_02113035.1|  leucyl-tRNA synthetase [Burkholderia pseud...   203    1e-50 
ref|ZP_02909031.1|  leucyl-tRNA synthetase [Burkholderia ambif...   203    1e-50 
ref|YP_283771.1|  leucyl-tRNA synthetase [Dechloromonas aromat...   203    1e-50  Gene info
ref|NP_299455.1|  leucyl-tRNA synthetase [Xylella fastidiosa 9...   203    1e-50  Gene info
ref|YP_758176.1|  leucyl-tRNA synthetase [Maricaulis maris MCS...   203    1e-50  Gene info
ref|ZP_01015843.1|  leucyl-tRNA synthetase [Rhodobacterales ba...   203    1e-50 
ref|ZP_02204442.1|  leucyl-tRNA synthetase [Dehalococcoides sp...   203    1e-50 
sp|Q47IN0.2|SYL_DECAR  RecName: Full=Leucyl-tRNA synthetase; A...   203    2e-50 
sp|Q9PBG8|SYL_XYLFA  Leucyl-tRNA synthetase (Leucine--tRNA lig...   203    2e-50 
ref|YP_001499328.1|  leucyl-tRNA synthetase [Rickettsia massil...   203    2e-50  Gene info
ref|YP_762228.1|  leucyl-tRNA synthetase [Hyphomonas neptunium...   203    2e-50  Gene info
ref|YP_001523483.1|  leucyl-tRNA synthetase [Azorhizobium caul...   203    2e-50  Gene info
ref|YP_001494699.1|  leucyl-tRNA synthetase [Rickettsia ricket...   203    2e-50  Gene info
ref|NP_779431.1|  leucyl-tRNA synthetase [Xylella fastidiosa T...   203    2e-50  Gene info
ref|NP_240256.1|  leucyl-tRNA synthetase [Buchnera aphidicola ...   202    2e-50  Gene info
gb|EDZ60357.1|  leucyl-tRNA synthetase [Candidatus Pelagibacte...   202    2e-50 
ref|YP_001830004.1|  leucyl-tRNA synthetase [Xylella fastidios...   202    2e-50  Gene info
ref|ZP_02062778.1|  leucyl-tRNA synthetase [Rickettsiella gryl...   202    2e-50 
ref|ZP_02612183.1|  leucyl-tRNA synthetase [Clostridium botuli...   202    2e-50 
ref|YP_001775935.1|  leucyl-tRNA synthetase [Xylella fastidios...   202    2e-50  Gene info
ref|YP_001924358.1|  leucyl-tRNA synthetase [Methylobacterium ...   202    2e-50  Gene info
ref|YP_001263343.1|  leucyl-tRNA synthetase [Sphingomonas witt...   202    2e-50  Gene info
gb|AAS73058.1|  predicted leucyl-tRNA synthetase [uncultured m...   202    2e-50 
ref|ZP_00652579.1|  Leucyl-tRNA synthetase bacterial/mitochond...   202    2e-50 
ref|YP_575459.1|  leucyl-tRNA synthetase [Nitrobacter hamburge...   202    3e-50  Gene info
ref|ZP_02373447.1|  leucyl-tRNA synthetase [Burkholderia thail...   202    3e-50 
ref|YP_367985.1|  leucyl-tRNA synthetase [Burkholderia sp. 383...   202    3e-50  Gene info
ref|ZP_01626484.1|  leucyl-tRNA synthetase [marine gamma prote...   202    3e-50 
ref|YP_001202404.1|  leucyl-tRNA synthetase [Bradyrhizobium sp...   202    3e-50  Gene info
ref|NP_643090.1|  leucyl-tRNA synthetase [Xanthomonas axonopod...   202    3e-50  Gene info
ref|YP_441758.1|  leucyl-tRNA synthetase [Burkholderia thailan...   202    4e-50  Gene info
ref|NP_884006.1|  leucyl-tRNA synthetase [Bordetella parapertu...   202    4e-50  Gene info
sp|Q2SZ91.2|SYL_BURTA  RecName: Full=Leucyl-tRNA synthetase; A...   202    4e-50 
ref|YP_530178.1|  leucyl-tRNA synthetase [Rhodopseudomonas pal...   202    4e-50  Gene info
ref|YP_827074.1|  leucyl-tRNA synthetase [Solibacter usitatus ...   202    4e-50  Gene info
ref|ZP_02387314.1|  leucyl-tRNA synthetase [Burkholderia thail...   201    4e-50 
ref|YP_988099.1|  leucyl-tRNA synthetase [Acidovorax sp. JS42]...   201    4e-50  Gene info
ref|ZP_00141979.1|  leucyl-tRNA synthetase [Rickettsia sibiric...   201    4e-50 
ref|YP_001218868.1|  leucyl-tRNA synthetase [Candidatus Vesico...   201    4e-50  Gene info
ref|NP_360222.1|  leucyl-tRNA synthetase [Rickettsia conorii s...   201    4e-50  Gene info
ref|NP_767267.1|  leucyl-tRNA synthetase [Bradyrhizobium japon...   201    5e-50  Gene info
ref|ZP_02336427.1|  leucyl-tRNA synthetase [Rickettsia africae...   201    5e-50 
ref|NP_889911.1|  leucyl-tRNA synthetase [Bordetella bronchise...   201    5e-50  Gene info
ref|ZP_00680642.1|  Leucyl-tRNA synthetase bacterial/mitochond...   201    5e-50 
ref|NP_880711.1|  leucyl-tRNA synthetase [Bordetella pertussis...   201    5e-50  Gene info
sp|Q3BRE4.2|SYL_XANC5  RecName: Full=Leucyl-tRNA synthetase; A...   201    5e-50 
emb|CAO80972.1|  leucyl-tRNA synthetase [Candidatus Cloacamona...   201    5e-50 
ref|ZP_02404463.1|  leucyl-tRNA synthetase [Burkholderia pseud...   201    8e-50 
ref|YP_180166.1|  leucyl-tRNA synthetase [Ehrlichia ruminantiu...   201    8e-50  Gene info
ref|ZP_02242624.1|  leucyl-tRNA synthetase [Xanthomonas oryzae...   201    9e-50 


