GOS 677020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120682266
Annotathon code: GOS_677020
Sample :
  • GPS :41°29'9n; 71°21'4w
  • North American East Coast: Newport Harbor, RI - USA
  • Coastal (-1m, 9.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : bigmac
Annotated on : 2009-02-04 21:56:41
  • FLORENCE Margaux
  • PONS Thomas

Synopsis

  • Gene symbol: fba
  • Taxonomy: Bacteria (NCBI info)
    Rank: superkingdom - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 2
    Kingdom: Bacteria - Phylum: - Class: - Order:
    Bacteria;

Genomic Sequence

>JCVI_READ_1091120682266 GOS_677020 genomic DNA
TGGAGGTGCGATTTTCAACGCAGGAAAAACCCTTTCGAATGAAAACCAACAAGCCGCCATTGCCGGTGCTATTGCCGGTGCCAAACACATCCACGAATTG
GCTACATTATACGGAGCAACCGTTATTCTTCATACCGATCATTGCGCAAAAAAATTATTGCCTTGGATTGACGGTTTATTGACCGCCAGCGAAGCCTTTT
ATGCAGAACACGGAAAATCTTTGTTCAGTTCGCACATGATTGATCTATCCGAGGAACCCATTGAAGAAAATATCGAGATTTGCAAAACCTATCTTGAACG
CATGAAGAAAATGGACATGACCCTCGAAATTGAATTGGGAATCACTGGTGGTGAAGAAGACGGAGTGGACAACAGCGATGTGGATGCCTCCAAACTCTAC
ACCCAACCCGAGGAAGTGGCCTATGCCTATGAAGAGCTAAGCAAAATAAGCGATCAATTTACCATTGCCGCCGCCTTTGGAAATGTACATGGGGTTTACA
AGCCTGGGAATGTTAAATTGACGCCCAAGATTTTAAGAAACTCTCAAACGCATATCTCAGAGAAATACAACTTGCCCGAAAATACGGTTGACTTTGTATT
TCATGGAGGTTCCGGATCTACGCAAGAAGAAATTCAAGAAGCGATTGGATATGGCGTTATTAAAATGAACATTGATACCGACCTTCAATTTGCTTTTACT
GAAGGAATACGTGACTATATGACGGATCATATCGAGTATTTGAGAAATCAAATTGGAAACCCAGAAGGTGCCGATCAACCCAATAAAAAATATTACGACC
CAAGAAAATGGTTGCGCTTGGGAGAAGAA

Translation

[2 - 829/829]   direct strand
>GOS_677020 Translation [2-829   direct strand]
GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLLTASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLER
MKKMDMTLEIELGITGGEEDGVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRNSQTHISEKYNLPENTVDFVF
HGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYMTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

PROTOCOLE:

NEIGHBOR
INFOBIOGEN SOUS FORMAT PHYLIP (OBTENU AVEC ALLIGNEMENT DES SEQUENCE )GROUPE EXTERIEUR
GIBBERELLAZEAE TRAITEMENT [PROTDIST]

PARSIMONY
INFOBIOGEN SOUS FORMAT PHYLIP (OBTENU AVEC ALLIGNEMENT DES SEQUENCE )GROUPE EXTERIEUR
GIBBERELLAZEAE TRAITEMENT PROTPARS
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:
a)NEIGHBOR

Apres avoir obtenu un arbre par INFIOBIOGEN(avec comme groupe exterieur:Gzeae), nous nous sommes apreçus que 
notre arbre contenait deux sous arbres. On a par la suite reraciner notre arbre sur un des deux sous groupes.
 
Cet arbre reflete une histoire evolutive complexe . 
On obtient un arbre qui se divise en deux sous arbres ayant chacun une grande variété de bacteries.
Le premier sous arbre contient des sequences ayant des scores faibles. Il contient par exemple une CFB: Bcapillosus
qui possede un score faible contrairement aux autres CFB qui sont elles presentent dans le deuxieme sous arbre. Cet 
eloigenemt entre les sequence des CFB peut resulter d'une perte de genes de la part de Bcapillosus, ce qui a engendrer
à son eloigenement des autres CFB presentes. 
Pour le cas des Monocercomonoides, cette sequence fait partie du groupe exterieur mais ne se trouve pas avec les autres
sequences de ce groupe. Cela peut laisser penser à un transfert horizontal entre un genome bacterien et eucaryote.  
 
On retouve notre sequence dans le deuxieme sous arbre associé à "Catlanticus"(CFB). Cette association nous laisse penser que 
que notre sequence appartient au groupe phylogenetique des bacteries.
On observe que le deuxieme sous arbre contient notre echantillon ainsi que notre groupe exterieur: les eucaryotes.
Cela reflete un certain lien entre notre sequence, les procaryotes et les eucaryotes.

a) et b): Les deux arbres viennent appuyer l'hypothèse émise selon laquelle le groupe phylogénétique de notre
échantillon appartient aux bactéries. On ne peut cependant pas preciser un sous groupe particulier. 
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a)NEIGHBOR 

                                                                                                 +---Pphaeoclathratiforme [green sulfur bacteria]  
                                                                               +----------------+
                                                                               |                +-----Ctepidum            [green sulfur bacteria]
                                                                   +-----------+
                                                                   |           +-----------Bcapillosus                    [CFB group bacteria]
                                                       +-----------+
                                                       |           |    +----------------------Monocercomonoides          [eukaryotes]     
                                                       |           |    |
                                          +------------+           +----+
                                          |            |                +-------------------------Rpickettii              [b-proteobacteria]
                                          |            |
                                          |            +-------------------------------------------------Cdifficile       [firmicutes]
 +----------------------------------------+
 |                                        |                     +-------------Scitri                                      [mycoplasmas]
 |                                        |      +--------------+
 |                                        |      |              +--------------------Alaidlawii                           [mycoplasmas]
 |                                        +------+
 |                                               +---------------Agonensis                                                [firmicutes] 
 |
 |                                                      +---Catlanticus                                                   [CFB group bacteria]
 |                                                    +-+
 |                                                    | +--------GOS_677020
 |                                                    |
 |                                                    | 
 |                                                    |+---Fbacterium                                                     [CFB group bacteria]
 +----------------------------------------------------+|
                                                      ||         +------------------Cjejuni                               [e-proteobacteria]
                                                      ||         |
                                                      ||         |      +----Pluminescens                                 [enterobacteria]
                                                      ++        ++      | 
                                                       |        ||    +-+                    +-Bvalaisiana                [spirochetes]
                                                       |        ||    | +--------------------+
                                                       |        |+----+                      +Bspielmanii                 [spirochetes]
                                                       |        |     |
                                                       +--------+     +------Methylomonas                                 [g-proteobacteria] 
                                                                |
                                                                | 
                                                                |      +--------------Kmicrum                             [dinoflagellates] 
                                                                |      |
                                                                +------+                     +-----------Gzeae            [ascomycetes]
                                                                       |            +--------+
                                                                       +------------+        +---Pbrasiliensis            [ascomycetes]
                                                                                    |
                                                                                    +-----------Cneoformans               [basidiomycetes]

________________________________________________________________________________________________=

b)PARSIMONY


Protein parsimony algorithm, version 3.6a2.1



One most parsimonious tree found:




                                                           +--Cjejuni[e-proteobacteria]  
           +-----------------------------------------------9  
           !                                               +--Kmicrum[dinoflagellates] 
           !  
           !                                               +--Bspielmanii[spirochetes]
           !     +----------------------------------------11  
        +--8     !                                         +--Bvalaisiana[spirochetes]
        !  !     !  
        !  !     !                                         +--Methylomonas[g-proteobacteria] 
        !  !     !     +-----------------------------------7  
        !  !     !     !                                   +--Pluminescens[enterobacteria]
        !  !     !     !  
        !  +----10     !                       +--------------Cdifficile[firmicutes]
        !        !     !                       !  
        !        !     !                       !        +-----Bcapillosus[CFB group bacteria]
        !        !     !              +-------20  +----19  
        !        !     !              !        !  !     !  +--Ctepidum[green sulfur bacteria] 
        !        !     !              !        !  !     +-18  
        !        !     !              !        +-17        +--Pphaeoclathratiforme[green sulfur bacteria]
        !        +-----6              !           !  
        !              !           +-15           !        +--Monocercomonoides[eukaryotes]
     +--3              !           !  !           +-------16  
     !  !              !           !  !                    +--Rpickettii[b-proteobacteria]
     !  !              !           !  !  
     !  !              !           !  !                 +-----Agonensis[firmicutes] 
     !  !              !     +----12  +----------------14  
     !  !              !     !     !                    !  +--Alaidlawii[mycoplasmas]
     !  !              !     !     !                    +-13  
     !  !              !     !     !                       +--Scitri[mycoplasmas]     
  +--2  !              +-----5     !  
  !  !  !                    !     +--------------------------GOS_677020
  !  !  !                    !  
  !  !  !                    !                             +--Fbacterium[CFB group bacteria]
  !  !  !                    +-----------------------------4  
  1  !  !                                                  +--Catlanticus[CFB group bacteria]
  !  !  !  
  !  !  +-----------------------------------------------------Cneoformans[basidiomycetes]
  !  !  
  !  +--------------------------------------------------------Pbrasiliensis[ascomycetes]
  !  
  +-----------------------------------------------------------Gzeae[ascomycetes]    

Annotator commentaries

Grâce à la recherche orf finder, nous obtenons un orf de la taille de notre échantillon (829pb): c'est l'orf numéro 1 dans le deuxième cadre de lecture du sens direct. Cet orf semble être codant et tronqué en 5' et en 3'. En effet, après avoir analysé les résultats de l'alignment multiple, on constate qu'il manque une soixantaine d'acides aminés en 5'. Le poids moléculaire de l'orf ne peut pas être calculé car il est incomplet.

Lors de la recherche de domaines protéiques, on en observe deux types:une Fructose-bisphosphate aldolase et une Ketose-bisphosphate aldolase. Grâce aux fiches interpro, on se rend conpte que la Fructose-bisphosphate aldolase est un descendant de la Ketose-bisphosphate aldolase, ce qui nous a permis de sélectionner la Ketose-bisphosphate aldolase comme domaine protéique conservé.Le processus biologique obtenu est : GO:0006096 glycolysis.On associe ce processus à:GO:OOO6091.

Le blast contre nr nous a permis d'émettre une hypothèse comme quoi notre échantillon appartient au groupe des bactéries; hypothèse par la suite confirmée grâce à l'analyse de l'arbre phylogénétique. Tous les homologues obtenus grâce au blast contre swissprot se révèlent être des aldolases. Ces résultats confirment le choix du domaine protéique conservé: Ketose-bisphosphate aldolase.

Le rapport taxonomique nous permet de constater que toutes les séquences ayant un score important ont une fonction aldolase; ce qui vient encore une fois, appuyer le choix du domaine protéique conservé. De plus, cela nous permet de sélectionner le groupe d'étude ainsi que le groupe extérieur: notre groupe d'étude choisi est celui des bactéries. En effet, tous les groupes phylogénétiques de bactéries sont représentés avec des scores importants. En vue de la sélection de ce groupe d'étude, nous allons prendre comme groupe extérieur les eucaryotes, également présents dans le rapport taxonomique avec des scores importants.

L'alignement multiple vient confirmer le fait que notre échantillon est tronqué en 5'et en 3'; que notre methionine se trouve avant notncbire orf et non pas dessus et qu'il manque environ soixance acides aminés en 5'. De plus, cela confirme que notre échantillon est bien une aldolase.

L'arbre phylogénétique obtenu par neighbor, montre un chemin évolutif complexe. Il ne nous permet pas de déterminer un sous-groupe phylogénétique exact pour notre échantillon, il nous permet juste d'avancer qu'il appartient au groupe des bactéries. Il met egalement en evidence un lien entre notre echantillon et les eucaryotes. Ce lien ne peut pas vraiment etre defini.En effet nous avons emis deux hypotheses (cf rapport taxonomique) que nous avons ensuite refutées.

Suite à cette étude, nous pouvons conclure que notre échantillon possède une fonction de Ketose-bisphosphate aldolase et qu'il appartient au groupe des bactéries. La Ketose-bisphosphate aldolase est un enzyme homodimerique qui joue un rôle dans le cycle du glucose.Il permet le passage du fructose-1,6-bisphosphate en dihydroxyacetone-phosphate et glyceraldehyde 3-phosphate, il est donc un enzyme majeur dans la transformation du glucose en pyruvate. Il necessite la fixation d'un ion de zinc pour son activité. De plus il est principalement retrouvé chez les procaryotes.

Multiple Alignement

PROTOCOLE:
EBI clustal w puis nous avans refait un alignement au format phylip pour pouvoir faire l'arbre avec
infobiogen
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Tout d'abord, nous pouvons constater que notre séquence est tronquée en 5' et en 3', car les séquences
qui lui sont homologues (Flavobacteriales bacterium , Croceibacter atlanticus...)commencent avant 
elle en 5' et finissent après elle en 3'.
De plus, on constate qu'il y a de fortes homologies entre toutes les séquences.
A la position 55 et 58 de note sequence on observe deux histidines concervées avec toutes les autres s
sequences. Ces deux histidines correspondent au site de fixation du zinc permettant l'activité 
aldolase de l'enzyme comme decrite sur la fiche interpro. 


---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:
CLUSTAL 2.0.10 multiple sequence alignment


Gzeae                     ------------------------------------------------------------
Pbrasiliensis             ------------------------------------------------------------
Cneoformans               ------------------------------------------------------------
Catlanticus               ------------------------------------------------------------
Fbacterium                ------------------------------------------------------------
GOS_677020                ------------------------------------------------------------
Pluminescens              ------------------------------------------------------------
Methylomonas              ------------------------------------------------------------
Kmicrum                   MTMRSVAFVLACLRLALAAEEDHTTPFSQLLLSLQPAAAVRSPIARHGHGLATSNLRITN 60
Cjejuni                   ------------------------------------------------------------
Bvalaisiana               ------------------------------------------------------------
Bspielmanii               ------------------------------------------------------------
Scitri                    ------------------------------------------------------------
Alaidlawii                ------------------------------------------------------------
Agonensis                 ------------------------------------------------------------
Rpickettii                ------------------------------------------------------------
Monocercomonoides         ------------------------------------------------------------
Pphaeoclathratiforme      ------------------------------------------------------------
Ctepidum                  ------------------------------------------------------------
Bcapillosus               ------------------------------------------------------------
Cdifficile                ------------------------------------------------------------
                                                                                      

Gzeae                     -----------------------MGVQEVLSRKSGVIVGDDVLRLFEYAREHKFAIPAIN 37
Pbrasiliensis             -----------------------MGVKDILSRKTGVIVGDDVLRLFQHAQEKVFAIPAIN 37
Cneoformans               ----------------------MSGALSVVP--AGVVTGDNVRKLFKYAKDNKFAIPAIN 36
Catlanticus               -------------------------MSHTIK--PGVATGKEVQDIFNHAKKHGYALPAVN 33
Fbacterium                -------------------------MSHNIK--PGVATGREVQDIFKLAKEKGFALPAVN 33
GOS_677020                ------------------------------------------------------------
Pluminescens              ----------------------MSKIFDFVK--PGVITGDDVQKVFAIAKENSFALPAVN 36
Methylomonas              ----------------------MTKILDVVK--PGVVTGEDVQKIFAICKENNFALPAVN 36
Kmicrum                   QDSLRSIRQTCRMMAVETATKAFTKLPASVK--PGVVTGPALADLLNYAKENKFAMPGPN 118
Cjejuni                   -----------------------MGVLDIVK--AGVISGDELNKIYDYAKAEGFAIPAVN 35
Bvalaisiana               -----------------------MGVLDKIK--PGVVYGKELHSLYEICKKEGFAIPSIN 35
Bspielmanii               -----------------------MGVLDKIK--PGVVYGKELHSLYEICKKEGFAIPSIN 35
Scitri                    ------------------------------MGQKYHARLVNASELIKKAHQNKYAVGHFN 30
Alaidlawii                -------------------------------------MLVSAKEMLQKAKAEGYAVAQIN 23
Agonensis                 ------------------------------------MPLVSMTEMLKQALAGKYAVGQFN 24
Rpickettii                ------------------------------------MPLVSMRQLLDHAAENGYGLPAFN 24
Monocercomonoides         --------------------------------------LCTLKQALEEARKGHYALGAFN 22
Pphaeoclathratiforme      --------------------------MEKNKISYKELGLCNSRELFSKAVTGGYAIPAYN 34
Ctepidum                  ---------------------------MKKITGYKELGLVNSRELFAKAISGGYAIPAYN 33
Bcapillosus               ---------------------------------MFPMALVTSTEMFKKAYAGGYAIGAFN 27
Cdifficile                ------------------------------------MALVTTTSMLKKAQDGGYAVGAFN 24
                                                                                      

Gzeae                     VTSSSTVVAALEAARDAKAPVILQFSQGGAAYFAGKGVSNGDQA-ASIAGSVAAAHYVRS 96
Pbrasiliensis             VTSSSTVVAALEAARDKNSPIILQVSQGGAAFFAGKGVPNGKQE-ASVAGAIAAAHYIRS 96
Cneoformans               VTSSSVVNAVLEAARDINSPIILQVSQGGAAFFAGKGLKNGNQE-ASIAGAVAAAHFIRS 95
Catlanticus               VVGSSTVNAVMETAAELNSPVIIQFSNGGGQFNAGKGLSNENEK-AAIAGCVAGAKHVHE 92
Fbacterium                VIGSNSINGVLETAKALNAPVIIQFSNGGAQFNAGKGLGNDNQK-GAIAGSVAGAKHVHQ 92
GOS_677020                ---------------------------GGAIFNAGKTLSNENQQ-AAIAGAIAGAKHIHE 32
Pluminescens              CVGTDSINAVLEAAAKVRSPVIIQFSNGGAAFIAGKGLKAEGQQ-TAILGSISGAHHVHQ 95
Methylomonas              VISTDTINAVLEAAAKAKSPVVIQFSNGGAAFVAGKGLKLEGQG-CSIHGAISGAHHVHR 95
Kmicrum                   IVGTNSINACMEAAKKYGGPIIITFSKGGGQFIAGKGADNEDDA-ASINGAIAGALHVRQ 177
Cjejuni                   VVGTDSINAVLEAAKKVNSPVIIQFSNGGAKFYAGKNCPNGE-----VLGAISGAKHVHL 90
Bvalaisiana               CIGTNSINAVLEAAKEINSPIMIQFSNSGSAFICGKGLKMEKPQGVSIAGAISGAMHVHL 95
Bspielmanii               CIGTNSINAVLEAAKEINSPIMIQFSNSGSAFICGKGLKMEKPQGVSIVGAISGAMHVHL 95
Scitri                    INNLEWTKALLEAAQATKTPIILGASEGAIKYMGG----------YNLVVAMVNALLDSL 80
Alaidlawii                INNLEWIKAVLSTVEELKSPVILGVSEGAAKYMGG----------YENVMAMVSTLDKAM 73
Agonensis                 INNLEWTQAILAAAEEEKSPVILGVSEGAARYMGG----------FKTVVNMVKGLMEDM 74
Rpickettii                VNNLEQVQAVMEAAKEAGAPVILQASAGARKYAG-----------ESFIKHLIQAAVEAY 73
Monocercomonoides         VNNMEQIQGIIAAAAETKSPVIIQASRGALKYTE-----------LNYLKHMILAAVELH 71
Pphaeoclathratiforme      FNNLEQMQAIILACAETKSPVILQVSKGARSYAN-----------ETLLRYLAQGAVAYA 83
Ctepidum                  FNNLEQLQAIIMACVETASPVILQVSKGARSYAN-----------QTLLRHLAAGAVEYA 82
Bcapillosus               VNNMEIVQGITEAAQELKAPVILQVSKGARAYAN-----------HTYLVKLVEAAVIEC 76
Cdifficile                VENMEMVIAVIEAAEELNSPVILQTTPSTVKYAG-----------LDY--YLANAKVAAE 71
                                                     .   :                   :        

Gzeae                     LAPTYGIPVVLHTDHCAKKLLPWLDGMLDADEAYFKEKGEPLFSSHMIDLSEEP------ 150
Pbrasiliensis             IAPSYGIPVVLHTDHCAKKLLPWLDGMLDADECYFKLHNEPLFSSHMIDLSEES------ 150
Cneoformans               VAPHYGVPVVLHSDHCAKKLLPWFDGMLEADEAYFKEHGEPLFSSHMLDLSEES------ 149
Catlanticus               LAEAYGATVILHTDHCAKKLLPWIDGLLDASEKFYNETGKSLYSSHMIDLSEEP------ 146
Fbacterium                MAEAYGVPVILHTDHCAKKLLPWIDGLLDASEQHYKETGKPLYSSHMIDLSEEP------ 146
GOS_677020                LATLYGATVILHTDHCAKKLLPWIDGLLTASEAFYAEHGKSLFSSHMIDLSEEP------ 86
Pluminescens              MAEHYGVPVILHTDHCARKLLPWIDGLLDAGEKHYAATGKPLFSSHMIDLSEES------ 149
Methylomonas              LAELYGVPVVLHTDHAAKKLLPWVDGMLDEGEKFFAATGKPLFSSHMLDLSEES------ 149
Kmicrum                   VAKLYGVPVILHTDHCMKSWLNWFEGMLEADEAYFKQHGEPLFSSHMLDLSEEP------ 231
Cjejuni                   LAKAYGVPVILHTDHAARKLLPWIDGLIEANAQYKKTHGQALFSSHMLDLSEES------ 144
Bvalaisiana               MAEHYGVPVVLHTDHCAKNLLPWVEGLLEYGEKYYSQHKKPLFSSHMLDLSEEP------ 149
Bspielmanii               MAEHYGVPVVLHTDHCAKNLLPWVEGLLEYGEKYYSQHKRPLFSSHMLDLSEES------ 149
Scitri                    DIT---VPAALHLDHGQ--SVESCKMAIDAG-----------FSSVMYDGSHHP------ 118
Alaidlawii                NIS---VPVAVHLDHG---TYEGAFKAIRAG-----------FTSVMFDGSHYP------ 110
Agonensis                 NIT---VPVAIHIDHGS--SFEKCKAAIDAG-----------FTSVMIDASHHP------ 112
Rpickettii                PE----IPLVMHQDHGQ--SPAICQGAIDLG-----------FGSVMMDGSLREDGKTPA 116
Monocercomonoides         PE----IPVVLHLDHGD--SLETAKTAISLG-----------FTSVMIDASSKP------ 108
Pphaeoclathratiforme      AELGSPIPIVLHLDHGD--SFELCKDCIDSG-----------FSSVMIDGSHLS------ 124
Ctepidum                  AELGREIPIVLHLDHGD--SFELCKDCIETG-----------FSSVMIDGSHLS------ 123
Bcapillosus               PD----IPIVLHLDHGD--SFETCKSCIDGG-----------FTSVMIDASSKP------ 113
Cdifficile                RVK---IPVAMHLDHGS--SFDLAMKALRSG-----------YTSIMIDGSHES------ 109
                                 .  :* **            :  .           : * * * *         

Gzeae                     -VEWNIETTAKYLKRAAPMKQWLEMEIGITGGEEDGVNNED--------VDNNSLYTQPE 201
Pbrasiliensis             -VEWNIETTAKYLKRAAPMKQWLEMEIGITGGEEDGVNNES--------VDNNSLYTQPE 201
Cneoformans               -KEDNIKDCVFYFKRMAKVNLWLEMEIGITGGEEDGVDNTS--------VDNNSLYTQPE 200
Catlanticus               -LEENIEICKEYLARMSKMGMTLEIELGITGGEEDGVDNTD--------VDDSKLYTQPE 197
Fbacterium                -IEENIEICKQYLTRMSKMGMTLEIELGITGGEEDGVDNSD--------VDASKLYTQPE 197
GOS_677020                -IEENIEICKTYLERMKKMDMTLEIELGITGGEEDGVDNSD--------VDASKLYTQPE 137
Pluminescens              -LEENIEICSQYLARMAKIDMTLEIELGCTGGEEDGVDNSH--------MDSSALYTQPE 200
Methylomonas              -LEENIEICGKYLARMAKMGMTLEIELGCTGGEEDGVDNSG--------MDHSALYTQPE 200
Kmicrum                   -LEENVAICKKYLERMAKINCLLEMELGVTGGEEDGVDNSD--------VDSSRLYTQPE 282
Cjejuni                   -LEENLSTCEVYLQKLDALGVALEIELGCTGGEEDGVDNTG--------IDNSKLYTQPE 195
Bvalaisiana               -IKENIEISKKFLERMAKIEMFLEIELGITGGEEDGVDNSD--------RALHELFSTPE 200
Bspielmanii               -IEENIEISKKFLERMAKIEMFLEIELGITGGEEDGVDNSD--------RALHELFSTPE 200
Scitri                    -FAENLKNTKEVVAYAKINAVSVEAEIGTIGGEEDGVVG------------AGEI-GDPK 164
Alaidlawii                -FEENLKKTQEVVAVAHAVGVSVEAEVGSIGGEEDGVVG------------TGEL-ADPE 156
Agonensis                 -FEENVEITSKVVEYAHARGVSVEAELGTVGGQEDDVVA------------EGIIYANPD 159
Rpickettii                DFDYNVDVTRRVVEMAHKVGVTVEGELGCLGSLETGMAGEEDGHGAEGKLDHSSLLTDPE 176
Monocercomonoides         -YEENVRITKEVVEYAHAFGVSVEAELGTLGGIEEDVSG-------------VVKLTDPK 154
Pphaeoclathratiforme      -YEDNIELTKKVVAYAHQFDVTVEGELGVLAGIEDEV------------SAAHHTYTQPE 171
Ctepidum                  -YEDNVSLTRKVVEFAHQHDVTVEGELGVLAGIEDEV------------HATKHTYTEPD 170
Bcapillosus               -FAENIEITRKVVEYAHDHGVVVEAELGALAGVEDEVNV----------SAEDSHYTRPE 162
Cdifficile                -FENNISISKSVVKACSPSLIPVEAELGKVGGKEDDLDG-----------GNSNDYTNPK 157
                              *:      .         :* *:*  .. *  :                     *.

Gzeae                     DILNIYNTLSPIS-PYFSIAAGFGNVHGVYKPGNVKLHP----ELLGKHQAHVKEALKSD 256
Pbrasiliensis             DIYTIYKTLSAIS-PYFSIAAGFGNVHGVYKPGNVRLHP----ELLSKHQAHVKEKTGSS 256
Cneoformans               DIWDVYSALNAIS-PNFSIAAGFGNVHGVYKPGNVKLRP----ELLGKHQKYTHEKIGGD 255
Catlanticus               EVAYAYEELSKVS-DQFTIAAAFGNVHGVYKPGNVKLTP----KILKNSQEYISNKYNVE 252
Fbacterium                EVAYAYEELSKIS-DQFTIAAAFGNVHGVYRPGNVKLTP----KILKNSQDYISQKYGVG 252
GOS_677020                EVAYAYEELSKIS-DQFTIAAAFGNVHGVYKPGNVKLTP----KILRNSQTHISEKYNLP 192
Pluminescens              DVAYAYEKLNAIS-PRFTIAASFGNVHGVYKPGNVKLTP----KILRNSQDYVSEKFNLP 255
Methylomonas              DVAYAYEHLSKIS-PNFTIAASFGNVHGVYSPGNVKLTP----KILDNSQKYVSEKFGLP 255
Kmicrum                   EVWYTYQELSSIPNAQFTIAASFGNVHGVYAPGNVDLKP----EILHNTQKFIKEKLGSE 338
Cjejuni                   DVALAYERLGKIS-DKFSIAASFGNVHGVYKPGNVSLQP----EILKNSQKFVKDKFALN 250
Bvalaisiana               DIYYGYSELLKIS-PNFQIAAAFGNVHGVYKPGNVKLTP----RVLRDGQDYVIAKTGTN 255
Bspielmanii               DIYYGYSELLKIS-PNFQIAAAFGNVHGVYKPGNVKLTP----RVLKDGQDYVISKTGAN 255
Scitri                    EAAEMVA-TGINF-----LAAGIGNIHGPYPTGWPG-------------LNFQALEDIQA 205
Alaidlawii                ECRIIAA-TGVDL-----FAAGIGNIHGKYPANWKG-------------LDFGVLKTVSE 197
Agonensis                 ECEELVKRTGIDC-----LAPALGSVHGPY-KGEPK-------------LGFKEMEEIRD 200
Rpickettii                EAAQFVKATQLDA-----LAIAIGTSHGAYKFTRKPTGD---------ILAISRVKEIHA 222
Monocercomonoides         QATEFVAATGVDA-----LAVAIGTSHGAYKFKSTP------------VLAIDLVETIS- 196
Pphaeoclathratiforme      EVEDFVSKTGVDS-----LAISIGTSHGAFKFKPGEDPK----------IRLDILTEIEH 216
Ctepidum                  QVEDFVGKTGVDS-----LAIAIGTSHGAFKFKPGEDHK----------IRLDILAEIEK 215
Bcapillosus               EVEEFVSKTGCDS-----LAIAIGTSHGAYKFTAAQCTRNEKGELVPPPLRFDILDEVVR 217
Cdifficile                EAKEFVDRTGISS-----LAIAIGTAHGLYKGEPK--------------IDLDRLSEIK- 197
                          :                 :* .:*. ** :                              

Gzeae                     NDKPVFFVFHGGS---------------------GSSKKEYLDAIGFGVVKVNVDTDMQF 295
Pbrasiliensis             KNKPVYLVFHGGS---------------------GSTKAEFKEAISYGVVKVNLDTDLQY 295
Cneoformans               EEKPLYLVFHGGS---------------------GSSKEEIREAVVNGVVKMNVDTDTQW 294
Catlanticus               HN-HIDFVFHGGS---------------------GSTVEEIREAIGYGVIKMNIDTDLQY 290
Fbacterium                HN-HIDFVFHGGS---------------------GSTVEEIREGISYGVIKMNIDTDMQY 290
GOS_677020                EN-TVDFVFHGGS---------------------GSTQEEIQEAIGYGVIKMNIDTDLQF 230
Pluminescens              HN-SLDFVFHGGS---------------------GSTAEEIKEAVSYGVVKMNIDTDTQW 293
Methylomonas              AK-SLTFVFHGGS---------------------GSSPEEIKESISYGVVKMNIDTDTQW 293
Kmicrum                   SDKPCNFVFHGGS---------------------GSSKEDIQYAIEAGVVKMNIDTDTQW 377
Cjejuni                   SDKPINFVFHGGS---------------------GSELKDIKNAVSYGVIKMNIDTDTQW 289
Bvalaisiana               IAKPVSYVFHGGS---------------------GSTIDEINEALSYGVVKMNIDTDTQW 294
Bspielmanii               ISKPVSYVFHGGS---------------------GSTIDEINEALSYGVVKMNIDTDTQW 294
Scitri                    AAK-IGMVLHGGS---------------------GIPQEQVKKAISLGISKINVNTELQI 243
Alaidlawii                VTNGVPLVLHGGT---------------------GIPADQITKAISLGIAKINVNTELQL 236
Agonensis                 RTG-VPLVLHGGT---------------------GIPTEQIQRAISLGTSKINVNTENQM 238
Rpickettii                RIPNTHLVMHGSSSVPQELLAIINQYGGKMKETYGVPVEEIQEAIKYGVRKINIDTDIRL 282
Monocercomonoides         KATEKPLVMHGSSSVPQEILADINKYGGKMPDAQGVPIPAIQNAIERGVCKVNVDTDSRM 256
Pphaeoclathratiforme      RIPGFPIVLHGSSSVPQDLVKTINEHGGKLKDAIGISEDQLRLAAKSAVCKINIDSDGRL 276
Ctepidum                  RIPGFPIVLHGASSVPQDLVQMINAHGGKLKDAVGIGEDQLREAARSAVCKINIDSDGRL 275
Bcapillosus               RLPGFPIVLHGSSSVPQEYVKMVNEFGGKMPDAVGIPEEQLRQAARGAVCKINIDSDLRL 277
Cdifficile                NVVSIPLVLHGGS---------------------GIHDDIIKEAIKRGIAKVNYATELRI 236
                                 *:**.:                     *        .   .  *:*  :: : 

Gzeae                     AYCSGIRDYMVNKREYVNTTVGNPDGEDKPNKKYFDPRVWVREGEKTMSKRVAEALEDFN 355
Pbrasiliensis             AYLSGVRDFVLKKKDYLMSAVGNPEGEDKPNKKYFDPRVWIREGEKTMCARVQEAFDDFN 355
Cneoformans               AYLCGVRDFVLKKKDYLMTQVGNPEGADKPNKKQYDPRVWVREGEKTLVERVKEACVDLG 354
Catlanticus               AFTEGCRDYILDKKDYISAQIGNPDGDDIPNKKYYDPRKWVREGELTFKARLKKAFEDLN 350
Fbacterium                AFLSGVRDYIQDKKDYLQTQIGNPDGDDVPNKKYYDPRVWLRKGEDAFVARLKKAFEDLN 350
GOS_677020                AFTEGIRDYMTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE-------------- 276
Pluminescens              ATWEGILNYYQKNEGYLQGQLGNPEGADKPNKKFYDPRVWLRAGQVSMAARLEQAFKELN 353
Methylomonas              ATWEGVMNFYKKNEGYLQGQIGNPEGADKPNKKYYDPRVWQRAGQEGMVARLQQAFQELN 353
Kmicrum                   AYWDGMRKYEAKNRDYLQGQIGNPDGAEKPNKKYYDPRMSLRAGEESMVERLVAAAADLN 437
Cjejuni                   AFWDGVREYELKNRAYLQGQIGNPEGDDKPNKKYYDPRVWLRSGEESMIKRLEIAFEDLN 349
Bvalaisiana               AAWEGVLNYYKKNENRLQSQLGDGKDADIPNKKFYDPRVWLREAEISMKDRVKIACKNLN 354
Bspielmanii               AAWEGVLNYYKKNENRLQGQLGDGKNIDVPNKKFYDPRVWLREAEISMKDRVKIACKNLN 354
Scitri                    AFAVATRKYIEEGKDKPE------------NGKGFDPRKLLRPGYEAIKTTFDELTS-WF 290
Alaidlawii                AFAAATRKYIEEGKD--L------------ESKGFDPRKLLNPGYVAMKQVIKDKLT-MF 281
Agonensis                 AFTKVVREVLA--KD----------------EKVYDPRKFLGPGRDAIKETVIGKMR-EF 279
Rpickettii                AMTGAVRKFLAENPD------------------KFDAREWLKPAREAAKQICKARYI-QF 323
Monocercomonoides         AMTATIRKIFTEQPG------------------VFDPREYLGPAREATKQLVMSKMR-DF 297
Pphaeoclathratiforme      AMTAAIRKVLDEKPE------------------EFDPRKYLGPARDALKKLYVHKIINVL 318
Ctepidum                  AMTAAVRKVLDEKPE------------------EFDPRKYLGPARDALKQLYMHKIINVL 317
Bcapillosus               AMTGTIRKFFAEHPD------------------KFDPREYLKPARANIKELVKHKLINVL 319
Cdifficile                AYSKGVKKVLNEDSE------------------VIDPKKYGLAGLQSVKDFVKEKIK-VC 277
                          *      .                           *.:     .                

Gzeae                     TANQL-------------------------- 360
Pbrasiliensis             TSNQL-------------------------- 360
Cneoformans               NNNRN-------------------------- 359
Catlanticus               NVNTL-------------------------- 355
Fbacterium                NVDTL-------------------------- 355
GOS_677020                -------------------------------
Pluminescens              AIDVL-------------------------- 358
Methylomonas              AVNTL-------------------------- 358
Kmicrum                   CVDVL-------------------------- 442
Cjejuni                   CINKN-------------------------- 354
Bvalaisiana               NINRN-------------------------- 359
Bspielmanii               NINRN-------------------------- 359
Scitri                    GCKGKA------------------------- 296
Alaidlawii                GSVNKA------------------------- 287
Agonensis                 GSSGKAL------------------------ 286
Rpickettii                GCEGQAGKIKPISLSVMAQKYQSGDLAQVVQ 354
Monocercomonoides         GTAGHAGDYVPISLEEAKKTYYG--L----- 321
Pphaeoclathratiforme      GSDGKA------------------------- 324
Ctepidum                  GSNGKA------------------------- 323
Bcapillosus               GCDGKA------------------------- 325
Cdifficile                GSVNKV------------------------- 283
                                                         
==============================================================================================

BLAST

PROTOCOLE:
I)BLASTp contre nr au NCBI à 5000 séquences.
II)BLASTp contre Swissprot au NCBI
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

I)BLASTp contre nr:
On a fait un blastp à 5000 séquences pour obtenir des Evalue positives. En effet, le passage à des
Evalues superieures à 1 marque l'absence de toute similarités avec notre séquence.
Apres observation des alignements deux à deux on a definit le seuil des Evalue(limite entre les sequences
homolgues et non homologues) à 1e-05. 
De plus, les scores importants pour les premiers homologues(qui ont tous une fonction fructose-bisphosphate aldolase) 
nous permettent d'emettre l'hypothese que l'échantillon est codant
pour une fructose-bisphosphate aldolase. En effet, plus un score est important et plus une Evalue
est faible, plus il y a de similarité entre la séquence et notre échantillon. 

II)BLASTp contre Swissprot:
Ce blast nous permet de confirmer l'hypothese emise sur la fonction de notre echantillon. En effet 
les scores importants correspondent tous à des Fructose-bisphosphate aldolases, descendants
de la Ketose-bisphosphate aldolase. De plus dans les fiches des homologues de notre sequence, 
on definit le symbole du gene: fba

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

I) blastp contre nr

a)Entête des résultats

Query ID
    lcl|31021
Description
    GOS_677020 Traduction [2-829 sens direct]
Molecule type
    amino acid
Query Length
    276

Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTP 2.2.19+ Citation

________________________________________________________________________________________________

b)Liste complète des hits

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_00951104.1|  fructose-bisphosphate aldolase [Croceibact...   474    4e-132
ref|ZP_01733428.1|  fructose-bisphosphate aldolase [Flavobacte...   468    3e-130
ref|ZP_01200852.1|  fructose 1, 6-bisphosphate aldolase [Flavo...   463    6e-129
ref|ZP_01059853.1|  fructose-bisphosphate aldolase [Flavobacte...   457    3e-127
ref|ZP_01253293.1|  fructose-bisphosphate aldolase [Psychrofle...   457    5e-127
ref|YP_860437.1|  fructose-bisphosphate aldolase [Gramella for...   456    1e-126 Gene info
ref|ZP_01053831.1|  fructose-bisphosphate aldolase [Tenacibacu...   453    8e-126
ref|ZP_01117668.1|  fructose-bisphosphate aldolase [Polaribact...   450    6e-125
ref|ZP_02161395.1|  fructose-bisphosphate aldolase [Kordia alg...   444    3e-123
ref|ZP_01122309.1|  fructose-bisphosphate aldolase [Robiginita...   444    4e-123
ref|YP_001295254.1|  fructose-bisphosphate aldolase [Flavobact...   443    5e-123 Gene info
ref|ZP_01050292.1|  fructose-bisphosphate aldolase [Cellulopha...   438    2e-121
ref|ZP_02181990.1|  fructose-bisphosphate aldolase [Flavobacte...   436    1e-120
ref|YP_528746.1|  fructose-bisphosphate aldolase [Saccharophag...   431    3e-119 Gene info
ref|ZP_01107228.1|  fructose-bisphosphate aldolase [Flavobacte...   428    2e-118
ref|ZP_01891008.1|  fructose-bisphosphate aldolase [unidentifi...   428    3e-118
ref|YP_001193814.1|  fructose-bisphosphate aldolase [Flavobact...   420    5e-116 Gene info
gb|AAO17213.1|  Orf59 [Photorhabdus luminescens]                    419    1e-115
ref|NP_928291.1|  fructose-bisphosphate aldolase [Photorhabdus...   419    1e-115 Gene info
ref|ZP_01885474.1|  fructose-bisphosphate aldolase [Pedobacter...   418    2e-115
ref|ZP_02962643.1|  hypothetical protein PROSTU_04780 [Provide...   418    3e-115
ref|ZP_01216326.1|  fructose-bisphosphate aldolase [Psychromon...   417    3e-115
ref|YP_002150024.1|  fructose-bisphosphate aldolase class II [...   414    5e-114 Gene info
ref|ZP_03317355.1|  hypothetical protein PROVALCAL_00262 [Prov...   412    1e-113
ref|ZP_03313592.1|  hypothetical protein PROVRUST_00356 [Provi...   412    1e-113
ref|ZP_01262880.1|  fructose-bisphosphate aldolase [Vibrio alg...   410    7e-113
ref|YP_002073764.1|  fructose-bisphosphate aldolase, class II ...   410    8e-113 Gene info
ref|YP_679642.1|  fructose-bisphosphate aldolase [Cytophaga hu...   409    1e-112 Gene info
ref|NP_798978.1|  fructose-bisphosphate aldolase [Vibrio parah...   407    6e-112 Gene info
ref|YP_001209095.1|  fructose-bisphosphate aldolase [Dicheloba...   407    7e-112 Gene info
ref|YP_855324.1|  fructose-bisphosphate aldolase [Aeromonas hy...   405    1e-111 Gene info
ref|YP_941832.1|  fructose-bisphosphate aldolase [Psychromonas...   405    2e-111 Gene info
ref|YP_001446726.1|  fructose-bisphosphate aldolase [Vibrio ha...   405    2e-111 Gene info
ref|YP_051999.1|  fructose-bisphosphate aldolase [Pectobacteri...   405    2e-111 Gene info
ref|YP_001143220.1|  fructose-bisphosphate aldolase [Aeromonas...   404    3e-111 Gene info
ref|NP_230132.1|  fructose-bisphosphate aldolase [Vibrio chole...   404    5e-111 Gene info
ref|YP_001436544.1|  fructose-bisphosphate aldolase [Enterobac...   403    8e-111 Gene info
ref|ZP_02196823.1|  fructose-bisphosphate aldolase [Vibrio cam...   403    8e-111
ref|ZP_01721483.1|  fructose-bisphosphate aldolase [Algoriphag...   402    1e-110
ref|YP_001359106.1|  fructose-bisphosphate aldolase [Sulfurovu...   402    1e-110 Gene info
ref|ZP_00820779.1|  COG0191: Fructose/tagatose bisphosphate al...   400    6e-110
ref|ZP_01897346.1|  fructose-bisphosphate aldolase [Moritella ...   400    8e-110
ref|ZP_00831824.1|  COG0191: Fructose/tagatose bisphosphate al...   400    8e-110
ref|YP_001480167.1|  fructose-bisphosphate aldolase [Serratia ...   398    3e-109 Gene info
gb|ABG26351.1|  fructose-1,6-bisphosphate aldolase [Methylomon...   398    3e-109
gb|AAN81951.1|AE016766_39  Fructose-bisphosphate aldolase clas...   397    3e-109 Gene info
ref|YP_542287.1|  fructose-bisphosphate aldolase [Escherichia ...   397    3e-109 Gene info
ref|YP_001455787.1|  fructose-bisphosphate aldolase [Citrobact...   397    3e-109 Gene info
ref|YP_071696.2|  fructose-bisphosphate aldolase [Yersinia pse...   397    4e-109 Gene info
ref|YP_854138.1|  fructose-bisphosphate aldolase [Escherichia ...   397    5e-109 Gene info
ref|NP_404538.1|  fructose-bisphosphate aldolase [Yersinia pes...   397    5e-109 Gene info
emb|CAH22433.1|  Fructose-bisphosphate aldolase class II [Yers...   397    5e-109 Gene info
ref|YP_001873739.1|  fructose-bisphosphate aldolase, class II ...   397    6e-109 Gene info
ref|ZP_03064070.1|  fructose-bisphosphate aldolase [Shigella d...   397    6e-109
ref|YP_690345.1|  fructose-bisphosphate aldolase [Shigella fle...   397    7e-109 Gene info
pir||G85948  fructose-bisphosphate aldolase, class II [importe...   396    7e-109
pdb|1B57|A  Chain A, Class Ii Fructose-1,6-Bisphosphate Aldola...   396    9e-109 Related structures
ref|NP_311823.1|  fructose-bisphosphate aldolase [Escherichia ...   396    9e-109 Gene info
ref|YP_409402.1|  fructose-bisphosphate aldolase [Shigella boy...   396    1e-108 Gene info
ref|YP_001178051.1|  fructose-bisphosphate aldolase [Enterobac...   395    1e-108 Gene info
ref|YP_455694.1|  fructose-bisphosphate aldolase [Sodalis glos...   395    1e-108 Gene info
ref|YP_001007579.1|  fructose-bisphosphate aldolase [Yersinia ...   395    2e-108 Gene info
ref|YP_001573492.1|  fructose-bisphosphate aldolase [Salmonell...   394    3e-108 Gene info
ref|ZP_00830021.1|  COG0191: Fructose/tagatose bisphosphate al...   394    4e-108
ref|ZP_01064707.1|  fructose-bisphosphate aldolase [Vibrio sp....   394    5e-108
ref|YP_001908730.1|  Fructose-bisphosphate aldolase class II [...   394    5e-108 Gene info
ref|ZP_03342487.1|  fructose-bisphosphate aldolase [Salmonella...   394    5e-108
ref|NP_457467.1|  fructose-bisphosphate aldolase [Salmonella e...   394    5e-108 Gene info
sp|O52402|ALF_EDWIC  Fructose-bisphosphate aldolase >gb|AAB925...   394    6e-108
ref|ZP_02661193.1|  fructose-bisphosphate aldolase [Salmonella...   394    6e-108
ref|ZP_02900574.1|  fructose-bisphosphate aldolase [Escherichi...   394    6e-108
ref|YP_002236618.1|  fructose-bisphosphate aldolase [Klebsiell...   393    7e-108 Gene info
ref|ZP_02477289.1|  fructose-bisphosphate aldolase [Haemophilu...   393    7e-108
pdb|1DOS|A  Chain A, Structure Of Fructose-Bisphosphate Aldola...   393    8e-108 Related structures
ref|YP_001589990.1|  fructose-bisphosphate aldolase [Salmonell...   393    8e-108 Gene info
ref|ZP_01160593.1|  fructose-bisphosphate aldolase [Photobacte...   393    9e-108
ref|ZP_01875227.1|  fructose-bisphosphate aldolase [Lentisphae...   392    1e-107
ref|ZP_02831904.1|  fructose-bisphosphate aldolase [Salmonella...   391    3e-107
ref|YP_001336981.1|  fructose-bisphosphate aldolase [Klebsiell...   390    6e-107 Gene info
ref|ZP_03284382.1|  hypothetical protein ENTCAN_04213 [Enterob...   390    8e-107
ref|YP_526751.1|  fructose-bisphosphate aldolase [Saccharophag...   388    2e-106 Gene info
ref|ZP_00348247.1|  COG0191: Fructose/tagatose bisphosphate al...   386    8e-106
ref|YP_001652261.1|  fructose-bisphosphate aldolase [Actinobac...   386    1e-105 Gene info
ref|YP_393024.1|  fructose-bisphosphate aldolase [Sulfurimonas...   386    1e-105 Gene info
ref|YP_001980708.1|  fructose-bisphosphate aldolase, class II ...   385    1e-105 Gene info
ref|ZP_01236105.1|  fructose-bisphosphate aldolase [Vibrio ang...   385    3e-105
ref|YP_002155199.1|  fructose-bisphosphate aldolase, class II ...   384    3e-105 Gene info
ref|NP_760439.1|  fructose-bisphosphate aldolase [Vibrio vulni...   384    5e-105 Gene info
ref|ZP_01220060.1|  fructose-bisphosphate aldolase [Photobacte...   383    7e-105
ref|ZP_01993223.1|  fructose-bisphosphate aldolase, class II [...   383    8e-105
gb|AAQ89598.1|  FbaM [uncultured bacterium]                         383    8e-105
ref|YP_340258.1|  fructose-bisphosphate aldolase [Pseudoaltero...   382    1e-104 Gene info
ref|YP_718413.1|  fructose-bisphosphate aldolase [Haemophilus ...   382    1e-104 Gene info
ref|NP_246800.1|  fructose-bisphosphate aldolase [Pasteurella ...   382    2e-104 Gene info
ref|YP_001343846.1|  fructose-bisphosphate aldolase [Actinobac...   382    2e-104 Gene info
ref|ZP_01113109.1|  fructose-bisphosphate aldolase [Reinekea s...   382    2e-104
ref|YP_002173723.1|  fructose-bisphosphate aldolase [Mannheimi...   382    2e-104 Gene info
ref|YP_002262078.1|  fructose-bisphosphate aldolase class II [...   381    3e-104
ref|YP_001489321.1|  fructose-bisphosphate aldolase [Arcobacte...   380    4e-104 Gene info
ref|YP_001783429.1|  fructose-bisphosphate aldolase, class II ...   380    5e-104 Gene info
ref|YP_131247.1|  fructose-bisphosphate aldolase [Photobacteri...   380    7e-104 Gene info
ref|YP_203826.1|  fructose-bisphosphate aldolase [Vibrio fisch...   379    1e-103 Gene info
ref|ZP_01871390.1|  fructose-bisphosphate aldolase [Caminibact...   379    1e-103
gb|EDZ63581.1|  fructose-bisphosphate aldolase, class II [Camp...   379    2e-103
ref|ZP_00156350.2|  COG0191: Fructose/tagatose bisphosphate al...   378    3e-103
ref|NP_873363.1|  fructose-bisphosphate aldolase [Haemophilus ...   377    6e-103 Gene info
ref|ZP_01614676.1|  fructose-bisphosphate aldolase [Alteromona...   377    7e-103
ref|ZP_00155517.2|  COG0191: Fructose/tagatose bisphosphate al...   376    1e-102
ref|ZP_01786079.1|  fructose-bisphosphate aldolase [Haemophilu...   376    1e-102
ref|ZP_00992815.1|  fructose-bisphosphate aldolase [Vibrio spl...   373    9e-102
ref|NP_438682.1|  fructose-bisphosphate aldolase [Haemophilus ...   373    1e-101 GeoGene info
ref|ZP_01789253.1|  fructose-bisphosphate aldolase [Haemophilu...   372    1e-101
ref|YP_248233.1|  fructose-bisphosphate aldolase [Haemophilus ...   372    1e-101 Gene info
ref|ZP_01791097.1|  fructose-bisphosphate aldolase [Haemophilu...   372    2e-101
ref|ZP_01796084.1|  hypothetical protein CGSHiR3021_10585 [Hae...   371    3e-101
ref|YP_001292468.1|  fructose-bisphosphate aldolase [Haemophil...   371    3e-101 Gene info
ref|YP_087436.1|  fructose-bisphosphate aldolase [Mannheimia s...   370    5e-101 Gene info
ref|YP_339611.1|  fructose-bisphosphate aldolase [Pseudoaltero...   370    8e-101 Gene info
gb|AAO43196.1|  fructose-1,6-bisphosphate aldolase precursor [...   367    6e-100
ref|YP_001467104.1|  fructose-bisphosphate aldolase [Campyloba...   367    6e-100 Gene info
gb|AAM66752.1|  fructose-1,6-bisphosphate aldolase precursor [...   367    8e-100
gb|AAV71138.1|  plastid C1 class II fructose bisphosphate aldo...   366    1e-99 
ref|YP_891705.1|  fructose-bisphosphate aldolase [Campylobacte...   366    1e-99  Gene info
ref|YP_001356033.1|  fructose-bisphosphate aldolase [Nitratiru...   365    2e-99  Gene info
ref|ZP_03129759.1|  fructose-bisphosphate aldolase, class II [...   365    2e-99 
ref|XP_001750808.1|  hypothetical protein [Monosiga brevicolli...   365    2e-99  Gene info
gb|ABA55533.1|  chloroplast fructose-6-bisphosphate aldolase c...   365    3e-99 
ref|ZP_00367304.1|  fructose-bisphosphate aldolase, class II [...   365    3e-99 
ref|YP_001406774.1|  fructose-bisphosphate aldolase [Campyloba...   364    5e-99  Gene info
ref|ZP_00368272.1|  fructose-bisphosphate aldolase, class II [...   363    8e-99 
ref|ZP_01071621.1|  fructose-bisphosphate aldolase, class II [...   362    2e-98 
ref|NP_281780.1|  fructose-bisphosphate aldolase [Campylobacte...   361    3e-98  Gene info
ref|YP_001482135.1|  fructose-bisphosphate aldolase [Campyloba...   361    3e-98  Gene info
ref|ZP_01069984.1|  fructose-bisphosphate aldolase [Campylobac...   360    6e-98 
gb|AAV71135.1|  plastid C1 class II fructose bisphosphate aldo...   360    9e-98 
ref|YP_001398164.1|  fructose-bisphosphate aldolase [Campyloba...   359    1e-97  Gene info
ref|YP_670799.1|  fructose-bisphosphate aldolase [Escherichia ...   359    1e-97  Gene info
ref|ZP_01450325.1|  fructose-bisphosphate aldolase [alpha prot...   358    3e-97 
ref|YP_001408067.1|  fructose-bisphosphate aldolase [Campyloba...   357    6e-97  Gene info
gb|AAV71137.1|  plastid C1 class II fructose bisphosphate aldo...   355    2e-96 
gb|AAO43262.1|  fructose-1,6-biphosphate aldolase precursor [P...   355    3e-96 
ref|XP_001884461.1|  fructose 1,6-bisphosphate aldolase [Lacca...   353    6e-96  Gene info
ref|ZP_00371795.1|  fructose-bisphosphate aldolase, class II [...   353    8e-96 
ref|XP_001839440.1|  hypothetical protein CC1G_06653 [Coprinop...   352    2e-95  Gene info
emb|CAL56106.1|  fructose-1,6-bisphosphate aldolase, class II ...   350    6e-95 
gb|ACF28657.1|  fructose 1,6 biphosphate aldolase [Amphidinium...   349    1e-94 
ref|XP_382946.1|  hypothetical protein FG02770.1 [Gibberella z...   349    1e-94  Gene info
ref|YP_001612562.1|  fructose-bisphosphate aldolase [Sorangium...   348    2e-94  Gene info
ref|NP_878552.1|  fructose-bisphosphate aldolase [Candidatus B...   348    3e-94  Gene info
dbj|BAF56083.1|  fructose 1,6-bisphosphate aldolase [Cystofilo...   347    7e-94 
gb|ABH10639.1|  fructose biphosphate aldolase [Coccidioides po...   346    1e-93 
ref|XP_001244213.1|  hypothetical protein CIMG_03654 [Coccidio...   346    1e-93  Gene info
ref|XP_001420119.1|  predicted protein [Ostreococcus lucimarin...   344    4e-93  Gene info
ref|XP_001556818.1|  fructose-bisphosphate aldolase [Botryotin...   344    5e-93  Gene info
ref|XP_001592320.1|  hypothetical protein SS1G_06561 [Scleroti...   343    7e-93  Gene info
ref|YP_277766.1|  fructose-bisphosphate aldolase [Candidatus B...   343    8e-93  Gene info
ref|XP_001881146.1|  eu2.Lbscf0012g03030 [Laccaria bicolor S23...   343    9e-93  Gene info
ref|XP_002143745.1|  fructose-bisphosphate aldolase, class II ...   343    1e-92  Gene info
ref|YP_945443.1|  fructose-bisphosphate aldolase [Borrelia tur...   342    2e-92  Gene info
ref|XP_001642375.1|  hypothetical protein Kpol_278p5 [Vanderwa...   342    2e-92  Gene info
ref|XP_001730421.1|  hypothetical protein MGL_2217 [Malassezia...   340    7e-92  Gene info
ref|YP_001883874.1|  fructose-bisphosphate aldolase [Borrelia ...   340    9e-92  Gene info
ref|XP_369021.2|  hypothetical protein MGG_00223 [Magnaporthe ...   340    9e-92  UniGene infoGene info
ref|NP_240263.1|  fructose-bisphosphate aldolase [Buchnera aph...   338    2e-91  Gene info
ref|YP_589069.1|  fructose-bisphosphate aldolase [Baumannia ci...   338    3e-91  Gene info
ref|XP_756821.1|  hypothetical protein UM00674.1 [Ustilago may...   337    5e-91  Gene info
ref|NP_660768.1|  fructose-bisphosphate aldolase [Buchnera aph...   337    8e-91  Gene info
ref|ZP_02368456.1|  fructose-bisphosphate aldolase [Borrelia v...   335    2e-90 
gb|AAV71136.1|  cytosolic class II fructose bisphosphate aldol...   335    3e-90 
ref|YP_002222903.1|  fructose-bisphosphate aldolase [Borrelia ...   334    4e-90  Gene info
ref|XP_459260.1|  hypothetical protein DEHA0D19327g [Debaryomy...   334    4e-90  Gene info
ref|YP_002222094.1|  fructose-bisphosphate aldolase [Borrelia ...   334    4e-90  Gene info
gb|ABF73010.1|  plastid fructose-1,6-bisphosphate aldolase cla...   333    7e-90 
ref|YP_709890.1|  fructose-bisphosphate aldolase [Borrelia afz...   333    8e-90  Gene info
ref|XP_001798548.1|  hypothetical protein SNOG_08226 [Phaeosph...   333    9e-90  Gene info
ref|ZP_03095473.1|  fructose-bisphosphate aldolase [Borrelia s...   332    2e-89 
ref|NP_212579.1|  fructose-bisphosphate aldolase [Borrelia bur...   332    2e-89  Gene info
ref|ZP_03088646.1|  fructose-bisphosphate aldolase [Borrelia g...   332    3e-89 
ref|XP_448879.1|  unnamed protein product [Candida glabrata] >...   331    4e-89  Gene info
ref|YP_072888.1|  fructose-bisphosphate aldolase [Borrelia gar...   331    4e-89  Gene info
ref|ZP_03328133.1|  fructose-bisphosphate aldolase [Borrelia g...   331    4e-89 
ref|ZP_02719412.1|  fructose-bisphosphate aldolase [Borrelia b...   331    4e-89 
ref|XP_001271168.1|  fructose-bisphosphate aldolase, class II ...   330    7e-89  Gene info
ref|XP_001644382.1|  hypothetical protein Kpol_1064p4 [Vanderw...   330    8e-89  Gene info
ref|NP_778008.1|  fructose-bisphosphate aldolase [Buchnera aph...   329    1e-88  Gene info
ref|XP_001819872.1|  hypothetical protein [Aspergillus oryzae ...   329    1e-88  Gene info
ref|XP_504407.1|  YALI0E26004p [Yarrowia lipolytica] >emb|CAG8...   327    4e-88  Gene info
ref|XP_958393.1|  fructose-bisphosphate aldolase [Neurospora c...   327    5e-88  Gene info
ref|XP_660479.1|  hypothetical protein AN2875.2 [Aspergillus n...   327    5e-88  Gene info
ref|XP_754452.1|  fructose-bisphosphate aldolase, class II [As...   327    6e-88  Gene info
ref|NP_871309.1|  fructose-bisphosphate aldolase [Wigglesworth...   327    7e-88  Gene info
ref|XP_001399881.1|  hypothetical protein An02g07470 [Aspergil...   327    8e-88  Gene info
emb|CAP94346.1|  Pc18g01220 [Penicillium chrysogenum Wisconsin...   326    2e-87 
ref|XP_001263297.1|  fructose-bisphosphate aldolase, class II ...   325    2e-87  Gene info
ref|XP_568771.1|  fructose-bisphosphate aldolase [Cryptococcus...   325    2e-87  Gene info
ref|XP_722836.1|  hypothetical protein CaO19.12088 [Candida al...   325    3e-87  Gene info
ref|XP_001213881.1|  fructose-bisphosphate aldolase [Aspergill...   323    6e-87  Gene info
gb|AAL34519.2|  fructose 1,6-biphosphate aldolase 1 [Paracocci...   322    1e-86 
ref|XP_001903114.1|  unnamed protein product [Podospora anseri...   320    9e-86  Gene info
ref|XP_001524369.1|  fructose-bisphosphate aldolase [Lodderomy...   317    8e-85  Gene info
gb|ACF33499.1|  fructose-bisphosphate aldolase [Candida tropic...   315    2e-84 
gb|EDN59849.1|  aldolase [Saccharomyces cerevisiae YJM789]          315    2e-84 