>ref|YP_001484204.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9215]
 sp|A8G4T7.1|SYL_PROM2 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 gb|ABV50618.1| Gene info Leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9215]
Length=856

 GENE ID: 5615845 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9215]

 Score =  592 bits (1526),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 288/303 (95%), Positives = 297/303 (98%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKCS KPFEK EINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELF+IDEPFK
Sbjct  515  RYPSSKCSNKPFEKIEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFEIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQAAAYKNNKTGKYVSPSDI+DLSNPTDPIDN+KLEVLFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQAAAYKNNKTGKYVSPSDINDLSNPTDPIDNTKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFL+RIWKLYINCAKDINSKSNSY
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLNRIWKLYINCAKDINSKSNSY  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            PD+EKSLIKS+NIAIKEISNDILNNQFNTAISELMKFYNSL+NSIN VNN LKI+ALKTF
Sbjct  695  PDREKSLIKSMNIAIKEISNDILNNQFNTAISELMKFYNSLANSINDVNNTLKIEALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHIAEEIWHLIGFKKSVHLE+WP FNAEALKEDSYELVIQVNGKVRDKV IN
Sbjct  755  CILLAPFAPHIAEEIWHLIGFKKSVHLEYWPSFNAEALKEDSYELVIQVNGKVRDKVKIN  814

Query  301  NDM  303
            NDM
Sbjct  815  NDM  817


>ref|YP_001091194.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9301]
 sp|A3PCW8.1|SYL_PROM0 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 gb|ABO17593.1| Gene info Leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9301]
Length=856

 GENE ID: 4911693 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9301]

 Score =  592 bits (1525),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 287/303 (94%), Positives = 297/303 (98%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKC  KPFEK EINKWLPVDQYVGGVEHAILHLLYARFFTKALRDN+LF+IDEPFK
Sbjct  515  RYPSSKCPNKPFEKIEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNQLFEIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQAAAYKNNKTGKYVSPSDI+DLSNPTDPIDN+KLE+LFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQAAAYKNNKTGKYVSPSDINDLSNPTDPIDNTKLEILFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAK++N KSNSY
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKNVNIKSNSY  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            PDKEKSLIKS+NIAIKEISNDILNNQFNTAISELMKFYNSLSNSIN VNNNLKIDALKTF
Sbjct  695  PDKEKSLIKSMNIAIKEISNDILNNQFNTAISELMKFYNSLSNSINDVNNNLKIDALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHIAEEIWHLIGFKKSVHLEHWP FNAEALKEDSYELVIQVNGKVR+KVNIN
Sbjct  755  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPSFNAEALKEDSYELVIQVNGKVREKVNIN  814

Query  301  NDM  303
            +DM
Sbjct  815  HDM  817


>ref|YP_001009363.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. AS9601]
 sp|A2BR45.1|SYL_PROMS Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 gb|ABM70256.1| Gene info Leucyl-tRNA synthetase [Prochlorococcus marinus str. AS9601]
Length=856

 GENE ID: 4717682 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. AS9601]

 Score =  585 bits (1509),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 294/303 (97%), Positives = 300/303 (99%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKCSTKPFEK EINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK
Sbjct  515  RYPSSKCSTKPFEKNEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQ+AAYKNNKTGKYVSPSDI+DLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQSAAYKNNKTGKYVSPSDITDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAK+INSKSNS+
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKNINSKSNSH  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            PDKEKSLIKS+NIAIKEISNDILNNQFNTAISELMKFYNSLSNSIN +NNNLKIDALKTF
Sbjct  695  PDKEKSLIKSMNIAIKEISNDILNNQFNTAISELMKFYNSLSNSINDINNNLKIDALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHIAEEIWHLIGFKKSVHLEHWP FNAEALKEDSYELVIQVNGKVRDKVNIN
Sbjct  755  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPSFNAEALKEDSYELVIQVNGKVRDKVNIN  814

Query  301  NDM  303
            NDM
Sbjct  815  NDM  817


>ref|YP_397407.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9312]
 sp|Q31AX4.1|SYL_PROM9 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 gb|ABB49971.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9312]
Length=856

 GENE ID: 3765713 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9312]

 Score =  559 bits (1441),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 278/303 (91%), Positives = 294/303 (97%), Gaps = 0/303 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSS+CSTKPFEK EIN WLPVDQYVGGVEHAILHLLYARFFTKALRDNELF+IDEPFK
Sbjct  515  RYPSSRCSTKPFEKIEINNWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFEIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQ+AAYKNNKTGKY+SPSDI+DLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE
Sbjct  575  KLLTQGMVQSAAYKNNKTGKYISPSDINDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
            SVIKKYGADTARMFILFKAPPEKDLEWGD+DVEGQFRFLSRIWKLYI+C+KDINSKS SY
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQFRFLSRIWKLYISCSKDINSKSKSY  694

Query  181  PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF  240
            P+KEK+LIKS+NIAIKEI+NDI NNQFNTAISELMKFYNSLSN+IN VNNNLKIDALKTF
Sbjct  695  PNKEKTLIKSMNIAIKEITNDISNNQFNTAISELMKFYNSLSNNINDVNNNLKIDALKTF  754

Query  241  CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN  300
            CILLAPFAPHI+EEIW LIGFK SVHLEHWP FNAEALKEDSY LVIQVNGKVRDK+NIN
Sbjct  755  CILLAPFAPHISEEIWLLIGFKNSVHLEHWPSFNAEALKEDSYVLVIQVNGKVRDKININ  814

Query  301  NDM  303
            N+M
Sbjct  815  NEM  817


>ref|YP_001011285.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515]
 sp|A2BWL7.1|SYL_PROM5 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 gb|ABM72178.1| Gene info Leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515]
Length=864

 GENE ID: 4719204 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. MIT 9515]

 Score =  503 bits (1294),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 244/305 (80%), Positives = 271/305 (88%), Gaps = 2/305 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSKC TKPFEK  +NKWLPVDQYVGGVEHAILHLLYARF TKALRDN LFDIDEPFK
Sbjct  521  RYPSSKCKTKPFEKDNVNKWLPVDQYVGGVEHAILHLLYARFLTKALRDNNLFDIDEPFK  580

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQAAAYKN KTGKY+SP DI D +NPTDP D+SKLEVLFEKMSKSKYNGIDPE
Sbjct  581  KLLTQGMVQAAAYKNTKTGKYISPKDIKDFNNPTDPNDDSKLEVLFEKMSKSKYNGIDPE  640