ref|NP_012863.1|  Fructose 1,6-bisphosphate aldolase, required...   315    3e-84  UniGene infoGene info
gb|EDV13034.1|  aldolase [Saccharomyces cerevisiae RM11-1a]         314    5e-84 
dbj|BAA04237.1|  fructose 1,6-bisphosphate aldolase [Schizosac...   314    5e-84 
ref|NP_595692.1|  fructose-bisphosphate aldolase Fba1 [Schizos...   314    5e-84  UniGene infoGene info
ref|NP_983014.1|  ABR068Cp [Ashbya gossypii ATCC 10895] >gb|AA...   312    2e-83  UniGene infoGene info
ref|XP_454290.1|  unnamed protein product [Kluyveromyces lacti...   312    2e-83  UniGene infoGene info
gb|EEB06266.1|  fructose-bisphosphate aldolase [Schizosaccharo...   312    2e-83 
gb|AAB00930.1|  fructose 1,6 bisphosphate-aldolase                  311    3e-83 
ref|XP_001938646.1|  fructose-bisphosphate aldolase [Pyrenopho...   311    5e-83  Gene info
gb|EEB08231.1|  fructose-bisphosphate aldolase [Schizosaccharo...   308    4e-82 
ref|ZP_03098536.1|  fructose-bisphosphate aldolase [Borrelia s...   306    2e-81 
ref|XP_001387503.1|  fructose-bisphosphate aldolase [Pichia st...   303    8e-81  Gene info
gb|AAV71134.1|  cytosolic class II fructose bisphosphate aldol...   300    6e-80 
gb|ABA55547.1|  cytosolic fructose-6-bisphosphate aldolase cla...   298    3e-79 
emb|CAA61912.1|  fructose-1,6-bisphosphate aldolase [Euglena g...   294    6e-78 
gb|EEA94659.1|  fructose-bisphosphate aldolase, class II [Pseu...   285    3e-75 
ref|YP_802834.1|  fructose-bisphosphate aldolase [Buchnera aph...   285    4e-75  Gene info
ref|YP_191210.1|  fructose-bisphosphate aldolase [Gluconobacte...   283    7e-75  Gene info
ref|ZP_01870691.1|  fructose-bisphosphate aldolase [Vibrio shi...   263    1e-68 
gb|AAO89071.1|  cytosolic class II fructose-1,6-bisphosphate a...   261    5e-68 
dbj|BAB12232.1|  fructose 1,6-bisphosphate aldolase [Aspergill...   259    2e-67 
ref|XP_001226079.1|  hypothetical protein CHGG_10812 [Chaetomi...   254    5e-66  Gene info
ref|XP_001617590.1|  hypothetical protein NEMVEDRAFT_v1g157247...   249    1e-64  UniGene infoGene info
ref|XP_001482220.1|  hypothetical protein PGUG_05240 [Pichia g...   230    1e-58  Gene info
sp|Q8J0N6|ALF_PARBR  Fructose-bisphosphate aldolase >gb|AAN855...   221    5e-56 
ref|ZP_02927983.1|  fructose-bisphosphate aldolase [Verrucomic...   216    1e-54 
ref|XP_001542964.1|  fructose-bisphosphate aldolase [Ajellomyc...   216    2e-54  Gene info
ref|YP_001877339.1|  fructose-bisphosphate aldolase, class II ...   214    5e-54  Gene info
ref|ZP_01854575.1|  fructose-bisphosphate aldolase [Planctomyc...   213    1e-53 
ref|YP_460805.1|  fructose-bisphosphate aldolase [Syntrophus a...   211    6e-53  Gene info
gb|EDZ70947.1|  YKL060Cp-like protein [Saccharomyces cerevisia...   211    6e-53 
ref|YP_845593.1|  fructose-bisphosphate aldolase [Syntrophobac...   211    7e-53  Gene info
ref|ZP_01130764.1|  fructose-bisphosphate aldolase [marine act...   207    7e-52 
ref|YP_873883.1|  fructose-bisphosphate aldolase [Acidothermus...   205    3e-51  Gene info
ref|YP_705474.1|  fructose-bisphosphate aldolase [Rhodococcus ...   204    5e-51  Gene info
gb|EDY80726.1|  fructose-bisphosphate aldolase, class II [Verr...   203    1e-50 
ref|YP_901523.1|  fructose-bisphosphate aldolase [Pelobacter p...   202    2e-50  Gene info
ref|YP_001109263.1|  fructose-bisphosphate aldolase [Saccharop...   200    9e-50  Gene info
ref|YP_951514.1|  fructose-bisphosphate aldolase [Mycobacteriu...   200    1e-49  Gene info
ref|YP_001801178.1|  fructose-bisphosphate aldolase [Corynebac...   199    1e-49  Gene info
ref|YP_830017.1|  fructose-bisphosphate aldolase [Arthrobacter...   199    2e-49  Gene info
ref|YP_062548.1|  fructose-bisphosphate aldolase [Leifsonia xy...   199    2e-49  Gene info
ref|YP_001704981.1|  fructose-bisphosphate aldolase [Mycobacte...   198    3e-49  Gene info
ref|YP_885158.1|  fructose-bisphosphate aldolase [Mycobacteriu...   198    3e-49  Gene info
ref|YP_001848985.1|  fructose-bisphosphate aldolase, Fba [Myco...   198    4e-49  Gene info
ref|NP_739211.1|  fructose-bisphosphate aldolase [Corynebacter...   198    4e-49  Gene info
ref|YP_121598.1|  fructose-bisphosphate aldolase [Nocardia far...   198    4e-49  Gene info
ref|YP_946363.1|  fructose-bisphosphate aldolase [Arthrobacter...   197    6e-49  Gene info
gb|EEA92560.1|  fructose-bisphosphate aldolase [Pseudovibrio s...   197    6e-49 
ref|YP_716782.1|  fructose-bisphosphate aldolase [Frankia alni...   197    8e-49  Gene info
ref|YP_001139584.1|  fructose-bisphosphate aldolase [Corynebac...   197    9e-49  Gene info
ref|NP_601964.1|  fructose-bisphosphate aldolase [Corynebacter...   197    9e-49  Gene info
ref|YP_001504590.1|  fructose-bisphosphate aldolase [Frankia s...   197    1e-48  Gene info
ref|YP_001222971.1|  fructose-bisphosphate aldolase [Clavibact...   196    1e-48  Gene info
ref|NP_301326.1|  fructose-bisphosphate aldolase [Mycobacteriu...   196    2e-48  Gene info
ref|YP_001131517.1|  fructose-bisphosphate aldolase [Mycobacte...   196    2e-48  Gene info
ref|YP_637680.1|  fructose-bisphosphate aldolase [Mycobacteriu...   196    2e-48  Gene info
emb|CAE53637.2|  putative fructose-1,6-bisphosphate aldolase [...   196    2e-48 
ref|YP_001626518.1|  fructose-bisphosphate aldolase [Renibacte...   196    2e-48  Gene info
ref|NP_940410.1|  fructose-bisphosphate aldolase [Corynebacter...   195    3e-48  Gene info
ref|YP_291066.1|  fructose-bisphosphate aldolase [Thermobifida...   194    5e-48  Gene info
ref|ZP_02837224.1|  fructose-bisphosphate aldolase, class II [...   194    5e-48 
emb|CAA35190.1|  fructose-bisphosphate aldolase [Corynebacteri...   194    5e-48 
ref|NP_627843.1|  fructose-bisphosphate aldolase [Streptomyces...   194    7e-48  Gene info
ref|YP_904338.1|  fructose-bisphosphate aldolase [Mycobacteriu...   194    8e-48  Gene info
ref|YP_002205545.1|  fructose-bisphosphate aldolase [Streptomy...   194    8e-48  Gene info
ref|YP_483439.1|  fructose-bisphosphate aldolase [Frankia sp. ...   194    8e-48  Gene info
ref|YP_001363851.1|  fructose-bisphosphate aldolase [Kineococc...   193    1e-47  Gene info
ref|NP_214877.1|  fructose-bisphosphate aldolase [Mycobacteriu...   193    1e-47  Gene info
ref|ZP_02043572.1|  hypothetical protein ACTODO_00416 [Actinom...   192    3e-47 
ref|YP_001156993.1|  fructose-bisphosphate aldolase [Salinispo...   192    3e-47  Gene info
ref|YP_001711072.1|  fructose-bisphosphate aldolase [Clavibact...   192    3e-47  Gene info
ref|YP_249986.1|  fructose-bisphosphate aldolase [Corynebacter...   191    5e-47  Gene info
ref|YP_925534.1|  fructose-bisphosphate aldolase [Nocardioides...   191    7e-47  Gene info
emb|CAD48742.1|  fructose-bisphosphate aldolase class II [Prop...   189    2e-46 
ref|YP_056684.1|  fructose-bisphosphate aldolase [Propionibact...   188    3e-46  Gene info
ref|NP_825700.1|  fructose-bisphosphate aldolase [Streptomyces...   187    5e-46  Gene info
ref|ZP_03182832.1|  fructose-bisphosphate aldolase [Streptomyc...   185    3e-45 
ref|YP_001824930.1|  putative fructose 1,6-bisphosphate aldola...   184    5e-45  Gene info
sp|Q9ZEM7|ALF_STRGB  Fructose-bisphosphate aldolase (FBP aldol...   184    7e-45 
ref|ZP_00996467.1|  ketose-bisphosphate aldolase, class-II:Fru...   184    7e-45 
ref|YP_001854047.1|  fructose-bisphosphate aldolase class II [...   184    9e-45  Gene info
ref|ZP_02943666.1|  fructose-bisphosphate aldolase, class II [...   184    9e-45 
ref|ZP_02917457.1|  hypothetical protein BIFDEN_00736 [Bifidob...   183    1e-44 
ref|ZP_00121417.1|  COG0191: Fructose/tagatose bisphosphate al...   182    2e-44  Gene info
ref|YP_001535061.1|  fructose-bisphosphate aldolase [Salinispo...   182    4e-44  Gene info
ref|NP_695738.1|  fructose-bisphosphate aldolase [Bifidobacter...   181    6e-44  Gene info
ref|ZP_03173021.1|  fructose-bisphosphate aldolase [Streptomyc...   180    8e-44  Gene info
ref|ZP_02963619.1|  fructose-bisphosphate aldolase [Bifidobact...   177    8e-43 
ref|YP_002197988.1|  fructose-bisphosphate aldolase [Streptomy...   176    1e-42  Gene info
ref|YP_908929.1|  fructose-bisphosphate aldolase [Bifidobacter...   175    4e-42  Gene info
ref|ZP_02027825.1|  hypothetical protein BIFADO_00232 [Bifidob...   174    5e-42 
ref|ZP_03323339.1|  hypothetical protein BIFCAT_00102 [Bifidob...   174    6e-42 
ref|ZP_03322930.1|  hypothetical protein BIFPSEUDO_01865 [Bifi...   174    7e-42 
ref|ZP_00381124.1|  COG0191: Fructose/tagatose bisphosphate al...   166    1e-39 
gb|AAV71139.1|  plastid C1 class II fructose bisphosphate aldo...   152    2e-35 
gb|ABA33681.1|  Fba-like protein [Haemophilus parasuis]             142    2e-32 
ref|ZP_01816299.1|  fructose-bisphosphate aldolase [Vibrionale...   141    5e-32 
gb|AAX81538.1|  fba1-like protein [Philodina sp. NPS-2005]          134    6e-30 
gb|ABL75360.1|  fructose-1,6-bisphosphate aldolase [Anoxybacil...   104    7e-21 
ref|YP_002317067.1|  Fructose-1,6-bisphosphate aldolase [Anoxy...   104    7e-21  Gene info
ref|YP_001125910.1|  fructose-1,6-bisphosphate aldolase [Geoba...   104    9e-21  Gene info
ref|ZP_01371903.1|  fructose-1,6-bisphosphate aldolase, class ...   103    1e-20 
ref|ZP_01722142.1|  fructose-1,6-bisphosphate aldolase, class ...   103    1e-20 
emb|CAK98220.1|  fructose-bisphosphate aldolase class II trans...   103    1e-20 
ref|YP_147739.1|  fructose-1,6-bisphosphate aldolase [Geobacil...   102    3e-20  Gene info
ref|YP_001679509.1|  putative aldolase [Heliobacterium modesti...   102    3e-20  Gene info
sp|P94453|ALF_BACST  Fructose-bisphosphate aldolase >emb|CAA72...   102    3e-20 
ref|ZP_02995863.1|  hypothetical protein CLOSPO_02986 [Clostri...   102    4e-20 
ref|YP_521172.1|  putative aldolase [Desulfitobacterium hafnie...   101    5e-20  Gene info
ref|ZP_02912324.1|  fructose-1,6-bisphosphate aldolase, class ...   101    7e-20 
ref|YP_149239.1|  fructose-bisphosphate aldolase [Geobacillus ...   101    8e-20  Gene info
ref|YP_252825.1|  fructose-bisphosphate aldolase [Staphylococc...   100    1e-19  Gene info
ref|YP_001787384.1|  tagatose bisphosphate family class II ald...   100    2e-19  Gene info
ref|YP_001254496.1|  class II aldolase, tagatose bisphosphate ...   100    2e-19  Gene info
ref|YP_001781557.1|  tagatose bisphosphate family class II ald...  99.8    2e-19  Gene info
emb|CAO81666.1|  fructose-bisphosphate aldolase [Candidatus Cl...  99.8    2e-19 
ref|ZP_02619682.1|  class II aldolase, tagatose bisphosphate f...  99.8    2e-19 
ref|ZP_01189975.1|  Ketose-bisphosphate aldolase, class-II:Fru...  99.8    2e-19 
ref|YP_001696994.1|  tagatose-1,6-bisphosphate aldolase agaY [...  99.0    3e-19  Gene info
ref|YP_001127415.1|  fructose-bisphosphate aldolase [Geobacill...  99.0    3e-19  Gene info
ref|NP_765278.1|  fructose-bisphosphate aldolase [Staphylococc...  99.0    4e-19  Gene info
ref|NP_957657.1|  putative class II fructose-1,6-bisphosphate ...  98.6    4e-19  Gene info
ref|YP_001391318.1|  tagatose-bisphosphate aldolase [Clostridi...  98.6    5e-19  Gene info
gb|AAL91129.1|  fructose-bisphosphate aldolase [Mycoplasma gal...  97.8    7e-19 
ref|NP_072683.1|  fructose-1,6-bisphosphate aldolase, class II...  97.8    8e-19  Gene info
ref|NP_853443.1|  hypothetical protein MGA_0498 [Mycoplasma ga...  97.4    1e-18  Gene info
ref|AP_002694.1|  D-tagatose 1,6-bisphosphate aldolase 2, cata...  97.1    1e-18 
ref|ZP_02949887.1|  class II aldolase, tagatose bisphosphate f...  97.1    1e-18 
ref|NP_109713.1|  fructose-bisphosphate aldolase [Mycoplasma p...  97.1    1e-18  Gene info
ref|ZP_02950627.1|  class II aldolase, tagatose bisphosphate f...  97.1    1e-18 
ref|NP_837708.1|  tagatose-bisphosphate aldolase [Shigella fle...  97.1    1e-18  Gene info
pir||G64976  tagatose-bisphosphate aldolase gaty (EC 4.1.2.-) ...  97.1    1e-18 
ref|ZP_03068278.1|  class II aldolase, tagatose bisphosphate f...  97.1    2e-18 
ref|YP_001718294.1|  fructose-1,6-bisphosphate aldolase, class...  96.7    2e-18  Gene info
ref|ZP_03002465.1|  class II aldolase, tagatose bisphosphate f...  96.7    2e-18 
ref|ZP_03029828.1|  class II aldolase, tagatose bisphosphate f...  96.3    2e-18 
ref|YP_001463444.1|  tagatose-bisphosphate aldolase [Escherich...  96.3    2e-18  Gene info
gb|ABF04273.1|  tagatose-bisphosphate aldolase 1 [Shigella fle...  96.3    2e-18  Gene info
ref|YP_001743047.1|  tagatose bisphosphate family class II ald...  96.3    2e-18  Gene info
ref|YP_689578.2|  tagatose-bisphosphate aldolase [Shigella fle...  96.3    3e-18  Gene info
ref|YP_424127.1|  fructose-1,6-bisphosphate aldolase, class II...  96.3    3e-18  Gene info
ref|ZP_03050214.1|  class II aldolase, tagatose bisphosphate f...  95.9    3e-18 
ref|ZP_02847777.1|  fructose-1,6-bisphosphate aldolase, class ...  95.9    3e-18 
ref|ZP_03043980.1|  class II aldolase, tagatose bisphosphate f...  95.5    4e-18 
gb|EEA92510.1|  fructose-bisphosphate aldolase class II [Pseud...  95.5    4e-18 
ref|YP_001879789.1|  class II aldolase, tagatose bisphosphate ...  95.5    4e-18  Gene info
ref|YP_002293640.1|  tagatose-bisphosphate aldolase [Escherich...  95.5    4e-18  Gene info
ref|NP_310926.2|  tagatose-bisphosphate aldolase [Escherichia ...  95.5    4e-18  Gene info
ref|ZP_01860914.1|  fructose-bisphosphate aldolase [Bacillus s...  95.5    4e-18 
gb|ABB65582.1|  tagatose-bisphosphate aldolase 1 [Shigella boy...  95.5    4e-18  Gene info
ref|YP_407410.2|  tagatose-bisphosphate aldolase [Shigella boy...  95.5    4e-18  Gene info
dbj|BAB36322.1|  tagatose-bisphosphate aldolase 1 [Escherichia...  95.5    4e-18  Gene info
ref|NP_754509.2|  tagatose-bisphosphate aldolase [Escherichia ...  95.5    4e-18  Gene info
gb|ABB62346.1|  tagatose-bisphosphate aldolase 1 [Shigella dys...  95.5    4e-18  Gene info
gb|AAN81077.1|AE016763_36  Tagatose-bisphosphate aldolase gatY...  95.5    5e-18  Gene info
ref|NP_372649.1|  fructose-bisphosphate aldolase [Staphylococc...  95.1    5e-18  Gene info
ref|YP_403837.2|  tagatose-bisphosphate aldolase [Shigella dys...  95.1    5e-18  Gene info
ref|YP_001114503.1|  putative aldolase [Desulfotomaculum reduc...  94.7    6e-18  Gene info
ref|YP_001696724.1|  fructose-bisphosphate aldolase [Lysinibac...  94.7    8e-18  Gene info
ref|ZP_03031625.1|  class II aldolase, tagatose bisphosphate f...  94.4    8e-18 
ref|YP_670034.1|  tagatose-bisphosphate aldolase [Escherichia ...  94.4    9e-18  Gene info
emb|CAA56226.1|  gatY [Escherichia coli] >prf||2113201A carboh...  94.4    9e-18 
ref|ZP_03063765.1|  class II aldolase, tagatose bisphosphate f...  94.4    1e-17 
ref|YP_001377038.1|  fructose-bisphosphate aldolase [Bacillus ...  94.4    1e-17  Gene info
ref|ZP_01724743.1|  fructose-bisphosphate aldolase [Bacillus s...  94.4    1e-17 
ref|NP_975144.1|  fructose-bisphosphate aldolase class II [Myc...  94.0    1e-17  Gene info
ref|YP_001666074.1|  putative aldolase [Thermoanaerobacter pse...  94.0    1e-17  Gene info
ref|YP_311033.2|  tagatose-bisphosphate aldolase [Shigella son...  94.0    1e-17  Gene info
gb|AAZ88798.1|  tagatose-bisphosphate aldolase 1 [Shigella son...  93.6    1e-17  Gene info
gb|AAG57153.1|AE005435_11  tagatose-bisphosphate aldolase 1 [E...  93.2    2e-17  Gene info
ref|ZP_02663016.1|  class II aldolase, tagatose bisphosphate f...  93.2    2e-17 
ref|NP_288598.2|  tagatose-bisphosphate aldolase [Escherichia ...  93.2    2e-17  Gene info
ref|ZP_02169385.1|  Fructose-bisphosphate aldolase [Bacillus s...  92.8    2e-17 
ref|NP_268066.1|  fructose-bisphosphate aldolase [Lactococcus ...  92.8    2e-17  Gene info
ref|ZP_02090297.1|  hypothetical protein FAEPRAM212_00536 [Fae...  92.8    3e-17 
ref|YP_177062.1|  fructose-bisphosphate aldolase [Bacillus cla...  92.8    3e-17  Gene info
ref|ZP_00827943.1|  COG0191: Fructose/tagatose bisphosphate al...  92.8    3e-17 
ref|YP_300849.1|  fructose-bisphosphate aldolase [Staphylococc...  92.4    3e-17  Gene info
ref|YP_811752.1|  fructose-bisphosphate aldolase [Lactococcus ...  92.4    3e-17  Gene info
ref|YP_853216.1|  tagatose-bisphosphate aldolase [Escherichia ...  92.4    4e-17  Gene info
gb|ABE07837.1|  tagatose-bisphosphate aldolase GatY [Escherich...  92.4    4e-17  Gene info
ref|NP_687163.1|  fructose-bisphosphate aldolase [Streptococcu...  92.0    4e-17  Gene info
ref|ZP_00783295.1|  fructose-1,6-bisphosphate aldolase, class ...  92.0    5e-17 
ref|YP_001922254.1|  class II aldolase, tagatose bisphosphate ...  92.0    5e-17  Gene info
ref|ZP_02026464.1|  hypothetical protein EUBVEN_01724 [Eubacte...  92.0    5e-17 
ref|ZP_02695612.2|  fructose-1,6-bisphosphate aldolase, class ...  92.0    5e-17 
ref|YP_002148183.1|  class II aldolase, tagatose bisphosphate ...  92.0    5e-17  Gene info
ref|YP_002047288.1|  class II aldolase, tagatose bisphosphate ...  91.7    5e-17  Gene info
ref|ZP_02831673.2|  class II aldolase, tagatose bisphosphate f...  91.7    5e-17 
ref|YP_002042516.1|  class II aldolase, tagatose bisphosphate ...  91.7    5e-17  Gene info
ref|ZP_02656923.1|  class II aldolase, tagatose bisphosphate f...  91.7    6e-17 
ref|YP_218184.1|  tagatose-bisphosphate aldolase [Salmonella e...  91.7    6e-17  Gene info
ref|NP_078435.1|  fructose-bisphosphate aldolase [Ureaplasma p...  91.7    6e-17  Gene info
ref|ZP_03292747.1|  hypothetical protein CLOHIR_00692 [Clostri...  91.3    8e-17 
ref|ZP_02211750.1|  hypothetical protein CLOBAR_01364 [Clostri...  90.9    9e-17 
ref|NP_621837.1|  putative aldolase [Thermoanaerobacter tengco...  90.9    1e-16  Gene info
ref|YP_359000.1|  putative aldolase [Carboxydothermus hydrogen...  90.9    1e-16  Gene info
ref|ZP_03305242.1|  hypothetical protein ANHYDRO_01680 [Anaero...  90.9    1e-16 
ref|YP_755071.1|  putative aldolase [Syntrophomonas wolfei sub...  90.5    1e-16  Gene info
ref|YP_142227.1|  fructose-bisphosphate aldolase [Streptococcu...  90.1    2e-16  Gene info
ref|YP_140313.1|  fructose-bisphosphate aldolase [Streptococcu...  90.1    2e-16  Gene info
ref|YP_001887313.1|  class II aldolase, tagatose bisphosphate ...  90.1    2e-16  Gene info