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCA--KDINSKSN  178
            SVIKKYGADTARMFILFKAPPEKDLEWGD+DVEGQ+RFL RIWKL+++    +  +++ N
Sbjct  641  SVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQYRFLCRIWKLFLDYRNNESWDNQKN  700

Query  179  SYPDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALK  238
               +KE SL KSINIAIKEISNDI NNQFNTAISELMKFYNSLS+S+ YVN +L+ DA K
Sbjct  701  YNREKENSLTKSINIAIKEISNDIKNNQFNTAISELMKFYNSLSSSMIYVNKDLRKDAFK  760

Query  239  TFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVN  298
             FCILLAPFAPHIAEEIW+LIG++KSVHLE WP+FN +ALKED YELVIQ+NGKVRDK+N
Sbjct  761  KFCILLAPFAPHIAEEIWNLIGYQKSVHLERWPIFNEDALKEDCYELVIQINGKVRDKIN  820

Query  299  INNDM  303
            +  D+
Sbjct  821  VGIDI  825


>ref|NP_893007.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 sp|Q7V1I2|SYL_PROMP Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 emb|CAE19348.1| Gene info Leucyl-tRNA synthetase [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
Length=858

 GENE ID: 1726569 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus subsp. pastoris str. CCMP1986]
(10 or fewer PubMed links)

 Score =  486 bits (1252),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 234/301 (77%), Positives = 271/301 (90%), Gaps = 2/301 (0%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RYPSSK  TKPFEK +INKWLPVDQYVGGVEHAILHLLYARF TKALRDN LFDIDEPFK
Sbjct  515  RYPSSKSLTKPFEKEKINKWLPVDQYVGGVEHAILHLLYARFLTKALRDNNLFDIDEPFK  574

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            +LLTQGMVQ+AAYKN+ TGKY+SP+DI D++NP DP DNSKLEVLFEKMSKSKYNGIDPE
Sbjct  575  RLLTQGMVQSAAYKNSITGKYISPTDIKDITNPKDPKDNSKLEVLFEKMSKSKYNGIDPE  634

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCA-KDINSKSNS  179
            SVIKKYGADTARMFILFKAPPEKDLEWGD+DVEGQ+RFL RIWKL+++ +  DI  +++ 
Sbjct  635  SVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQYRFLCRIWKLFLDYSNNDITHEADK  694

Query  180  Y-PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALK  238
               + E SL+KSINIAIKEISNDI NNQFNTAISELMKFYNS+S+++NYVN +L+ ++L 
Sbjct  695  LKKENESSLLKSINIAIKEISNDIKNNQFNTAISELMKFYNSISSNLNYVNKDLRRESLM  754

Query  239  TFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVN  298
             FCILLAPFAPHI++EIWHLIG  KSVHLE WP+F+ +ALKE+S+ELVIQ+NGKVRDK+N
Sbjct  755  KFCILLAPFAPHISDEIWHLIGNSKSVHLEKWPVFDEDALKENSFELVIQINGKVRDKIN  814

Query  299  I  299
            +
Sbjct  815  V  815


>ref|YP_291516.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. NATL2A]
 sp|Q46L15.1|SYL_PROMT Gene info RecName: Full=Leucyl-tRNA synthetase; AltName: Full=Leucine--tRNA 
ligase; Short=LeuRS
 gb|AAZ57813.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. NATL2A]
Length=862

 GENE ID: 3605694 PMN2A_0321 | leucyl-tRNA synthetase
[Prochlorococcus marinus str. NATL2A]

 Score =  363 bits (933),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 226/307 (73%), Gaps = 4/307 (1%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RY +     KPF K+EI+KWLPV QYVGG+EHAILHLLY+RF TKAL+   L +IDEPFK
Sbjct  517  RYINPDNCEKPFLKSEIDKWLPVKQYVGGIEHAILHLLYSRFLTKALKKCGLINIDEPFK  576

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQA  +KN  T KY S   I D+ NP DP+    +E+++EKMSKSKYNG+DP 
Sbjct  577  KLLTQGMVQAVTFKNPNTNKYFSKDQIKDIDNPKDPLTGENIEIIYEKMSKSKYNGVDPS  636