gb|AAL35376.1|AF442550_1  fructose-1,6-phosphate aldolase [Str...  90.1    2e-16 
ref|YP_821189.1|  fructose-bisphosphate aldolase [Streptococcu...  89.7    2e-16  Gene info
ref|NP_693927.1|  fructose-bisphosphate aldolase [Oceanobacill...  89.7    2e-16  Gene info
ref|YP_001512274.1|  fructose-1,6-bisphosphate aldolase, class...  89.7    2e-16  Gene info
ref|ZP_02919229.1|  hypothetical protein STRINF_00057 [Strepto...  89.7    2e-16 
ref|YP_001692591.1|  fructose-bisphosphate aldolase [Finegoldi...  89.7    2e-16  Gene info
ref|ZP_03052844.1|  tagatose-1,6-bisphosphate aldolase gaty (t...  89.4    3e-16 
ref|ZP_02085216.1|  hypothetical protein CLOBOL_02749 [Clostri...  89.4    3e-16 
ref|NP_347463.1|  fructose-bisphosphate aldolase [Clostridium ...  89.4    3e-16  Gene info
ref|ZP_03313478.1|  hypothetical protein PROVRUST_00240 [Provi...  89.4    3e-16 
ref|ZP_02632443.1|  class II aldolase, tagatose bisphosphate f...  89.4    3e-16 
gb|ABH04817.1|  fructose-1,6-bisphosphate aldolase [Heliobacil...  89.4    3e-16 
ref|ZP_00785903.1|  fructose-1,6-bisphosphate aldolase, class ...  89.4    3e-16 
ref|YP_176690.1|  fructose-bisphosphate aldolase [Bacillus cla...  89.4    3e-16  Gene info
ref|ZP_02330018.1|  putative aldolase [Paenibacillus larvae su...  89.0    4e-16 
ref|YP_053884.1|  fructose-biphosphate aldolase [Mesoplasma fl...  88.6    4e-16  Gene info
ref|NP_758415.1|  fructose-bisphosphate aldolase [Mycoplasma p...  88.6    5e-16  Gene info
ref|ZP_02040859.1|  hypothetical protein RUMGNA_01624 [Ruminoc...  88.6    5e-16 
ref|ZP_03042223.1|  fructose-1,6-bisphosphate aldolase, class ...  88.2    6e-16 
ref|NP_847736.1|  fructose-bisphosphate aldolase [Bacillus ant...  88.2    6e-16  Gene info
ref|NP_834997.1|  fructose-bisphosphate aldolase [Bacillus cer...  88.2    6e-16  Gene info
ref|YP_001560769.1|  fructose-1,6-bisphosphate aldolase, class...  88.2    7e-16  Gene info
ref|ZP_02643645.1|  putative tagatose-1,6-bisphosphate aldolas...  88.2    7e-16 
ref|ZP_02637213.1|  putative tagatose-1,6-bisphosphate aldolas...  88.2    7e-16 
ref|NP_928182.1|  tagatose-bisphosphate aldolase [Photorhabdus...  88.2    7e-16  Gene info
ref|YP_699880.1|  tagatose-bisphosphate aldolase [Clostridium ...  88.2    7e-16  Gene info
ref|ZP_02640437.1|  putative tagatose-1,6-bisphosphate aldolas...  88.2    7e-16 
ref|YP_001451016.1|  fructose-bisphosphate aldolase [Streptoco...  88.2    7e-16  Gene info
ref|ZP_02954168.1|  putative tagatose-1,6-bisphosphate aldolas...  87.8    7e-16 
ref|NP_563542.1|  tagatose-bisphosphate aldolase [Clostridium ...  87.8    8e-16  Gene info
ref|ZP_02633904.1|  putative tagatose-1,6-bisphosphate aldolas...  87.8    8e-16 
gb|AAL60165.1|AF416702_3  GatY [Klebsiella oxytoca]                87.8    8e-16 
ref|YP_001486999.1|  fructose-bisphosphate aldolase [Bacillus ...  87.8    9e-16  Gene info
ref|ZP_01968989.1|  hypothetical protein RUMTOR_02572 [Ruminoc...  87.8    9e-16 
ref|ZP_01697855.1|  fructose-1,6-bisphosphate aldolase, class ...  87.4    1e-15 
ref|ZP_02080760.1|  hypothetical protein CLOLEP_02217 [Clostri...  87.4    1e-15 
ref|ZP_01832149.1|  fructose-1,6-bisphosphate aldolase, class ...  87.4    1e-15 
gb|ABM17098.1|  putative fructose-1,6-bisphosphate aldolase cl...  87.4    1e-15 
ref|NP_345117.1|  fructose-bisphosphate aldolase [Streptococcu...  87.4    1e-15  Gene info
ref|YP_001337205.1|  tagatose-bisphosphate aldolase [Klebsiell...  87.4    1e-15  Gene info
ref|ZP_00231624.1|  fructose-bisphosphate aldolase, putative [...  87.4    1e-15 
ref|NP_244653.1|  fructose-1,6-bisphosphate aldolase [Bacillus...  87.0    1e-15  Gene info
ref|ZP_02438046.1|  hypothetical protein CLOSS21_00484 [Clostr...  87.0    1e-15 
ref|ZP_01965379.1|  hypothetical protein RUMOBE_03118 [Ruminoc...  87.0    1e-15 
ref|ZP_01168484.1|  fructose-bisphosphate aldolase [Bacillus s...  87.0    1e-15 
ref|NP_466079.1|  hypothetical protein lmo2556 [Listeria monoc...  87.0    1e-15  Gene info
ref|YP_086604.1|  fructose-bisphosphate aldolase [Bacillus cer...  87.0    2e-15  Gene info
ref|ZP_00831930.1|  COG0191: Fructose/tagatose bisphosphate al...  87.0    2e-15 
ref|ZP_02587207.1|  fructose-bisphosphate aldolase [Bacillus c...  87.0    2e-15 
ref|YP_177375.1|  fructose-bisphosphate aldolase [Bacillus cla...  86.7    2e-15  Gene info
ref|ZP_02421778.1|  hypothetical protein EUBSIR_00609 [Eubacte...  86.7    2e-15 
ref|YP_001456027.1|  tagatose-bisphosphate aldolase [Citrobact...  86.7    2e-15  Gene info
ref|YP_001815196.1|  fructose-1,6-bisphosphate aldolase, class...  86.3    2e-15  Gene info
ref|YP_001986485.1|  Fructose-bisphosphate aldolase [Lactobaci...  86.3    2e-15  Gene info
ref|YP_805730.1|  fructose/tagatose bisphosphate aldolase [Lac...  86.3    2e-15  Gene info
emb|CAA09925.1|  fructose-bisphosphate aldolase [Streptococcus...  86.3    2e-15 
ref|YP_075074.1|  fructose-bisphosphate aldolase [Symbiobacter...  86.3    3e-15  Gene info
ref|ZP_03210498.1|  Fructose/tagatose bisphosphate aldolase [L...  86.3    3e-15 
ref|ZP_03297447.1|  hypothetical protein COLSTE_01349 [Collins...  86.3    3e-15 
ref|ZP_02419399.1|  hypothetical protein ANACAC_01986 [Anaeros...  85.9    3e-15 
emb|CAA09923.1|  fructose-bisphosphate aldolase class-II [Stre...  85.9    3e-15 
ref|NP_457638.1|  tagatose-bisphosphate aldolase [Salmonella e...  85.9    3e-15  Gene info
ref|YP_001561966.1|  fructose-bisphosphate aldolase, class II ...  85.9    3e-15  Gene info
gb|AAC44684.1|  putative aldolase [Vibrio furnissii]               85.9    3e-15 
ref|NP_472030.1|  hypothetical protein lin2701 [Listeria innoc...  85.5    4e-15  Gene info
ref|YP_083236.1|  tagatose-bisphosphate aldolase [Bacillus cer...  85.5    4e-15  Gene info
ref|ZP_01771514.1|  Hypothetical protein COLAER_00501 [Collins...  85.5    5e-15 
ref|YP_001590223.1|  tagatose-bisphosphate aldolase [Salmonell...  85.5    5e-15  Gene info
ref|NP_978222.1|  tagatose-bisphosphate aldolase [Bacillus cer...  85.1    5e-15  Gene info
gb|AAF81089.1|AF228498_9  KbaY [Escherichia coli]                  85.1    5e-15 
ref|YP_001745414.1|  tagatose-1,6-bisphosphate aldolase agaY [...  85.1    5e-15  Gene info
ref|ZP_02234251.1|  hypothetical protein DORFOR_01112 [Dorea f...  85.1    6e-15 
ref|ZP_01994104.1|  hypothetical protein DORLON_00078 [Dorea l...  85.1    6e-15 
ref|ZP_01966855.1|  hypothetical protein RUMTOR_00396 [Ruminoc...  85.1    6e-15 
ref|ZP_02326990.1|  tagatose-bisphosphate aldolase [Paenibacil...  84.7    7e-15 
ref|ZP_01771907.1|  Hypothetical protein COLAER_00897 [Collins...  84.7    7e-15 
ref|ZP_03124581.1|  tagatose-bisphosphate aldolase [Clostridiu...  84.7    7e-15 
emb|CAA09927.1|  fructose-bisphosphate aldolase class-II [Stre...  84.7    7e-15 
ref|YP_001573282.1|  tagatose-bisphosphate aldolase [Salmonell...  84.7    7e-15  Gene info
ref|ZP_03065981.1|  tagatose-1,6-bisphosphate aldolase agaY [S...  84.3    8e-15 
ref|ZP_02432103.1|  hypothetical protein CLOSCI_02348 [Clostri...  84.3    9e-15 
ref|ZP_03284660.1|  hypothetical protein ENTCAN_04494 [Enterob...  84.3    9e-15 
ref|NP_289710.1|  tagatose-bisphosphate aldolase [Escherichia ...  84.3    9e-15  Gene info
ref|YP_001089968.1|  tagatose-bisphosphate aldolase [Clostridi...  84.3    1e-14  Gene info
ref|YP_278819.1|  fructose-bisphosphate aldolase [Mycoplasma h...  84.3    1e-14  Gene info
ref|ZP_01158549.1|  tagatose 1,6-diphosphate aldolase [Photoba...  84.3    1e-14 
ref|YP_001567700.1|  fructose-1,6-bisphosphate aldolase, class...  84.3    1e-14  Gene info
ref|YP_080645.1|  tagatose-bisphosphate aldolase [Bacillus lic...  84.3    1e-14  Gene info
ref|ZP_01801612.1|  hypothetical protein CdifQ_04003979 [Clost...  84.3    1e-14 
ref|ZP_03073639.1|  fructose-1,6-bisphosphate aldolase, class ...  84.3    1e-14 
ref|ZP_02990226.1|  fructose-1,6-bisphosphate aldolase, class ...  84.3    1e-14 
emb|CAR67365.1|  tagatose-bisphosphate aldolase gaty (ec 4.1.2...  84.0    1e-14 
ref|ZP_03116704.1|  tagatose-bisphosphate aldolase [Clostridiu...  84.0    1e-14 
ref|ZP_03167688.1|  hypothetical protein RUMLAC_01363 [Ruminoc...  84.0    1e-14 
ref|ZP_00831309.1|  COG0191: Fructose/tagatose bisphosphate al...  84.0    1e-14 
ref|ZP_02900807.1|  tagatose-1,6-bisphosphate aldolase agaY [E...  84.0    1e-14 
gb|ABF15090.1|  ketose-bisphosphate aldolase [Lactobacillus re...  84.0    1e-14 
ref|YP_001270845.1|  fructose-bisphosphate aldolase [Lactobaci...  84.0    1e-14  Gene info
ref|YP_001799098.1|  Fructose-bisphosphate aldolase class II [...  84.0    1e-14  Gene info
ref|YP_115529.1|  fructose-bisphosphate aldolase [Mycoplasma h...  83.6    1e-14  Gene info
ref|ZP_02870466.1|  fructose-bisphosphate aldolase [candidate ...  83.6    1e-14 
ref|YP_002151864.1|  tagatose-1,6-bisphosphate aldolase [Prote...  83.6    1e-14  Gene info
ref|YP_431229.1|  putative aldolase [Moorella thermoacetica AT...  83.6    2e-14  Gene info
ref|ZP_01063137.1|  tagatose 1,6-diphosphate aldolase [Vibrio ...  83.6    2e-14 
ref|ZP_02441146.1|  hypothetical protein ANACOL_00416 [Anaerot...  83.6    2e-14 
ref|NP_814897.1|  fructose-bisphosphate aldolase [Enterococcus...  83.6    2e-14  Gene info
ref|YP_001647907.1|  fructose-bisphosphate aldolase [Bacillus ...  83.6    2e-14  Gene info
ref|ZP_02432108.1|  hypothetical protein CLOSCI_02353 [Clostri...  83.6    2e-14 
ref|ZP_02418435.1|  hypothetical protein ANACAC_01017 [Anaeros...  83.6    2e-14 
gb|AAG00613.1|AF293701_1  fructose-bisphosphate aldolase [Cocc...  83.6    2e-14 
ref|YP_001213388.1|  putative aldolase [Pelotomaculum thermopr...  83.6    2e-14  Gene info
ref|YP_001422988.1|  fructose-bisphosphate aldolase [Bacillus ...  83.6    2e-14  Gene info
ref|ZP_02078884.1|  hypothetical protein CLOLEP_00321 [Clostri...  83.6    2e-14 
ref|ZP_02421171.1|  hypothetical protein ANACAC_03825 [Anaeros...  83.6    2e-14 
ref|YP_081037.1|  fructose-bisphosphate aldolase [Bacillus lic...  83.2    2e-14  Gene info
ref|NP_349554.1|  tagatose-bisphosphate aldolase [Clostridium ...  83.2    2e-14  Gene info
ref|YP_001309030.1|  fructose-1,6-bisphosphate aldolase, class...  83.2    2e-14  Gene info
dbj|BAF63935.1|  fructose-bisphosphate aldolase [Bacillus sp. ...  83.2    2e-14 
ref|YP_152263.1|  tagatose-bisphosphate aldolase [Salmonella e...  83.2    2e-14  Gene info
ref|ZP_01915956.1|  fructose-bisphosphate aldolase [Limnobacte...  82.8    3e-14 
ref|ZP_03288984.1|  hypothetical protein CLONEX_01175 [Clostri...  82.8    3e-14 
ref|NP_562266.1|  fructose-1,6-bisphosphate aldolase, class II...  82.8    3e-14  Gene info
ref|ZP_02418258.1|  hypothetical protein ANACAC_00827 [Anaeros...  82.8    3e-14 
ref|ZP_01234301.1|  tagatose 1,6-diphosphate aldolase [Vibrio ...  82.8    3e-14 
ref|ZP_02419624.1|  hypothetical protein ANACAC_02218 [Anaeros...  82.4    3e-14 
ref|ZP_03297342.1|  hypothetical protein COLSTE_01237 [Collins...  82.4    3e-14 
ref|ZP_02621880.1|  class II aldolase, tagatose bisphosphate f...  82.4    4e-14 
ref|YP_878788.1|  tagatose bisphosphate family class II aldola...  82.4    4e-14  Gene info
ref|YP_001178287.1|  tagatose-bisphosphate aldolase [Enterobac...  82.4    4e-14  Gene info
ref|YP_287414.1|  fructose-bisphosphate aldolase [Mycoplasma h...  82.0    4e-14  Gene info
ref|YP_605546.1|  fructose-1,6-bisphosphate aldolase, class II...  82.0    4e-14  Gene info
ref|ZP_02868384.1|  hypothetical protein CLOSPI_02226 [Clostri...  82.0    4e-14 
ref|NP_762935.1|  tagatose-bisphosphate aldolase [Vibrio vulni...  82.0    5e-14  Gene info
ref|ZP_02076813.1|  hypothetical protein EUBDOL_00606 [Eubacte...  82.0    5e-14 
ref|NP_391593.1|  fructose-bisphosphate aldolase [Bacillus sub...  82.0    5e-14  Gene info
ref|YP_001410271.1|  fructose-1,6-bisphosphate aldolase, class...  81.6    5e-14  Gene info
ref|YP_619357.1|  fructose-bisphosphate aldolase [Lactobacillu...  81.6    6e-14  Gene info
ref|NP_469723.1|  hypothetical protein lin0378 [Listeria innoc...  81.6    6e-14  Gene info
ref|YP_012987.1|  hypothetical protein LMOf2365_0379 [Listeria...  81.6    6e-14  Gene info
ref|ZP_00604671.1|  Ketose-bisphosphate aldolase, class-II [En...  81.6    6e-14 
dbj|BAB16889.1|  class-II aldolase [Streptococcus bovis]           81.3    7e-14 
ref|ZP_03326371.1|  ketose-bisphosphate aldolase [Anaerocellum...  81.3    8e-14 
ref|ZP_02007486.1|  fructose-bisphosphate aldolase, class II, ...  81.3    8e-14 
ref|YP_850349.1|  hypothetical protein lwe2152 [Listeria welsh...  81.3    8e-14  Gene info
ref|YP_002240137.1|  putative fructose-1,6-bisphosphate aldola...  81.3    8e-14  Gene info
ref|YP_848517.1|  hypothetical protein lwe0316 [Listeria welsh...  81.3    8e-14  Gene info
ref|ZP_02438184.1|  hypothetical protein CLOSS21_00624 [Clostr...  81.3    8e-14 
ref|YP_001086869.1|  putative fructose-bisphosphate aldolase [...  81.3    9e-14  Gene info
ref|YP_658423.1|  fructose/tagatose-1,6-bisphosphate aldolase ...  81.3    9e-14  Gene info
ref|ZP_01805311.1|  hypothetical protein CdifQ_04000425 [Clost...  80.9    9e-14 
ref|ZP_02078581.1|  hypothetical protein CLOLEP_00016 [Clostri...  80.9    9e-14 
ref|YP_001898080.1|  fructose-bisphosphate aldolase, class II,...  80.9    9e-14  Gene info
ref|ZP_02439706.1|  hypothetical protein CLOSS21_02186 [Clostr...  80.9    9e-14 
ref|YP_972887.1|  fructose-bisphosphate aldolase [Acidovorax a...  80.9    1e-13  Gene info
ref|YP_001321454.1|  fructose-1,6-bisphosphate aldolase, class...  80.5    1e-13  Gene info
ref|YP_429482.1|  fructose-bisphosphate aldolase [Moorella the...  80.5    1e-13  Gene info
ref|ZP_00229598.1|  fructose-bisphosphate aldolase, class II f...  80.5    1e-13 
ref|ZP_02326696.1|  hypothetical protein Plarl_03455 [Paenibac...  80.5    1e-13 
ref|YP_132715.1|  tagatose-bisphosphate aldolase [Photobacteri...  80.5    1e-13  Gene info
ref|YP_001488569.1|  fructose-bisphosphate aldolase [Bacillus ...  80.1    2e-13  Gene info
ref|ZP_03054982.1|  fructose-1,6-bisphosphate aldolase, class ...  80.1    2e-13 
ref|ZP_00943130.1|  Fructose-bisphosphate aldolase [Ralstonia ...  80.1    2e-13 
ref|ZP_01543908.1|  fructose-bisphosphate aldolase [Oenococcus...  80.1    2e-13 
ref|NP_391846.1|  fructose-1,6-bisphosphate aldolase [Bacillus...  80.1    2e-13  Gene info
ref|YP_002124059.1|  fructose-bisphosphate aldolase Fba [Strep...  80.1    2e-13  Gene info
ref|ZP_02439624.1|  hypothetical protein CLOSS21_02090 [Clostr...  80.1    2e-13 
ref|YP_001334031.1|  putative fructose-1,6-bisphosphate aldola...  80.1    2e-13  Gene info
ref|NP_518694.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  80.1    2e-13  Gene info
ref|YP_071593.1|  tagatose-bisphosphate aldolase [Yersinia pse...  79.7    2e-13  Gene info
ref|YP_014758.1|  hypothetical protein LMOf2365_2167 [Listeria...  79.7    2e-13  Gene info
ref|ZP_02074301.1|  hypothetical protein CLOL250_01067 [Clostr...  79.7    2e-13 
ref|NP_665434.1|  fructose-bisphosphate aldolase [Streptococcu...  79.7    2e-13  Gene info
ref|YP_001199888.1|  fructose-bisphosphate aldolase [Streptoco...  79.7    2e-13  Gene info
ref|YP_597341.1|  fructose-bisphosphate aldolase [Streptococcu...  79.7    2e-13  Gene info
ref|ZP_02958576.2|  hypothetical protein PROSTU_00323 [Provide...  79.7    2e-13 
ref|YP_060934.1|  fructose-bisphosphate aldolase [Streptococcu...  79.7    2e-13  Gene info
ref|NP_269879.1|  fructose-bisphosphate aldolase [Streptococcu...  79.7    2e-13  Gene info
ref|ZP_01866032.1|  fructose-1,6-bisphosphate aldolase, class ...  79.7    2e-13 
ref|YP_535299.1|  fructose-bisphosphate aldolase [Lactobacillu...  79.7    3e-13  Gene info
ref|ZP_01220270.1|  tagatose 1,6-diphosphate aldolase [Photoba...  79.3    3e-13 
ref|ZP_03294218.1|  hypothetical protein CLOHIR_02174 [Clostri...  79.3    3e-13 
ref|NP_471571.1|  hypothetical protein lin2238 [Listeria innoc...  79.3    3e-13  Gene info
ref|ZP_01994409.1|  hypothetical protein DORLON_00394 [Dorea l...  79.3    3e-13 
ref|YP_001423229.1|  hypothetical protein RBAM_036690 [Bacillu...  79.3    3e-13  Gene info
ref|ZP_02861571.1|  hypothetical protein ANASTE_00777 [Anaerof...  79.3    3e-13 
ref|ZP_03311864.1|  hypothetical protein DESPIG_01784 [Desulfo...  79.3    3e-13 
ref|ZP_01520073.1|  fructose-bisphosphate aldolase, class II, ...  79.3    3e-13 
ref|ZP_02419375.1|  hypothetical protein ANACAC_01962 [Anaeros...  79.3    3e-13 
emb|CAA09924.1|  fructose-bisphosphate aldolase [Streptococcus...  79.3    3e-13 
ref|NP_463889.1|  hypothetical protein lmo0359 [Listeria monoc...  79.3    3e-13  Gene info
ref|NP_465657.1|  hypothetical protein lmo2133 [Listeria monoc...  79.0    3e-13  Gene info
ref|NP_964539.1|  fructose-bisphosphate aldolase [Lactobacillu...  79.0    3e-13  Gene info
ref|YP_173948.1|  hypothetical protein ABC0445 [Bacillus claus...  79.0    3e-13  Gene info
ref|YP_001256222.1|  fructose-bisphosphate aldolase (Fba) [Myc...  79.0    4e-13  Gene info
ref|YP_001621362.1|  ketose bisphosphate aldolase, class-II [A...  79.0    4e-13  Gene info
ref|NP_295312.1|  fructose-bisphosphate aldolase [Deinococcus ...  79.0    4e-13  Gene info
ref|YP_001179983.1|  fructose-1,6-bisphosphate aldolase, class...  79.0    4e-13  Gene info
ref|NP_404465.1|  tagatose-bisphosphate aldolase [Yersinia pes...  79.0    4e-13  Gene info
ref|ZP_02643804.1|  putative fructose-bisphosphate aldolase, c...  79.0    4e-13 
ref|ZP_02440727.1|  hypothetical protein CLOSS21_03233 [Clostr...  79.0    4e-13 
ref|YP_001036780.1|  fructose-bisphosphate aldolase [Clostridi...  78.6    4e-13  Gene info
ref|NP_243180.1|  fructose bisphosphate aldolase [Bacillus hal...  78.6    5e-13  Gene info
ref|ZP_02036387.1|  hypothetical protein BACCAP_01989 [Bactero...  78.6    5e-13 
ref|YP_001881945.1|  tagatose-1,6-bisphosphate aldolase GatY [...  78.6    5e-13  Gene info
ref|YP_173931.1|  fructose-bisphosphate aldolase [Bacillus cla...  78.2    6e-13  Gene info
ref|ZP_02633730.1|  putative fructose-bisphosphate aldolase, c...  78.2    6e-13 
ref|YP_157606.1|  fructose-1,6-bisphosphate aldolase [Azoarcus...  78.2    7e-13  Gene info
ref|ZP_02419491.1|  hypothetical protein ANACAC_02083 [Anaeros...  78.2    7e-13 
ref|ZP_02863303.1|  putative fructose-bisphosphate aldolase, c...  78.2    7e-13 
ref|NP_756345.1|  hypothetical protein c4483 [Escherichia coli...  77.8    8e-13  Gene info
ref|YP_001951192.1|  fructose-1,6-bisphosphate aldolase, class...  77.8    9e-13  Gene info
ref|ZP_02080407.1|  hypothetical protein CLOLEP_01860 [Clostri...  77.4    1e-12 
ref|YP_725085.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  77.4    1e-12  Gene info
ref|YP_542670.1|  tagatose-bisphosphate aldolase [Escherichia ...  77.4    1e-12  Gene info
ref|NP_755884.1|  tagatose-bisphosphate aldolase [Escherichia ...  77.4    1e-12  Gene info
ref|YP_911784.1|  fructose-bisphosphate aldolase [Chlorobium p...  77.4    1e-12  Gene info
ref|NP_561002.1|  fructose-bisphosphate aldolase [Clostridium ...  77.4    1e-12  Gene info
ref|ZP_02426946.1|  hypothetical protein CLORAM_00323 [Clostri...  77.4    1e-12 
ref|YP_176999.1|  fructose-bisphosphate aldolase [Bacillus cla...  77.4    1e-12  Gene info
ref|YP_814303.1|  fructose/tagatose bisphosphate aldolase [Lac...  77.4    1e-12  Gene info
ref|YP_855348.1|  tagatose bisphosphate family class II aldola...  77.4    1e-12  Gene info
ref|XP_001119873.1|  PREDICTED: hypothetical protein, partial ...  77.4    1e-12  UniGene infoGene info
ref|YP_694545.1|  fructose-bisphosphate aldolase [Clostridium ...  77.4    1e-12  Gene info
ref|YP_357662.1|  fructose-bisphosphate aldolase [Pelobacter c...  77.4    1e-12  Gene info
ref|YP_278477.1|  fructose-bisphosphate aldolase [Mycoplasma s...  77.4    1e-12  Gene info
ref|ZP_03295807.1|  hypothetical protein COLINT_01520 [Collins...  77.0    1e-12 
ref|ZP_01313928.1|  fructose-1,6-bisphosphate aldolase, class ...  77.0    1e-12 
ref|YP_131830.2|  tagatose-bisphosphate aldolase [Photobacteri...  77.0    1e-12  Gene info
gb|EEA96560.1|  fructose-1,6-bisphosphate aldolase, class II [...  77.0    1e-12 
ref|ZP_03296425.1|  hypothetical protein COLSTE_00309 [Collins...  77.0    1e-12 
ref|YP_015823.1|  fructose-bisphosphate aldolase [Mycoplasma m...  77.0    1e-12  Gene info
ref|ZP_03327892.1|  fructose-1,6-bisphosphate aldolase, class ...  77.0    2e-12 
gb|ABG56068.1|  fructose bisphosphate aldolase [Monocercomonoi...  77.0    2e-12 
emb|CAG22030.1|  putative aldolase [Photobacterium profundum SS9]  77.0    2e-12  Gene info
ref|YP_374926.1|  fructose-bisphosphate aldolase [Pelodictyon ...  76.6    2e-12  Gene info
ref|NP_784142.1|  fructose-bisphosphate aldolase [Lactobacillu...  76.6    2e-12  Gene info
ref|ZP_02953733.1|  putative fructose-bisphosphate aldolase, c...  76.6    2e-12 
gb|AAL23716.1|  putative fructose-1,6-bisphosphate aldolase [E...  76.6    2e-12 
ref|ZP_02076880.1|  hypothetical protein EUBDOL_00673 [Eubacte...  76.6    2e-12 
ref|XP_650373.1|  fructose-1,6-bisphosphate aldolase [Entamoeb...  76.6    2e-12  Gene info
ref|YP_409572.1|  tagatose-bisphosphate aldolase [Shigella boy...  76.6    2e-12  Gene info
emb|CAA09926.1|  fructose-bisphosphate aldolase [Streptococcus...  76.6    2e-12 
ref|ZP_02861829.1|  hypothetical protein ANASTE_01039 [Anaerof...  76.6    2e-12 
ref|ZP_01576371.1|  ketose-bisphosphate aldolases [Clostridium...  76.6    2e-12 
ref|YP_001478808.1|  tagatose-bisphosphate aldolase [Serratia ...  76.6    2e-12  Gene info
ref|ZP_02206414.1|  hypothetical protein COPEUT_01183 [Coproco...  76.3    2e-12 
ref|ZP_03110677.1|  fructose-bisphosphate aldolase, class II [...  76.3    2e-12 
ref|YP_048464.1|  hypothetical protein ECA0338 [Pectobacterium...  76.3    2e-12  Gene info
ref|NP_720575.1|  fructose-bisphosphate aldolase [Streptococcu...  76.3    2e-12  Gene info
ref|ZP_02259592.1|  fructose-bisphosphate aldolase [Bacillus c...  76.3    3e-12 
ref|ZP_03101276.1|  fructose-bisphosphate aldolase, class II [...  76.3    3e-12 
ref|YP_543162.1|  hypothetical protein UTI89_C4203 [Escherichi...  76.3    3e-12  Gene info
ref|YP_001745958.1|  fructose-bisphosphate aldolase, class II ...  76.3    3e-12  Gene info
ref|YP_001306506.1|  fructose-1,6-bisphosphate aldolase, class...  76.3    3e-12  Gene info
ref|ZP_01387029.1|  ketose-bisphosphate aldolases:fructose-1,6...  76.3    3e-12 
ref|ZP_03124420.1|  tagatose-bisphosphate aldolase [Clostridiu...  76.3    3e-12 
ref|ZP_01802542.1|  hypothetical protein CdifQ_04003524 [Clost...  76.3    3e-12 
ref|YP_001179181.1|  ketose-bisphosphate aldolase [Caldicellul...  75.9    3e-12  Gene info
ref|YP_206947.1|  tagatose-bisphosphate aldolase [Vibrio fisch...  75.9    3e-12  Gene info
ref|YP_001789401.1|  fructose-bisphosphate aldolase, class II ...  75.9    3e-12  Gene info
ref|YP_804833.1|  fructose-bisphosphate aldolase [Pediococcus ...  75.9    3e-12  Gene info
ref|YP_895068.1|  fructose-bisphosphate aldolase [Bacillus thu...  75.9    3e-12  Gene info
ref|YP_001089588.1|  tagatose-bisphosphate aldolase [Clostridi...  75.9    3e-12  Gene info
ref|NP_325941.1|  fructose-bisphosphate aldolase [Mycoplasma p...  75.9    3e-12  Gene info
ref|YP_411084.1|  fructose-1,6-bisphosphate aldolase [Nitrosos...  75.9    3e-12  Gene info
ref|NP_844887.1|  fructose-bisphosphate aldolase [Bacillus ant...  75.9    3e-12  Gene info
ref|ZP_00603168.1|  Ketose-bisphosphate aldolase, class-II:Fru...  75.9    3e-12 
ref|YP_036626.1|  fructose-bisphosphate aldolase [Bacillus thu...  75.9    4e-12  Gene info
ref|ZP_02729946.1|  hypothetical protein CdifQCD_19692 [Clostr...  75.5    4e-12 
ref|ZP_01802614.1|  hypothetical protein CdifQ_04003602 [Clost...  75.5    4e-12 
ref|XP_001741525.1|  fructose-bisphosphate aldolase [Entamoeba...  75.5    4e-12  Gene info
ref|ZP_02213226.1|  fructose-bisphosphate aldolase, class II [...  75.5    4e-12 
ref|ZP_00392762.1|  COG0191: Fructose/tagatose bisphosphate al...  75.5    5e-12 
ref|ZP_02990592.1|  class II aldolase, tagatose bisphosphate f...  75.5    5e-12 
ref|ZP_02396035.1|  fructose-bisphosphate aldolase, class II [...  75.5    5e-12 
ref|YP_685970.1|  fructose-bisphosphate aldolase (class II) [u...  75.5    5e-12  Gene info
ref|ZP_01666634.1|  fructose-1,6-bisphosphate aldolase, class ...  75.1    5e-12 
ref|ZP_02970150.1|  ketose-bisphosphate aldolase [bacterium El...  75.1    5e-12 
ref|YP_002246615.1|  fructose-1,6-bisphosphate aldolase, class...  75.1    5e-12  Gene info
ref|ZP_02432110.1|  hypothetical protein CLOSCI_02355 [Clostri...  75.1    5e-12 
ref|YP_595138.1|  fructose/tagatose bisphosphate aldolase [Law...  75.1    5e-12  Gene info
ref|ZP_03267171.1|  fructose-bisphosphate aldolase, class II, ...  75.1    6e-12 
ref|YP_001986413.1|  Fructose-bisphosphate aldolase (Fragment)...  75.1    6e-12  Gene info
ref|YP_582658.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  74.7    7e-12  Gene info
gb|ACH68645.1|  fructose-bisphosphate aldolase [Thermotogales ...  74.7    7e-12 
ref|YP_001986377.1|  Fructose-bisphosphate aldolase [Lactobaci...  74.7    7e-12  Gene info
ref|YP_245793.1|  fructose-bisphosphate aldolase [Bacillus cer...  74.7    7e-12  Gene info
ref|YP_001919013.1|  fructose-bisphosphate aldolase [Natranaer...  74.7    7e-12  Gene info
ref|ZP_03330744.1|  fructose-1,6-bisphosphate aldolase, class ...  74.7    7e-12 
ref|ZP_02884603.1|  fructose-bisphosphate aldolase, class II, ...  74.7    7e-12 
ref|YP_005383.1|  fructose-bisphosphate aldolase [Thermus ther...  74.3    8e-12  Gene info
ref|YP_294783.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  74.3    9e-12  Gene info
ref|ZP_03278686.1|  fructose-bisphosphate aldolase, class II, ...  74.3    1e-11 
ref|YP_001795911.1|  FRUCTOSE-BISPHOSPHATE ALDOLASE PROTEIN [C...  74.3    1e-11  Gene info
ref|YP_420743.1|  fructose-1,6-bisphosphate aldolase [Magnetos...  74.3    1e-11  Gene info
ref|ZP_03119193.1|  hypothetical protein CdifA_17872 [Clostrid...  74.3    1e-11 
ref|YP_001035913.1|  fructose-bisphosphate aldolase [Streptoco...  74.3    1e-11  Gene info
ref|ZP_02184330.1|  fbaA [Carnobacterium sp. AT7] >gb|EDP68902...  74.3    1e-11 
ref|YP_934346.1|  fructose-1,6-bisphosphate aldolase [Azoarcus...  73.9    1e-11  Gene info
ref|ZP_02327035.1|  fructose-bisphosphate aldolase [Paenibacil...  73.9    1e-11 
ref|YP_001089650.1|  hypothetical protein CD3135 [Clostridium ...  73.9    1e-11  Gene info
ref|ZP_02748521.1|  hypothetical protein CdifQCD-6_21003 [Clos...  73.9    1e-11 
ref|YP_001938946.1|  Fructose/tagatose bisphosphate aldolase [...  73.9    1e-11  Gene info
ref|YP_001784155.1|  ketose-bisphosphate aldolase [Haemophilus...  73.9    1e-11  Gene info
ref|ZP_03107684.1|  fructose-bisphosphate aldolase, class II [...  73.9    1e-11 
sp|Q703I2|ALF_THECA  Fructose-bisphosphate aldolase (Fructose-...  73.9    1e-11 
ref|YP_002018243.1|  fructose-1,6-bisphosphate aldolase, class...  73.9    1e-11  Gene info
ref|ZP_03124950.1|  hypothetical protein CdifQCD-2_08895 [Clos...  73.9    1e-11 
ref|YP_002097536.1|  Ketose-bisphosphate aldolase [Burkholderi...  73.6    2e-11  Gene info
ref|YP_379042.1|  fructose-bisphosphate aldolase [Chlorobium c...  73.6    2e-11  Gene info
ref|YP_001578864.1|  fructose-1,6-bisphosphate aldolase [Burkh...  73.6    2e-11  Gene info
ref|ZP_02067428.1|  hypothetical protein BACOVA_04436 [Bactero...  73.2    2e-11 
ref|ZP_03212045.1|  putative sugar-bisphosphate aldolase [Lact...  73.2    2e-11 
ref|ZP_00053757.2|  COG0191: Fructose/tagatose bisphosphate al...  73.2    2e-11 
ref|ZP_01373222.1|  ketose-bisphosphate aldolases [Desulfitoba...  73.2    2e-11 
ref|ZP_02417899.1|  hypothetical protein ANACAC_00466 [Anaeros...  73.2    2e-11 
ref|YP_517726.1|  hypothetical protein DSY1493 [Desulfitobacte...  73.2    2e-11  Gene info
ref|ZP_03118952.1|  tagatose-bisphosphate aldolase [Clostridiu...  73.2    2e-11 
ref|YP_194445.1|  fructose-bisphosphate aldolase [Lactobacillu...  72.8    2e-11  Gene info
ref|YP_174358.1|  hypothetical protein ABC0858 [Bacillus claus...  72.8    3e-11  Gene info
ref|ZP_02744225.1|  tagatose-bisphosphate aldolase [Clostridiu...  72.8    3e-11 
ref|ZP_03293774.1|  hypothetical protein CLOHIR_01724 [Clostri...  72.8    3e-11 
ref|YP_001943299.1|  fructose-1,6-bisphosphate aldolase, class...  72.8    3e-11  Gene info
ref|YP_001896890.1|  fructose-bisphosphate aldolase, class II,...  72.8    3e-11  Gene info
ref|ZP_02621108.2|  tagatose-1,6-bisphosphate aldolase gaty [C...  72.8    3e-11 
ref|YP_287959.1|  fructose-bisphosphate aldolase [Mycoplasma h...  72.8    3e-11  Gene info
ref|YP_083846.1|  fructose-bisphosphate aldolase [Bacillus cer...  72.4    3e-11  Gene info
ref|YP_081314.1|  fructose-1,6-bisphosphate aldolase [Bacillus...  72.4    3e-11  Gene info
ref|ZP_02033886.1|  hypothetical protein PARMER_03925 [Parabac...  72.4    4e-11 
gb|AAZ53936.2|  fructose-bisphosphate aldolase [Mycoplasma hyo...  72.4    4e-11 
ref|YP_116097.1|  fructose-bisphosphate aldolase [Mycoplasma h...  72.4    4e-11  Gene info
ref|ZP_03294421.1|  hypothetical protein COLINT_00094 [Collins...  72.4    4e-11 
ref|YP_002093345.1|  Fructose-bisphosphate aldolase [Burkholde...  72.4    4e-11  Gene info
ref|YP_002251548.1|  fructose-1,6-bisphosphate aldolase, class...  72.0    5e-11  Gene info
ref|YP_621889.1|  fructose-1,6-bisphosphate aldolase [Burkhold...  72.0    5e-11  Gene info
ref|YP_370195.1|  fructose-1,6-bisphosphate aldolase [Burkhold...  72.0    5e-11  Gene info
ref|ZP_03286670.1|  fructose-1,6-bisphosphate aldolase, class ...  72.0    5e-11 
ref|YP_560295.1|  fructose-1,6-bisphosphate aldolase [Burkhold...  72.0    5e-11  Gene info
ref|ZP_02866396.1|  hypothetical protein CLOSPI_00176 [Clostri...  72.0    5e-11 
ref|ZP_02354636.1|  fructose-1,6-bisphosphate aldolase [Burkho...  72.0    5e-11 
ref|ZP_02910921.1|  fructose-bisphosphate aldolase, class II, ...  72.0    5e-11 
ref|ZP_02888698.1|  fructose-bisphosphate aldolase, class II, ...  72.0    5e-11 
ref|YP_001986390.1|  Fructose-bisphosphate aldolase [Lactobaci...  72.0    5e-11  Gene info
ref|YP_001471509.1|  fructose-1,6-bisphosphate aldolase, class...  72.0    5e-11  Gene info
ref|YP_774563.1|  fructose-1,6-bisphosphate aldolase [Burkhold...  72.0    5e-11  Gene info
ref|ZP_03327129.1|  Fructose-bisphosphate aldolase [Anaerocell...  71.6    5e-11 
ref|ZP_02377966.1|  fructose-1,6-bisphosphate aldolase [Burkho...  71.6    5e-11 
ref|ZP_02424766.1|  hypothetical protein ALIPUT_00894 [Alistip...  71.6    6e-11 
ref|YP_001678085.1|  fructose-1,6-bisphosphate aldolase [Franc...  71.6    6e-11  Gene info
ref|ZP_03011696.1|  hypothetical protein BACCOP_03612 [Bactero...  71.6    6e-11 
ref|ZP_02993692.1|  hypothetical protein CLOSPO_00765 [Clostri...  71.6    6e-11 
ref|ZP_02693384.1|  fructose-bisphosphate aldolase [Epulopisci...  71.6    7e-11 
ref|ZP_03134854.1|  fructose-1,6-bisphosphate aldolase, class ...  71.2    7e-11 
ref|YP_001311616.1|  fructose-bisphosphate aldolase [Clostridi...  71.2    8e-11  Gene info
pdb|2ISV|A  Chain A, Structure Of Giardia Fructose-1,6-Biphosp...  71.2    8e-11  Related structures
ref|ZP_02462481.1|  fructose-1,6-bisphosphate aldolase [Burkho...  71.2    8e-11 
ref|YP_546351.1|  fructose-1,6-bisphosphate aldolase [Methylob...  71.2    8e-11  Gene info
pdb|1RV8|A  Chain A, Class Ii Fructose-1,6-Bisphosphate Aldola...  71.2    8e-11  Related structures
ref|ZP_00439955.1|  COG0191: Fructose/tagatose bisphosphate al...  71.2    8e-11 
ref|YP_107423.1|  fructose-1,6-bisphosphate aldolase [Burkhold...  71.2    8e-11  Gene info
pdb|2FJK|A  Chain A, Crystal Structure Of Fructose-1,6-Bisphos...  71.2    8e-11  Related structures
ref|ZP_03211145.1|  hypothetical protein LRH_00722 [Lactobacil...  71.2    9e-11 
ref|YP_001120567.1|  fructose-1,6-bisphosphate aldolase [Burkh...  71.2    9e-11  Gene info
gb|AAX16388.1|  fructose-bisphosphate aldolase [uncultured mur...  71.2    9e-11 
ref|NP_781044.1|  fructose-bisphosphate aldolase [Clostridium ...  71.2    9e-11  Gene info
gb|AAO66590.1|  putative fructose-bisphosphate aldolase [Brach...  70.9    9e-11 
ref|ZP_03211154.1|  hypothetical protein LRH_00767 [Lactobacil...  70.9    9e-11 
ref|NP_810604.1|  fructose-bisphosphate aldolase [Bacteroides ...  70.9    1e-10  Gene info
ref|YP_521493.1|  fructose-1,6-bisphosphate aldolase [Rhodofer...  70.9    1e-10  Gene info
ref|YP_076512.1|  putative aldolase [Symbiobacterium thermophi...  70.9    1e-10  Gene info
ref|ZP_01962353.1|  hypothetical protein RUMOBE_00066 [Ruminoc...  70.9    1e-10 
ref|ZP_02438183.1|  hypothetical protein CLOSS21_00623 [Clostr...  70.9    1e-10 
ref|XP_001710050.1|  Fructose-bisphosphate aldolase [Giardia l...  70.9    1e-10  Gene info
ref|ZP_02040287.1|  hypothetical protein RUMGNA_01051 [Ruminoc...  70.9    1e-10 
ref|YP_001130408.1|  fructose-bisphosphate aldolase [Prostheco...  70.9    1e-10  Gene info
ref|YP_001819876.1|  ketose-bisphosphate aldolase [Opitutus te...  70.9    1e-10  Gene info
ref|YP_002015731.1|  fructose-1,6-bisphosphate aldolase, class...  70.9    1e-10  Gene info
ref|ZP_01188080.1|  Ketose-bisphosphate aldolase, class-II [Ha...  70.9    1e-10 
ref|ZP_02086907.1|  hypothetical protein CLOBOL_04451 [Clostri...  70.9    1e-10 
ref|YP_001577892.1|  fructose-bisphosphate aldolase [Lactobaci...  70.9    1e-10  Gene info
ref|YP_001389556.1|  fructose-1,6-bisphosphate aldolase, class...  70.5    1e-10  Gene info
ref|YP_279369.1|  fructose-bisphosphate aldolase [Mycoplasma h...  70.5    1e-10  Gene info
gb|AAZ44658.2|  fructose-bisphosphate aldolase [Mycoplasma hyo...  70.5    1e-10 
gb|ABH11549.1|  fructose-1,6-biphosphate aldolase [Lactobacill...  70.5    1e-10 
ref|ZP_03305975.1|  hypothetical protein BACFIN_00295 [Bactero...  70.5    1e-10 
ref|YP_001303301.1|  fructose-bisphosphate aldolase [Parabacte...  70.5    1e-10  Gene info
ref|YP_999460.1|  fructose-bisphosphate aldolase, class II [Ve...  70.5    1e-10  Gene info
ref|ZP_01961144.1|  hypothetical protein BACCAC_02770 [Bactero...  70.5    1e-10 
ref|YP_001785521.1|  fructose-1,6-bisphosphate aldolase, class...  70.5    1e-10  Gene info
ref|YP_002221241.1|  fructose-bisphosphate aldolase, class II,...  70.5    2e-10  Gene info
ref|YP_001252737.1|  fructose-1,6-bisphosphate aldolase, class...  70.5    2e-10  Gene info
gb|ACA58082.1|  FbaA [Francisella piscicida]                       70.5    2e-10 
ref|YP_001382597.1|  fructose-1,6-bisphosphate aldolase, class...  70.5    2e-10  Gene info
ref|ZP_02616861.1|  fructose-1,6-bisphosphate aldolase, class ...  70.1    2e-10 
ref|YP_001779820.1|  fructose-1,6-bisphosphate aldolase, class...  70.1    2e-10  Gene info
ref|ZP_02434733.1|  hypothetical protein BACSTE_00962 [Bactero...  70.1    2e-10 
ref|ZP_02070050.1|  hypothetical protein BACUNI_01467 [Bactero...  70.1    2e-10 
ref|YP_396141.1|  fructose-bisphosphate aldolase [Lactobacillu...  70.1    2e-10  Gene info
ref|ZP_02692735.1|  tagatose-bisphosphate aldolase [Epulopisci...  70.1    2e-10 
ref|YP_001298974.1|  fructose-bisphosphate aldolase [Bacteroid...  70.1    2e-10  Gene info
ref|YP_572431.1|  fructose-1,6-bisphosphate aldolase [Chromoha...  70.1    2e-10  Gene info
ref|ZP_02212765.1|  hypothetical protein CLOBAR_02384 [Clostri...  70.1    2e-10 
sp|Q56815.1|ALF_XANFL  RecName: Full=Fructose-bisphosphate ald...  70.1    2e-10 
gb|AAN16353.1|AF461037_1  fructose-1,6-bisphosphate aldolase [...  69.7    2e-10 
ref|ZP_03210063.1|  hypothetical protein BACPLE_03754 [Bactero...  69.7    2e-10 
ref|YP_984086.1|  fructose-1,6-bisphosphate aldolase [Polaromo...  69.7    2e-10  Gene info
ref|ZP_03298940.1|  hypothetical protein BACDOR_00299 [Bactero...  69.7    2e-10 
ref|YP_432821.1|  fructose-1,6-bisphosphate aldolase [Hahella ...  69.7    2e-10  Gene info
ref|ZP_02418115.1|  hypothetical protein ANACAC_00683 [Anaeros...  69.3    3e-10 
ref|YP_988137.1|  fructose-bisphosphate aldolase [Acidovorax s...  69.3    3e-10  Gene info
ref|YP_001477265.1|  hypothetical protein Spro_1033 [Serratia ...  69.3    3e-10  Gene info
ref|YP_002004149.1|  Fructose-bisphosphate aldolase [Candidatu...  69.3    3e-10  Gene info
ref|ZP_01994435.1|  hypothetical protein DORLON_00420 [Dorea l...  69.3    3e-10 