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
             VI KYGADTARMFILFKAPPEKDLEW D+DVEGQ+RF+ R+WK  IN  K  N+ S S 
Sbjct  637  VVIDKYGADTARMFILFKAPPEKDLEWDDSDVEGQYRFIQRLWKFVINTFKLTNNNSRSN  696

Query  181  PDKEKS----LIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDA  236
             +KEKS     ++ INIAIKEI++D+ N QFNTAISELMK  N LS  +NY +N      
Sbjct  697  IEKEKSKDEEALRLINIAIKEITDDLDNLQFNTAISELMKVVNGLSLIVNYCSNETLNKV  756

Query  237  LKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDK  296
            +     + +PF+PHIAEE+W  IG  +S+HL+ WP F+A A+++D+++L+IQ+NGKVR  
Sbjct  757  ISILVKITSPFSPHIAEELWKTIGNTQSIHLQSWPEFDAGAIEQDTFKLMIQINGKVRGS  816

Query  297  VNINNDM  303
            +N + ++
Sbjct  817  INASKNL  823


>ref|YP_001014817.1| Gene info leucyl-tRNA synthetase [Prochlorococcus marinus str. NATL1A]
 sp|A2C242.1|SYL_PROM1 Gene info Leucyl-tRNA synthetase (Leucine--tRNA ligase) (LeuRS)
 gb|ABM75552.1| Gene info Leucyl-tRNA synthetase [Prochlorococcus marinus str. NATL1A]
Length=862

 GENE ID: 4780516 leuS | leucyl-tRNA synthetase
[Prochlorococcus marinus str. NATL1A]

 Score =  363 bits (932),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 226/307 (73%), Gaps = 4/307 (1%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            RY +     KPF K+EI+KWLPV QYVGG+EHAILHLLY+RF TKAL+   L +IDEPFK
Sbjct  517  RYINPDNCEKPFLKSEIDKWLPVKQYVGGIEHAILHLLYSRFLTKALKRCGLINIDEPFK  576

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            KLLTQGMVQA  +KN  T KY S   I D+ NP DP+    +E+++EKMSKSKYNG+DP 
Sbjct  577  KLLTQGMVQAVTFKNPNTNKYFSKDQIKDIDNPKDPLTGENIEIIYEKMSKSKYNGVDPS  636

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY  180
             VI KYGADTARMFILFKAPPEKDLEW D+DVEGQ+RF+ R+WK  IN  K  N+ S S 
Sbjct  637  VVIDKYGADTARMFILFKAPPEKDLEWDDSDVEGQYRFIQRLWKFVINTFKLTNNNSRSN  696

Query  181  PDKEKS----LIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDA  236
             +KEKS     ++ INIAIKEI++D+ N QFNTAISELMK  N LS  +NY +N      
Sbjct  697  IEKEKSKDEEALRLINIAIKEITDDLDNLQFNTAISELMKVVNGLSLIVNYCSNETLNKV  756

Query  237  LKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDK  296
            +     + +PF+PHIAEE+W  IG  +S+HL+ WP F+A A+++D+++L+IQ+NGKVR  
Sbjct  757  ISILVKITSPFSPHIAEELWKTIGNTQSIHLQSWPEFDAGAIEQDTFKLMIQINGKVRGS  816

Query  297  VNINNDM  303
            +N + ++
Sbjct  817  INASKNL  823


>ref|ZP_01124067.1|  t-RNA synthetase, class Ia:Leucyl-tRNA synthetase [Synechococcus 
sp. WH 7805]
 gb|EAR18702.1|  t-RNA synthetase, class Ia:Leucyl-tRNA synthetase [Synechococcus 
sp. WH 7805]
Length=878

 Score =  359 bits (921),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/304 (54%), Positives = 220/304 (72%), Gaps = 11/304 (3%)

Query  10   KPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFKKLLTQGMVQ  69
            +PF+   + +WLPV QYVGG+EHAILHLLY+RFFTKALRD  L +I EPF++LLTQGMVQ
Sbjct  534  RPFDPDAVERWLPVQQYVGGIEHAILHLLYSRFFTKALRDRGLLNIREPFERLLTQGMVQ  593

Query  70   AAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPESVIKKYGAD  129
               Y+N +TG+YV+PS++SD S P DP+D   LEVLFEKMSKSKYNG+DP +VI +YGAD
Sbjct  594  GVTYRNPRTGRYVAPSEVSDESAPKDPLDGGDLEVLFEKMSKSKYNGVDPAAVIDRYGAD  653

Query  130  TARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSYP--------  181
            TARMFILFKAPPEKDLEW D DVEGQFRFL R+W+L  +   D   +  S P        
Sbjct  654  TARMFILFKAPPEKDLEWDDADVEGQFRFLQRLWRLIESVRSDHQDQLLSEPTVVPEGSV  713

Query  182  --DKEKSLIKSINIAIKEISNDILNN-QFNTAISELMKFYNSLSNSINYVNNNLKIDALK  238
              ++E  + ++++ AI+ +S+D+    QFNTAISELMK  N+LS S+   + +++ +A+ 
Sbjct  714  LSEQESGIRRAVHTAIEAVSDDLRGEYQFNTAISELMKLSNALSGSLAEASRSVQAEAIS  773

Query  239  TFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVN  298
                LLAPFAPH+AEE W  +G + SVH + WP+ +  AL+ D+ +LVIQV GKVR  ++
Sbjct  774  ALIRLLAPFAPHLAEEFWFSLGGQGSVHNQPWPVHDPAALRRDTVDLVIQVKGKVRGSIS  833

Query  299  INND  302
            +  D
Sbjct  834  VPAD  837


>ref|ZP_01472104.1|  t-RNA synthetase, class Ia:Leucyl-tRNA synthetase [Synechococcus 
sp. RS9916]
 gb|EAU73818.1|  t-RNA synthetase, class Ia:Leucyl-tRNA synthetase [Synechococcus 
sp. RS9916]
Length=882

 Score =  357 bits (915),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 219/314 (69%), Gaps = 12/314 (3%)

Query  1    RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK  60
            R+     +  PF    I +WLPV QYVGG+EHAILHLLYARFFTKALRD  L  IDEPF+
Sbjct  529  RFADPGNTDAPFTPEAIARWLPVKQYVGGIEHAILHLLYARFFTKALRDRGLLTIDEPFE  588

Query  61   KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE  120
            +LLTQGMVQA  Y+N +TG+YV+P  +SD  +P DP D  +LEVLFEKMSKSKYNG+DP 
Sbjct  589  RLLTQGMVQAVTYRNPRTGRYVAPDRVSDEGDPRDPDDGGELEVLFEKMSKSKYNGVDPA  648

Query  121  SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINS-----  175
            +VI +YGADTARMFILFKAPPEKDLEW D DVEGQFRFL R+W+L  + A + +      
Sbjct  649  AVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFLQRLWRLVESAATNADQPVCLS  708

Query  176  --KSNSYP----DKEKSLIKSINIAIKEISNDILNN-QFNTAISELMKFYNSLSNSINYV  228
               + + P    + E+ + ++++ AI EI  D+  + QFNTAISELMK  N+LS ++  V
Sbjct  709  GDGALTLPAELSEAEQEVRRAVHTAIAEIGEDLSGDFQFNTAISELMKLSNALSGALETV  768

Query  229  NNNLKIDALKTFCILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQ  288
               ++ +AL     LLAPFAPH+AEE WH +   +SVH + WP+ +  AL +D+ ELVIQ
Sbjct  769  TPAVRQEALSVLIRLLAPFAPHLAEEFWHRLKGSQSVHQQPWPIHDPAALVKDTIELVIQ  828

Query  289  VNGKVRDKVNINND  302
            V GKVR  + +  D
Sbjct  829  VKGKVRGSLQVPAD  842



ORF finding

PROTOCOLE:

a)SMS,paramètres: any codon,reading frames 1,2,3 on the direct strand,at least 60 codons long,bacterial code.

b)SMS,paramètres: any codon,reading frames 1,2,3 on the reverse strand,at least 60 codons long,bacterial code.