ref|ZP_02432288.1|  hypothetical protein CLOSCI_02533 [Clostri...  68.9    4e-10 
ref|YP_001998591.1|  fructose-1,6-bisphosphate aldolase, class...  68.9    4e-10  Gene info
gb|ABI49146.1|  fructose-1,6-bisphopshate aldolase [Trimastix ...  68.9    4e-10 
ref|ZP_03016551.1|  hypothetical protein BACINT_04158 [Bactero...  68.9    4e-10 
ref|ZP_02086906.1|  hypothetical protein CLOBOL_04450 [Clostri...  68.9    4e-10 
ref|NP_462679.1|  putative fructose-1,6-bisphosphate aldolase ...  68.9    4e-10  Gene info
ref|YP_424584.1|  fructose/tagatose bisphosphate aldolase, cla...  68.9    4e-10  Gene info
ref|YP_001416814.1|  fructose-bisphosphate aldolase, class II ...  68.9    4e-10  Gene info
ref|YP_898958.1|  fructose-1,6-bisphosphate aldolase [Francise...  68.9    4e-10  Gene info
ref|ZP_02085414.1|  hypothetical protein CLOBOL_02951 [Clostri...  68.9    4e-10 
ref|YP_002170069.1|  fructose-1,6-bisphosphate aldolase [Franc...  68.9    4e-10  Gene info
ref|YP_785417.1|  fructose-bisphosphate aldolase [Bordetella a...  68.9    4e-10  Gene info
ref|YP_747790.1|  fructose-1,6-bisphosphate aldolase [Nitrosom...  68.6    5e-10  Gene info
ref|ZP_02418006.1|  hypothetical protein ANACAC_00573 [Anaeros...  68.6    5e-10 
ref|YP_100577.1|  fructose-bisphosphate aldolase [Bacteroides ...  68.6    5e-10  Gene info
ref|YP_001986214.1|  Fructose-bisphosphate aldolase [Lactobaci...  68.6    6e-10  Gene info
ref|ZP_02420313.1|  hypothetical protein ANACAC_02930 [Anaeros...  68.2    6e-10 
ref|NP_790239.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  68.2    6e-10  Gene info
ref|ZP_02842988.1|  fructose-bisphosphate aldolase, class II, ...  68.2    7e-10 
ref|YP_001959736.1|  fructose-1,6-bisphosphate aldolase, class...  68.2    7e-10  Gene info
ref|NP_661944.1|  fructose-bisphosphate aldolase [Chlorobium t...  68.2    7e-10  Gene info
ref|YP_152739.1|  putative fructose-1,6-bisphosphate aldolase ...  68.2    7e-10  Gene info
ref|ZP_02682429.1|  fructose-1,6-bisphosphate aldolase, class ...  68.2    8e-10 
ref|YP_218688.1|  putative fructose-1,6-bisphosphate aldolase ...  67.8    8e-10  Gene info
ref|YP_002043027.1|  fructose-1,6-bisphosphate aldolase, class...  67.8    8e-10  Gene info
ref|ZP_01922474.1|  ketose-bisphosphate aldolase [Victivallis ...  67.8    9e-10 
emb|CAM32612.1|  Fructose-1,6-bisphosphate aldolase protein [H...  67.8    9e-10 
ref|YP_001961030.1|  rcorf55 [Agrobacterium rhizogenes] >gb|AB...  67.8    9e-10  Gene info
ref|YP_551411.1|  fructose-1,6-bisphosphate aldolase [Polaromo...  67.8    1e-09  Gene info
ref|YP_276914.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  67.4    1e-09  Gene info
ref|NP_975623.1|  fructose-bisphosphate aldolase class-II [Myc...  67.4    1e-09  Gene info
ref|ZP_02000313.1|  Ketose-bisphosphate aldolase, class-II [Be...  67.4    1e-09 
ref|ZP_02901311.1|  fructose-1,6-bisphosphate aldolase [Escher...  67.4    1e-09 
ref|YP_237852.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  67.4    1e-09  Gene info
ref|YP_001174381.1|  fructose-1,6-bisphosphate aldolase [Pseud...  67.4    1e-09  Gene info
ref|ZP_03042982.1|  fructose-bisphosphate aldolase, class II [...  67.4    1e-09 
ref|XP_001311055.1|  fructose-1,6-bisphosphate aldolase [Trich...  67.4    1e-09  Gene info
ref|YP_001019488.1|  fructose-1,6-bisphosphate aldolase [Methy...  67.4    1e-09  Gene info
ref|ZP_01924277.1|  Fructose-bisphosphate aldolase [Victivalli...  67.4    1e-09 
ref|ZP_03297010.1|  hypothetical protein COLSTE_00895 [Collins...  67.0    1e-09 
ref|YP_001455309.1|  hypothetical protein CKO_03797 [Citrobact...  67.0    1e-09  Gene info
ref|ZP_02440435.1|  hypothetical protein CLOSS21_02939 [Clostr...  67.0    1e-09 
ref|ZP_01665244.1|  ketose-bisphosphate aldolases [Thermosinus...  67.0    1e-09 
ref|NP_840411.1|  fructose-1,6-bisphosphate aldolase [Nitrosom...  67.0    1e-09  Gene info
ref|ZP_01736855.1|  fructose-bisphosphate aldolase [Marinobact...  67.0    1e-09 
ref|YP_001988853.1|  Fructose-bisphosphate aldolase [Lactobaci...  67.0    2e-09  Gene info
ref|NP_001057323.1|  Os06g0258900 [Oryza sativa (japonica cult...  67.0    2e-09  UniGene infoGene info
ref|ZP_02085120.1|  hypothetical protein CLOBOL_02653 [Clostri...  67.0    2e-09 
gb|EDY87045.1|  fructose-bisphosphate aldolase, class II, Calv...  67.0    2e-09 
gb|EAZ36539.1|  hypothetical protein OsJ_020022 [Oryza sativa ...  67.0    2e-09 
ref|ZP_02441578.1|  hypothetical protein ANACOL_00859 [Anaerot...  67.0    2e-09 
ref|NP_066666.1|  hypothetical protein pRi1724_p086 [Agrobacte...  67.0    2e-09  Gene info
ref|YP_001021982.1|  fructose-bisphosphate aldolase [Methylibi...  66.6    2e-09  Gene info
ref|YP_001396961.1|  hypothetical protein CKL_3599 [Clostridiu...  66.6    2e-09  Gene info
ref|NP_899857.1|  fructose-1,6-bisphosphate aldolase [Chromoba...  66.6    2e-09  Gene info
ref|ZP_02417608.1|  hypothetical protein ANACAC_00172 [Anaeros...  66.6    2e-09 
ref|YP_002308852.1|  fructose-bisphosphate aldolase [Candidatu...  66.6    2e-09  Gene info
ref|NP_880254.1|  fructose-1,6-bisphosphate aldolase [Bordetel...  66.6    2e-09  Gene info
ref|NP_471572.1|  hypothetical protein lin2239 [Listeria innoc...  66.6    2e-09  Gene info
ref|YP_170314.1|  fructose-1,6-bisphosphate aldolase [Francise...  66.2    2e-09  Gene info
ref|XP_001241859.1|  hypothetical protein CIMG_05755 [Coccidio...  66.2    2e-09  Gene info
gb|EAZ00417.1|  hypothetical protein OsI_021649 [Oryza sativa ...  66.2    2e-09 
ref|YP_513835.1|  fructose-1,6-bisphosphate aldolase [Francise...  66.2    2e-09  Gene info
ref|ZP_02420817.1|  hypothetical protein ANACAC_03464 [Anaeros...  66.2    3e-09 
ref|NP_883508.1|  fructose-1,6-bisphosphate aldolase [Bordetel...  66.2    3e-09  Gene info
ref|YP_001856699.1|  fructose-bisphosphate aldolase, class II ...  66.2    3e-09  Gene info
ref|ZP_02438127.1|  hypothetical protein CLOSS21_00567 [Clostr...  66.2    3e-09 
ref|YP_001632211.1|  fructose-1,6-bisphosphate aldolase [Borde...  66.2    3e-09  Gene info
ref|YP_001354536.1|  fructose-1,6-bisphosphate aldolase [Janth...  65.9    3e-09  Gene info
ref|NP_407401.1|  hypothetical protein YPO3960 [Yersinia pesti...  65.9    3e-09  Gene info
ref|YP_388833.1|  fructose-bisphosphate aldolase [Desulfovibri...  65.9    3e-09  Gene info
gb|EDX79178.1|  fructose-bisphosphate aldolase, class II, Calv...  65.9    3e-09 
gb|AAX77921.1|  unknown protein [synthetic construct]              65.9    3e-09 
ref|YP_960298.1|  fructose-bisphosphate aldolase, class II [Ma...  65.9    4e-09  Gene info
ref|YP_011356.1|  fructose-1,6-bisphosphate aldolase, class II...  65.9    4e-09  Gene info
gb|AAM87414.1|AE013991_2  biphosphate aldolase [Yersinia pesti...  65.5    4e-09  Gene info
ref|YP_694332.1|  fructose-1,6-bisphosphate aldolase [Alcanivo...  65.5    4e-09  Gene info
ref|ZP_02086914.1|  hypothetical protein CLOBOL_04458 [Clostri...  65.5    4e-09 
ref|ZP_03211362.1|  fructose-1,6-bisphosphate aldolase [Lactob...  65.5    4e-09 
emb|CAO68226.1|  unnamed protein product [Vitis vinifera]          65.5    4e-09 
ref|YP_903338.1|  fructose-bisphosphate aldolase [Candidatus R...  65.5    4e-09  Gene info
ref|ZP_02088831.1|  hypothetical protein CLOBOL_06387 [Clostri...  65.5    4e-09 
ref|YP_001337842.1|  putative ketose-bisphosphate aldolase, cl...  65.5    5e-09  Gene info
ref|YP_014759.1|  fructose-bisphosphate aldolase [Listeria mon...  65.5    5e-09  Gene info
ref|YP_850350.1|  fructose-bisphosphate aldolase [Listeria wel...  65.5    5e-09  Gene info
ref|NP_246312.1|  hypothetical protein PM1373 [Pasteurella mul...  65.5    5e-09  Gene info
ref|ZP_00233314.1|  fructose-bisphosphate aldolase, class II f...  65.5    5e-09 
ref|ZP_03211029.1|  putative fructose-1,6-bisphosphate aldolas...  65.5    5e-09 
ref|ZP_01077077.1|  fructose-bisphosphate aldolase [Marinomona...  65.5    5e-09 
ref|ZP_03212930.1|  tagatose-1,6-bisphosphate aldolase [Lactob...  65.1    5e-09 
gb|ACG24232.1|  unknown [Zea mays]                                 65.1    5e-09 
ref|NP_465658.1|  hypothetical protein lmo2134 [Listeria monoc...  65.1    5e-09  Gene info
ref|XP_002148452.1|  fructose-bisphosphate aldolase, putative ...  65.1    5e-09  Gene info
ref|ZP_02419914.1|  hypothetical protein ANACAC_02508 [Anaeros...  65.1    5e-09 
ref|NP_859637.1|  fructose-bisphosphate aldolase [Helicobacter...  65.1    6e-09  Gene info
ref|XP_001299473.1|  fructose-1,6-bisphosphate aldolase [Trich...  65.1    6e-09  Gene info
ref|YP_313921.1|  fructose-1,6-bisphosphate aldolase [Thiobaci...  65.1    6e-09  Gene info
ref|NP_213960.1|  fructose-1,6-bisphosphate aldolase class II ...  64.7    7e-09  Gene info
ref|YP_001185964.1|  fructose-1,6-bisphosphate aldolase [Pseud...  64.7    7e-09  Gene info
ref|YP_001956230.1|  fructose-bisphosphate aldolase [unculture...  64.7    8e-09  Gene info
ref|YP_002300219.1|  fructose-bisphosphate aldolase, class II,...  64.7    8e-09  Gene info
ref|YP_046575.1|  fructose-1,6-bisphosphate aldolase [Acinetob...  64.7    8e-09  Gene info
ref|YP_001875249.1|  fructose-1,6-bisphosphate aldolase, class...  64.3    9e-09  Gene info
ref|NP_925479.1|  tagatose-bisphosphate aldolase GatY-like pro...  64.3    9e-09  Gene info
ref|YP_001346053.1|  fructose-1,6-bisphosphate aldolase [Pseud...  64.3    9e-09  Gene info
ref|ZP_01962503.1|  hypothetical protein RUMOBE_00216 [Ruminoc...  64.3    9e-09 
ref|NP_249246.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  64.3    9e-09  Gene info
ref|NP_290054.1|  putative fructose-1,6-bisphosphate aldolase ...  64.3    9e-09  Gene info
ref|ZP_01104063.1|  fructose-1,6-bisphosphate aldolase [gamma ...  64.3    9e-09 
ref|YP_002241233.1|  fructose-bisphosphate aldolase, class II ...  64.3    1e-08  Gene info
ref|XP_001312328.1|  fructose-1,6-bisphosphate aldolase [Trich...  64.3    1e-08  Gene info
ref|XP_001315385.1|  fructose-1,6-bisphosphate aldolase [Trich...  64.3    1e-08  Gene info
ref|YP_001745738.1|  fructose-bisphosphate aldolase, class II ...  64.3    1e-08  Gene info
ref|YP_344781.1|  fructose-1,6-bisphosphate aldolase [Nitrosoc...  64.3    1e-08  Gene info
ref|NP_756146.1|  putative fructose-1,6-bisphosphate aldolase ...  63.9    1e-08  Gene info
ref|YP_425687.1|  fructose-1,6-bisphosphate aldolase [Rhodospi...  63.9    1e-08  Gene info
ref|NP_629975.1|  tagatose-bisphosphate aldolase [Streptomyces...  63.9    1e-08  Gene info
ref|XP_001326960.1|  fructose-1,6-bisphosphate aldolase [Trich...  63.9    1e-08  Gene info
ref|YP_732913.1|  fructose-1,6-bisphosphate aldolase [Shewanel...  63.9    1e-08  Gene info
ref|ZP_01962338.1|  hypothetical protein RUMOBE_00051 [Ruminoc...  63.9    1e-08 
ref|YP_001100852.1|  fructose-1,6-bisphosphate aldolase [Hermi...  63.9    1e-08  Gene info
ref|NP_716562.1|  fructose-1,6-bisphosphate aldolase [Shewanel...  63.9    1e-08  Gene info
ref|ZP_02964885.1|  probable fructose-bisphosphate aldolase 2 ...  63.9    1e-08 
ref|YP_964666.1|  fructose-1,6-bisphosphate aldolase [Shewanel...  63.9    1e-08  Gene info
emb|CAC87146.1|  putative fructose-1,6-bisphosphate aldolase [...  63.9    1e-08 
ref|NP_488603.1|  fructose-1,6-bisphosphate aldolase [Nostoc s...  63.9    1e-08  Gene info
ref|YP_001772715.1|  fructose-bisphosphate aldolase, class II ...  63.9    1e-08  Gene info
ref|YP_323002.1|  fructose-1,6-bisphosphate aldolase [Anabaena...  63.5    1e-08  Gene info
sp|O87796|ALF_PSEST  Fructose-bisphosphate aldolase >emb|CAA09...  63.5    2e-08 
ref|ZP_02439919.1|  hypothetical protein CLOSS21_02403 [Clostr...  63.5    2e-08 
ref|YP_807862.1|  fructose/tagatose bisphosphate aldolase [Lac...  63.5    2e-08  Gene info
ref|ZP_01896182.1|  fructose-1,6-bisphosphate aldolase [Marino...  63.5    2e-08 
ref|YP_610436.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  63.5    2e-08  Gene info
ref|ZP_02420789.1|  hypothetical protein ANACAC_03436 [Anaeros...  63.5    2e-08 
ref|XP_001307153.1|  fructose-1,6-bisphosphate aldolase [Trich...  63.2    2e-08  Gene info
gb|EDX89784.1|  fructose-bisphosphate aldolase, class II, Calv...  63.2    2e-08 
ref|ZP_02176980.1|  fructose-1,6-bisphosphate aldolase class I...  63.2    2e-08 
ref|ZP_00418722.1|  Ketose-bisphosphate aldolase, class-II:Fru...  63.2    2e-08 
ref|ZP_02418315.1|  hypothetical protein ANACAC_00890 [Anaeros...  63.2    2e-08 
ref|XP_001259661.1|  fructose-bisphosphate aldolase, putative ...  63.2    2e-08  Gene info
ref|YP_262839.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  63.2    2e-08  Gene info
ref|ZP_02417998.1|  hypothetical protein ANACAC_00565 [Anaeros...  63.2    2e-08 
ref|YP_001671229.1|  fructose-1,6-bisphosphate aldolase [Pseud...  63.2    2e-08  Gene info
ref|XP_001223667.1|  conserved hypothetical protein [Chaetomiu...  62.8    3e-08  Gene info
ref|YP_001218934.1|  fructose-bisphosphate aldolase, class II ...  62.8    3e-08  Gene info
ref|XP_753612.1|  fructose-bisphosphate aldolase [Aspergillus ...  62.8    3e-08  Gene info
ref|YP_001478484.1|  ketose-bisphosphate aldolase [Serratia pr...  62.8    3e-08  Gene info
ref|ZP_02121166.1|  Fructose-bisphosphate aldolase [Methylobac...  62.4    3e-08 
ref|ZP_02438260.1|  hypothetical protein CLOSS21_00701 [Clostr...  62.4    4e-08 
ref|ZP_01307962.1|  fructose-bisphosphate aldolase [Oceanobact...  62.4    4e-08 
ref|YP_115434.1|  fructose-1,6-bisphosphate aldolase [Methyloc...  62.4    4e-08  Gene info
ref|ZP_02076888.1|  hypothetical protein EUBDOL_00681 [Eubacte...  62.0    5e-08 
ref|YP_156592.1|  fructose-1,6-bisphosphate aldolase [Idiomari...  62.0    5e-08  Gene info
ref|YP_552894.1|  fructose-1,6-bisphosphate aldolase [Burkhold...  62.0    5e-08  Gene info
ref|ZP_01133023.1|  fructose-bisphosphate aldolase [Pseudoalte...  62.0    5e-08 
ref|ZP_02861398.1|  hypothetical protein ANASTE_00603 [Anaerof...  62.0    5e-08 
ref|YP_583670.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  61.6    6e-08  Gene info
ref|YP_001798229.1|  fructose-bisphosphate aldolase, class II ...  61.6    6e-08  Gene info
ref|XP_659938.1|  hypothetical protein AN2334.2 [Aspergillus n...  61.6    7e-08  Gene info
ref|YP_002300813.1|  fructose-bisphosphate aldolase [Helicobac...  61.6    7e-08  Gene info
ref|ZP_02881243.1|  fructose-bisphosphate aldolase, class II, ...  61.6    7e-08 
ref|ZP_01441793.1|  fructose-bisphosphate aldolase [Roseovariu...  61.6    7e-08 
ref|NP_747063.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  61.2    7e-08  Gene info
ref|ZP_02418846.1|  hypothetical protein ANACAC_01430 [Anaeros...  61.2    7e-08 
ref|YP_001002617.1|  fructose-1,6-bisphosphate aldolase [Halor...  61.2    7e-08  Gene info
ref|ZP_01615785.1|  fructose-bisphosphate aldolase, class II [...  61.2    7e-08 
ref|ZP_03343628.1|  tagatose-bisphosphate aldolase [Salmonella...  61.2    7e-08 
ref|ZP_03211034.1|  putative fructose-1,6-bisphosphate aldolas...  61.2    7e-08 
ref|YP_001738711.1|  fructose-1,6-bisphosphate aldolase, class...  61.2    7e-08  Gene info
gb|AAF25990.1|AC013354_9  F15H18.22 [Arabidopsis thaliana]         61.2    7e-08 
ref|YP_743674.1|  fructose-1,6-bisphosphate aldolase [Alkalili...  61.2    7e-08  Gene info
ref|YP_002198181.1|  tagatose-bisphosphate aldolase [Streptomy...  61.2    8e-08  Gene info
ref|YP_001747380.1|  fructose-bisphosphate aldolase, class II ...  61.2    8e-08  Gene info
ref|NP_228086.1|  fructose-bisphosphate aldolase [Thermotoga m...  61.2    8e-08  Gene info
ref|YP_170823.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  61.2    8e-08  Gene info
ref|YP_286795.1|  fructose-1,6-bisphosphate aldolase [Dechloro...  61.2    8e-08  Gene info
ref|YP_001156592.1|  fructose-1,6-bisphosphate aldolase [Polyn...  61.2    8e-08  Gene info
ref|XP_659492.1|  hypothetical protein AN1888.2 [Aspergillus n...  61.2    8e-08  Gene info
ref|YP_001988858.1|  Fructose-bisphosphate aldolase [Lactobaci...  61.2    8e-08  Gene info
ref|YP_002202995.1|  tagatose-bisphosphate aldolase [Streptomy...  61.2    9e-08  Gene info
ref|ZP_01042830.1|  Fructose/tagatose bisphosphate aldolase [I...  61.2    9e-08 
ref|YP_001244247.1|  fructose-1,6-bisphosphate aldolase, class...  61.2    9e-08  Gene info
ref|NP_822620.1|  tagatose-bisphosphate aldolase [Streptomyces...  61.2    9e-08  Gene info
ref|ZP_00404840.1|  COG0191: Fructose/tagatose bisphosphate al...  61.2    9e-08 
ref|YP_543163.1|  putative aldolase [Escherichia coli UTI89] >...  61.2    9e-08  Gene info
ref|YP_001343146.1|  fructose-bisphosphate aldolase, class II ...  61.2    9e-08  Gene info
ref|YP_350990.1|  fructose-1,6-bisphosphate aldolase [Pseudomo...  60.8    1e-07  Gene info
ref|XP_001823305.1|  hypothetical protein [Aspergillus oryzae ...  60.8    1e-07  Gene info
ref|YP_001707093.1|  fructose-1,6-bisphosphate aldolase, class...  60.8    1e-07  Gene info
ref|NP_326191.1|  fructose-bisphosphate aldolase [Mycoplasma p...  60.8    1e-07  Gene info
pdb|3C4U|A  Chain A, Structure Of Class Ii Fructose-Biphosphat...  60.8    1e-07  Related structures
ref|NP_001117303.1|  ketose-bisphosphate aldolase class-II fam...  60.8    1e-07  UniGene infoGene info
ref|NP_173263.2|  ketose-bisphosphate aldolase class-II family...  60.8    1e-07  UniGene infoGene info
ref|NP_222883.1|  fructose-bisphosphate aldolase [Helicobacter...  60.8    1e-07  Gene info
ref|ZP_02861557.1|  hypothetical protein ANASTE_00763 [Anaerof...  60.8    1e-07 
gb|AAF78379.1|AC069551_12  T10O22.24 [Arabidopsis thaliana]        60.8    1e-07 
ref|YP_001909667.1|  fructose-bisphosphate aldolase [Helicobac...  60.8    1e-07  Gene info
ref|YP_002265795.1|  fructose-bisphosphate aldolase [Helicobac...  60.8    1e-07  Gene info
ref|NP_206975.1|  fructose-bisphosphate aldolase [Helicobacter...  60.8    1e-07  Gene info
ref|YP_626913.1|  fructose-bisphosphate aldolase [Helicobacter...  60.8    1e-07  Gene info
ref|YP_664194.1|  fructose-bisphosphate aldolase [Helicobacter...  60.5    1e-07  Gene info
ref|ZP_02692932.1|  fructose-1,6-bisphosphate aldolase, class ...  60.5    1e-07 