---------------------------------------------------------------------------------------------------

ANALYSE DES RÉSULTATS:

a)Le plus grand ORF trouvé sur le brin direct fait 278 nucléotides,il est situé dans le cadre de lecure 2.
On ne peut pas conclure pour l'instant.

b)Sur le brin indirect,le plus grand ORF fait 908 nucléotides,soit pratiquement toute notre séquence.
Il est situé dans le cadre de lecture n°2.Cet ORF est incomplet en 5' et 3': il ne débute pas par un codon start et ne
se termine pas non plus par un codon stop. Le fait qu'il commence au niveau du nucléotide 2 suggère qu'il est bien 
incomplet en 5'.

Cet ORF est beaucoup plus pertinent que celui trouvé précedemment.Sa taille (908 nucléotides soit 303 acides aminés)
nous laisse supposer que nous sommes en présence d'une séquence codante.

-------------------------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a)No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 416 to base 694.
AGCTTCCAAATCCTGCTTAAAAATCTAAATTGTCCTTCAACATCTGTATCTCCCCATTCC
AAATCTTTTTCTGGTGGTGCTTTAAATAATATAAACATTCTTGCTGTATCTGCTCCATAT
TTTTTAATTACTGATTCAGGGTCTATTCCATTGTATTTAGACTTAGACATCTTCTCGAAA
AGAACTTCGAGTTTAGAATTGTCAATTGGATCTGTAGGATTTGATAAATCAGAAATATCG
GAAGGAGAAACATATTTACCAGTTTTATTGTTTTTATAG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
SFQILLKNLNCPSTSVSPHSKSFSGGALNNINILAVSAPYFLITDSGSIPLYLDLDIFSK
RTSSLELSIGSVGFDKSEISEGETYLPVLLFL*

No ORFs were found in reading frame 3.

-----------------------------------

b)No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 910.
AGATACCCATCTTCAAAATGTTCAACTAAGCCATTTGAAAAGACTGAAATTAATAAGTGG
TTGCCAGTTGATCAATATGTTGGAGGAGTAGAGCATGCAATATTGCATTTGTTATATGCA
AGATTTTTCACTAAAGCATTGCGGGATAATGAACTATTTGATATCGATGAACCTTTCAAA
AAACTATTAACGCAAGGAATGGTTCAGGCCGCAGCCTATAAAAACAATAAAACTGGTAAA
TATGTTTCTCCTTCCGATATTTCTGATTTATCAAATCCTACAGATCCAATTGACAATTCT
AAACTCGAAGTTCTTTTCGAGAAGATGTCTAAGTCTAAATACAATGGAATAGACCCTGAA
TCAGTAATTAAAAAATATGGAGCAGATACAGCAAGAATGTTTATATTATTTAAAGCACCA
CCAGAAAAAGATTTGGAATGGGGAGATACAGATGTTGAAGGACAATTTAGATTTTTAAGC
AGGATTTGGAAGCTTTATATAAATTGTGCAAAAGATATAAATAGTAAATCTAATTCCTAT
CCAGATAAAGAAAAAAGTTTAATAAAGTCAATTAATATCGCTATAAAAGAAATTTCAAAT
GACATATTAAATAACCAATTTAATACTGCGATTTCAGAACTAATGAAGTTTTATAATTCC
TTATCAAATTCCATTAATTACGTAAACAATAATTTAAAAATTGATGCTTTAAAAACATTT
TGTATTTTGTTGGCTCCATTTGCTCCTCATATTGCAGAAGAAATATGGCATCTTATAGGA
TTTAAAAAATCTGTGCATTTAGAACACTGGCCTTTATTTAATGCCGAGGCACTAAAAGAA
GATTCATATGAACTAGTAATACAGGTGAATGGAAAAGTTAGAGACAAAGTTAATATTAAT
AATGATATG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
RYPSSKCSTKPFEKTEINKWLPVDQYVGGVEHAILHLLYARFFTKALRDNELFDIDEPFK
KLLTQGMVQAAAYKNNKTGKYVSPSDISDLSNPTDPIDNSKLEVLFEKMSKSKYNGIDPE
SVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFLSRIWKLYINCAKDINSKSNSY
PDKEKSLIKSINIAIKEISNDILNNQFNTAISELMKFYNSLSNSINYVNNNLKIDALKTF
CILLAPFAPHIAEEIWHLIGFKKSVHLEHWPLFNAEALKEDSYELVIQVNGKVRDKVNIN
NDM

No ORFs were found in reading frame 3.


---------------------------------------------------------------------------------------------------




Personal tools