ref|XP_367020.1|  hypothetical protein MGG_03096 [Magnaporthe ...  60.5    1e-07  Gene info
ref|NP_781193.1|  fructose-bisphosphate aldolase [Clostridium ...  60.5    1e-07  Gene info
ref|ZP_01164897.1|  putative fructose-1,6-bisphosphate aldolas...  60.5    1e-07 
ref|ZP_02134130.1|  Fructose-bisphosphate aldolase [Desulfatib...  60.5    1e-07 
ref|ZP_03240313.1|  fructose-bisphosphate aldolase [Helicobact...  60.5    1e-07 
ref|YP_001175025.1|  hypothetical protein Ent638_0285 [Enterob...  60.5    2e-07  Gene info
ref|YP_001868832.1|  fructose-bisphosphate aldolase, class II ...  60.5    2e-07  Gene info
ref|YP_001084573.2|  fructose-1,6-bisphosphate aldolase [Acine...  60.5    2e-07  Gene info
ref|YP_001682394.1|  fructose-1,6-bisphosphate aldolase [Caulo...  60.1    2e-07  Gene info
ref|YP_001092886.1|  fructose-1,6-bisphosphate aldolase [Shewa...  60.1    2e-07  Gene info
ref|YP_001673081.1|  fructose-1,6-bisphosphate aldolase [Shewa...  60.1    2e-07  Gene info
ref|YP_885761.1|  tagatose-1,6-bisphosphate aldolase GatY [Myc...  60.1    2e-07  Gene info
gb|EDX87378.1|  fructose-bisphosphate aldolase, class II, Calv...  60.1    2e-07 
ref|ZP_00603652.1|  Ketose-bisphosphate aldolase, class-II [En...  60.1    2e-07 
ref|YP_749348.1|  fructose-1,6-bisphosphate aldolase [Shewanel...  60.1    2e-07  Gene info
emb|CAO88630.1|  unnamed protein product [Microcystis aerugino...  60.1    2e-07 
ref|YP_877462.1|  fructose-1,6-bisphosphate aldolase, class II...  60.1    2e-07  Gene info
ref|YP_001500653.1|  fructose-1,6-bisphosphate aldolase [Shewa...  60.1    2e-07  Gene info
ref|YP_001752866.1|  fructose-bisphosphate aldolase, class II ...  60.1    2e-07  Gene info
ref|ZP_02088732.1|  hypothetical protein CLOBOL_06288 [Clostri...  60.1    2e-07 
sp|Q9XDP3|ALF_NOSCO  Fructose-bisphosphate aldolase >gb|AAD378...  60.1    2e-07 
ref|YP_270538.1|  fructose-1,6-bisphosphate aldolase [Colwelli...  59.7    2e-07  Gene info
ref|YP_001472616.1|  fructose-1,6-bisphosphate aldolase [Shewa...  59.7    2e-07  Gene info
ref|YP_001759268.1|  fructose-bisphosphate aldolase, class II ...  59.7    2e-07  Gene info
ref|YP_001821797.1|  putative tagatose-bisphosphate aldolase [...  59.7    2e-07  Gene info
ref|XP_001816583.1|  hypothetical protein [Aspergillus oryzae ...  59.7    2e-07  Gene info
ref|YP_001598513.1|  fructose-1,6-bisphosphate aldolase [Neiss...  59.7    2e-07  Gene info
ref|ZP_01611920.1|  fructose-bisphosphate aldolase [Alteromona...  59.7    2e-07 
gb|EDY38697.1|  fructose-bisphosphate aldolase, class II, Calv...  59.7    2e-07 
ref|ZP_02082111.1|  hypothetical protein CLOLEP_03600 [Clostri...  59.7    3e-07 
ref|ZP_02862949.1|  hypothetical protein ANASTE_02176 [Anaerof...  59.7    3e-07 
ref|XP_001910408.1|  unnamed protein product [Podospora anseri...  59.7    3e-07  Gene info
ref|YP_286823.1|  fructose-1,6-bisphosphate aldolase [Dechloro...  59.7    3e-07  Gene info
ref|NP_290719.1|  hypothetical protein Z5687 [Escherichia coli...  59.7    3e-07  Gene info
ref|NP_313096.1|  hypothetical protein ECs5069 [Escherichia co...  59.3    3e-07  Gene info
ref|ZP_02836909.1|  ketose-bisphosphate aldolase class-II [Art...  59.3    3e-07 
ref|ZP_02157543.1|  fructose-bisphosphate aldolase [Shewanella...  59.3    3e-07 
ref|ZP_03064575.1|  probable fructose-bisphosphate aldolase 1 ...  59.3    3e-07 
ref|ZP_02085765.1|  hypothetical protein CLOBOL_03308 [Clostri...  59.3    3e-07 
ref|ZP_01967258.1|  hypothetical protein RUMTOR_00804 [Ruminoc...  59.3    3e-07 
ref|YP_339125.1|  fructose-1,6-bisphosphate aldolase [Pseudoal...  59.3    3e-07  Gene info
ref|YP_001011117.1|  fructose-1,6-bisphosphate aldolase [Proch...  59.3    3e-07  Gene info
gb|ABE11220.1|  fructose-bisphosphate/sedoheptulose-1,7-bispho...  59.3    3e-07 
ref|YP_390518.1|  fructose-1,6-bisphosphate aldolase [Thiomicr...  59.3    3e-07  Gene info
ref|YP_001885499.1|  probable fructose-bisphosphate aldolase 1...  58.9    4e-07  Gene info
ref|ZP_02087369.1|  hypothetical protein CLOBOL_04913 [Clostri...  58.9    4e-07 
ref|ZP_02210255.1|  hypothetical protein CLOBAR_02663 [Clostri...  58.9    4e-07 
ref|ZP_03031916.1|  fructose-bisphosphate aldolase, class II [...  58.9    4e-07 
ref|YP_002313482.1|  Ketose-bisphosphate aldolase, class-II:Fr...  58.9    4e-07  Gene info
ref|YP_001515845.1|  fructose-bisphosphate aldolase, class II ...  58.9    4e-07  Gene info
ref|YP_671630.1|  putative fructose-bisphosphate aldolase clas...  58.9    4e-07  Gene info
ref|NP_907459.1|  fructose-bisphosphate aldolase [Wolinella su...  58.9    5e-07  Gene info
ref|NP_754071.1|  hypothetical protein c2177 [Escherichia coli...  58.9    5e-07  Gene info
ref|YP_001745959.1|  fructose-bisphosphate aldolase, class II ...  58.9    5e-07  Gene info
gb|EDY89572.1|  fructose-bisphosphate aldolase, class II, Calv...  58.5    5e-07 
ref|XP_001401065.1|  hypothetical protein An14g04410 [Aspergil...  58.5    5e-07  Gene info
ref|XP_957478.1|  hypothetical protein NCU04401 [Neurospora cr...  58.5    5e-07  Gene info
ref|ZP_02011949.1|  Fructose-bisphosphate aldolase [Opitutacea...  58.5    5e-07 
ref|ZP_02620175.1|  fructose-1,6-bisphosphate aldolase, class ...  58.5    6e-07 
ref|XP_001818674.1|  hypothetical protein [Aspergillus oryzae ...  58.5    6e-07  Gene info
ref|ZP_01452851.1|  Fructose-bisphosphate aldolase, class II, ...  58.5    6e-07 
ref|NP_894370.1|  fructose-1,6-bisphosphate aldolase [Prochlor...  58.5    6e-07  Gene info
ref|YP_001224868.1|  fructose-1,6-bisphosphate aldolase [Synec...  58.5    6e-07  Gene info
ref|YP_002215838.1|  fructose-bisphosphate aldolase, class II ...  58.5    6e-07  Gene info
ref|NP_219099.1|  fructose-bisphosphate aldolase [Treponema pa...  58.2    6e-07  Gene info
ref|YP_002226785.1|  putative aldolase [Salmonella enterica su...  58.2    7e-07  Gene info
ref|XP_001397325.1|  hypothetical protein An16g00110 [Aspergil...  58.2    7e-07  Gene info
ref|YP_207215.1|  fructose-1,6-bisphosphate aldolase [Neisseri...  58.2    7e-07  Gene info
ref|YP_001049224.1|  fructose-bisphosphate aldolase, class II ...  58.2    8e-07  Gene info
ref|XP_001592161.1|  hypothetical protein SS1G_06400 [Scleroti...  58.2    8e-07  Gene info
ref|YP_946077.1|  putative fructose/tagatose bisphosphate aldo...  57.8    8e-07  Gene info
ref|ZP_02420420.1|  hypothetical protein ANACAC_03037 [Anaeros...  57.8    9e-07 
ref|YP_001658261.1|  fructose-1,6-bisphosphate aldolase [Micro...  57.8    9e-07  Gene info
ref|ZP_01548961.1|  fructose-bisphosphate aldolase [Stappia ag...  57.8    9e-07 
ref|ZP_02085107.1|  hypothetical protein CLOBOL_02640 [Clostri...  57.8    9e-07 
ref|YP_867114.1|  fructose-bisphosphate aldolase [Magnetococcu...  57.8    9e-07  Gene info
ref|NP_896884.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  57.8    1e-06  Gene info
ref|YP_829776.1|  fructose-bisphosphate aldolase [Arthrobacter...  57.8    1e-06  Gene info
ref|YP_001233961.1|  fructose-bisphosphate aldolase, class II ...  57.8    1e-06  Gene info
ref|ZP_03297341.1|  hypothetical protein COLSTE_01236 [Collins...  57.8    1e-06 
ref|ZP_02685871.1|  fructose-bisphosphate aldolase, class II [...  57.8    1e-06 
ref|YP_001920646.1|  probable fructose-bisphosphate aldolase 2...  57.4    1e-06  Gene info
ref|YP_216297.1|  hypothetical protein SC1310 [Salmonella ente...  57.4    1e-06  Gene info
ref|ZP_01124183.1|  fructose-bisphosphate aldolase [Synechococ...  57.4    1e-06 
gb|AAF24135.1|AF129168_8  D-fructose-1,6-biphosphate aldolase ...  57.4    1e-06 
ref|YP_562097.1|  fructose-1,6-bisphosphate aldolase [Shewanel...  57.4    1e-06  Gene info
ref|ZP_02438905.1|  hypothetical protein CLOSS21_01360 [Clostr...  57.4    1e-06 
ref|ZP_02658260.1|  fructose-bisphosphate aldolase, class II [...  57.4    1e-06 
ref|YP_001009235.1|  fructose-1,6-bisphosphate aldolase [Proch...  57.4    1e-06  Gene info
ref|ZP_01867754.1|  Fructose/tagatose bisphosphate aldolase [V...  57.4    1e-06 
ref|NP_756346.1|  putative aldolase [Escherichia coli CFT073] ...  57.4    1e-06  Gene info
ref|YP_397285.1|  fructose-1,6-bisphosphate aldolase [Prochlor...  57.4    1e-06  Gene info
ref|XP_001216212.1|  conserved hypothetical protein [Aspergill...  57.4    1e-06  Gene info
ref|NP_892899.1|  fructose-1,6-bisphosphate aldolase [Prochlor...  57.4    1e-06  Gene info
ref|YP_002000667.1|  fructose-bisphosphate aldolase [Neisseria...  57.0    1e-06  Gene info
ref|ZP_02080396.1|  hypothetical protein CLOLEP_01849 [Clostri...  57.0    1e-06 
ref|ZP_01625570.1|  fructose-bisphosphate aldolase [marine gam...  57.0    1e-06 
ref|ZP_02056469.1|  fructose-bisphosphate aldolase, class II, ...  57.0    2e-06 
ref|NP_283400.1|  fructose-1,6-bisphosphate aldolase [Neisseri...  57.0    2e-06  Gene info
ref|ZP_02088832.1|  hypothetical protein CLOBOL_06388 [Clostri...  57.0    2e-06 
ref|YP_590689.1|  fructose-1,6-bisphosphate aldolase [Acidobac...  57.0    2e-06  Gene info
ref|ZP_03002548.1|  fructose-bisphosphate aldolase, class II [...  57.0    2e-06 
ref|YP_669625.1|  hypothetical protein ECP_1721 [Escherichia c...  57.0    2e-06  Gene info
ref|NP_416287.1|  predicted aldolase [Escherichia coli str. K-...  56.6    2e-06  Gene info
ref|YP_540976.1|  putative membrane protein YdjI [Escherichia ...  56.6    2e-06  Gene info
ref|NP_288209.1|  putative aldolase [Escherichia coli O157:H7 ...  56.6    2e-06  Gene info
ref|YP_001743476.1|  fructose-bisphosphate aldolase [Escherich...  56.6    2e-06  Gene info
ref|YP_002049476.1|  fructose-bisphosphate aldolase [Paulinell...  56.6    2e-06  Gene info
ref|YP_405533.1|  hypothetical protein SDY_4132 [Shigella dyse...  56.6    2e-06  Gene info
ref|NP_442114.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  56.6    2e-06  Gene info
ref|NP_707340.1|  putative aldolase [Shigella flexneri 2a str....  56.6    2e-06  Gene info
ref|XP_001827494.1|  hypothetical protein [Aspergillus oryzae ...  56.6    2e-06  Gene info
ref|ZP_02862938.1|  hypothetical protein ANASTE_02165 [Anaerof...  56.6    2e-06 
ref|YP_688939.1|  putative aldolase [Shigella flexneri 5 str. ...  56.6    2e-06  Gene info
emb|CAJ90024.1|  putative tagatose-bisphosphate aldolase [Stre...  56.6    2e-06 
ref|YP_001887299.1|  fructose-1,6-bisphosphate aldolase, class...  56.2    2e-06  Gene info
gb|EDY90552.1|  fructose-bisphosphate aldolase, class II, Calv...  56.2    2e-06 
ref|YP_579950.1|  fructose-1,6-bisphosphate aldolase [Psychrob...  56.2    2e-06  Gene info
ref|YP_062759.1|  tagatose-bisphosphate aldolase [Leifsonia xy...  56.2    2e-06  Gene info
ref|YP_376807.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  56.2    2e-06  Gene info
ref|ZP_03173905.1|  tagatose-bisphosphate aldolase [Streptomyc...  56.2    3e-06  Gene info
ref|YP_264001.1|  fructose-1,6-bisphosphate aldolase [Psychrob...  56.2    3e-06  Gene info
ref|YP_730907.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  56.2    3e-06  Gene info
emb|CAP95890.1|  Pc21g09930 [Penicillium chrysogenum Wisconsin...  56.2    3e-06 
ref|NP_923698.1|  fructose-1,6-bisphosphate aldolase [Gloeobac...  56.2    3e-06  Gene info
ref|ZP_02468737.1|  fructose-1,6-bisphosphate aldolase [Burkho...  56.2    3e-06 
ref|XP_001274327.1|  fructose-bisphosphate aldolase, putative ...  56.2    3e-06  Gene info
ref|YP_382157.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  55.8    3e-06  Gene info
ref|NP_274865.1|  fructose-1,6-bisphosphate aldolase [Neisseri...  55.8    3e-06  Gene info
ref|ZP_01545759.1|  fructose-bisphosphate aldolase [Stappia ag...  55.8    3e-06 
gb|EDY90479.1|  fructose-bisphosphate aldolase, class II, Calv...  55.8    4e-06 
ref|NP_768161.1|  fructose-1,6-bisphosphate aldolase [Bradyrhi...  55.8    4e-06  Gene info
ref|YP_928628.1|  fructose-1,6-bisphosphate aldolase [Shewanel...  55.8    4e-06  Gene info
ref|ZP_02418782.1|  hypothetical protein ANACAC_01366 [Anaeros...  55.8    4e-06 
ref|ZP_01127613.1|  Fructose-bisphosphate aldolase, class II, ...  55.5    4e-06 
ref|YP_001044816.1|  fructose-1,6-bisphosphate aldolase [Rhodo...  55.5    4e-06  Gene info
gb|EDX73151.1|  fructose-bisphosphate aldolase, class II, Calv...  55.5    4e-06 
ref|YP_840903.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  55.5    4e-06  Gene info
ref|YP_354364.1|  fructose-1,6-bisphosphate aldolase [Rhodobac...  55.5    4e-06  Gene info
ref|YP_825188.1|  fructose-1,6-bisphosphate aldolase [Solibact...  55.5    4e-06  Gene info
ref|ZP_01223384.1|  fructose-bisphosphate aldolase, class II [...  55.5    4e-06 
gb|AAC43445.1|  fructose-1,6-bisphosphate aldolase                 55.5    5e-06 
ref|NP_950424.1|  fructose/tagatose bisphosphate aldolase [Oni...  55.5    5e-06  Gene info
ref|ZP_03181362.1|  tagatose-bisphosphate aldolase [Streptomyc...  55.5    5e-06 
ref|ZP_01867069.1|  hypothetical fructose-1,6-bisphosphate ald...  55.1    5e-06 
ref|NP_437398.1|  fructose-1,6-bisphosphate aldolase [Sinorhiz...  55.1    6e-06  Gene info
ref|NP_681166.1|  fructose-1,6-bisphosphate aldolase [Thermosy...  55.1    6e-06  Gene info
ref|YP_484571.1|  fructose-1,6-bisphosphate aldolase [Rhodopse...  55.1    6e-06  Gene info
ref|ZP_03269998.1|  fructose-bisphosphate aldolase, class II, ...  55.1    6e-06 
ref|ZP_01045339.1|  Fructose-bisphosphate aldolase, class II, ...  55.1    7e-06 
ref|ZP_03138678.1|  ketose-bisphosphate aldolase [Cyanothece s...  54.7    7e-06 
ref|NP_949976.1|  fructose-1,6-bisphosphate aldolase [Rhodopse...  54.7    7e-06  Gene info
ref|NP_867402.2|  fructose-1,6-bisphosphate aldolase [Rhodopir...  54.7    8e-06  Gene info
emb|CAD74948.1|  fructose-1,6-bisphosphate aldolase [Rhodopire...  54.7    8e-06  Gene info
ref|YP_947243.1|  putative fructose/tagatose bisphosphate aldo...  54.7    8e-06  Gene info
ref|YP_001236642.1|  fructose-1,6-bisphosphate aldolase [Brady...  54.7    9e-06  Gene info
ref|YP_001734604.1|  fructose-bisphosphate aldolase, class II ...  54.7    9e-06  Gene info
ref|YP_001663533.1|  ketose-bisphosphate aldolase [Thermoanaer...  54.3    9e-06  Gene info
ref|YP_456743.1|  fructose bisphosphate aldolase [Aster yellow...  54.3    1e-05  Gene info
ref|YP_568192.1|  fructose-1,6-bisphosphate aldolase [Rhodopse...  54.3    1e-05  Gene info
ref|NP_422044.1|  fructose-1,6-bisphosphate aldolase [Caulobac...  54.3    1e-05  Gene info
ref|ZP_02420069.1|  hypothetical protein ANACAC_02672 [Anaeros...  53.9    1e-05 
ref|YP_476616.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  53.9    1e-05  Gene info
emb|CAP86304.1|  Pc20g09750 [Penicillium chrysogenum Wisconsin...  53.9    1e-05 
ref|YP_132139.1|  fructose-1,6-bisphosphate aldolase [Photobac...  53.9    1e-05  Gene info
ref|ZP_02692334.1|  hypothetical fructose-1,6-bisphosphate ald...  53.9    1e-05 
ref|ZP_02433242.1|  hypothetical protein CLOSCI_03513 [Clostri...  53.9    1e-05 
ref|NP_820758.1|  fructose-bisphosphate aldolase, class II [Co...  53.9    1e-05  Gene info
ref|ZP_03136260.1|  fructose-bisphosphate aldolase, class II, ...  53.5    2e-05 
ref|YP_001313413.1|  fructose-1,6-bisphosphate aldolase [Sinor...  53.5    2e-05  Gene info
ref|XP_001937245.1|  fructose-bisphosphate aldolase [Pyrenopho...  53.5    2e-05  Gene info
ref|YP_723580.1|  fructose-1,6-bisphosphate aldolase [Trichode...  53.5    2e-05  Gene info
ref|YP_001925022.1|  fructose-bisphosphate aldolase, class II,...  53.5    2e-05  Gene info
ref|YP_474930.1|  fructose-1,6-bisphosphate aldolase [Synechoc...  53.5    2e-05  Gene info
ref|ZP_00989234.1|  Fructose-bisphosphate aldolase I [Vibrio s...  53.5    2e-05 
ref|YP_001168905.1|  fructose-1,6-bisphosphate aldolase [Rhodo...  53.1    2e-05  Gene info
ref|XP_001836298.1|  hypothetical protein CC1G_06383 [Coprinop...  53.1    2e-05  Gene info
ref|YP_319297.1|  fructose-1,6-bisphosphate aldolase [Nitrobac...  53.1    2e-05  Gene info
ref|ZP_03211168.1|  Fructose/tagatose bisphosphate aldolase [L...  53.1    2e-05 
ref|ZP_01629412.1|  fructose-bisphosphate aldolase [Nodularia ...  53.1    2e-05 
ref|YP_571544.1|  fructose-1,6-bisphosphate aldolase [Nitrobac...  53.1    2e-05  Gene info
ref|YP_001550865.1|  fructose-1,6-bisphosphate aldolase [Proch...  52.8    3e-05  Gene info
ref|YP_001532609.1|  ketose-bisphosphate aldolase [Dinoroseoba...  52.8    3e-05  Gene info
emb|CAB46249.1|  fructose-1,6-bisphosphat aldolase class II [C...  52.8    3e-05 
ref|YP_002132031.1|  FbaA, fructose-bisphosphate aldolase, cla...  52.8    3e-05  Gene info
ref|ZP_01080195.1|  Fructose-1,6-bisphosphate aldolase class I...  52.8    3e-05 
ref|YP_001802773.1|  fructose-1,6-bisphosphate aldolase [Cyano...  52.8    3e-05  Gene info
ref|YP_001471329.1|  ketose-bisphosphate aldolase [Thermotoga ...  52.8    3e-05  Gene info
ref|ZP_01729481.1|  fructose-bisphosphate aldolase [Cyanothece...  52.8    3e-05 
ref|YP_532763.1|  fructose-1,6-bisphosphate aldolase [Rhodopse...  52.4    3e-05  Gene info
ref|ZP_03273902.1|  fructose-bisphosphate aldolase, class II, ...  52.4    4e-05 
ref|ZP_01618762.1|  fructose-1,6-bisphosphate aldolase [Lyngby...  52.4    4e-05 
ref|YP_001371441.1|  fructose-1,6-bisphosphate aldolase [Ochro...  52.4    4e-05  Gene info
ref|NP_107629.1|  fructose-1,6-bisphosphate aldolase [Mesorhiz...  52.0    5e-05  Gene info
ref|YP_001203269.1|  fructose-1,6-bisphosphate aldolase [Brady...  52.0    5e-05  Gene info
ref|ZP_01220438.1|  hypothetical fructose-1,6-bisphosphate ald...  52.0    5e-05 
ref|XP_001390772.1|  unnamed protein product [Aspergillus nige...  51.6    6e-05  Gene info
ref|YP_781602.1|  fructose-1,6-bisphosphate aldolase [Rhodopse...  51.6    6e-05  Gene info
ref|YP_831206.1|  fructose-bisphosphate aldolase [Arthrobacter...  51.6    6e-05  Gene info
ref|ZP_00404841.1|  COG0191: Fructose/tagatose bisphosphate al...  51.6    7e-05 
ref|XP_001771368.1|  predicted protein [Physcomitrella patens ...  51.6    7e-05  UniGene infoGene info
ref|ZP_02438320.1|  hypothetical protein CLOSS21_00771 [Clostr...  51.2    8e-05 
ref|ZP_03153793.1|  fructose-bisphosphate aldolase, class II, ...  51.2    8e-05 
ref|YP_002008336.1|  FRUCTOSE-BISPHOSPHATE ALDOLASE (RUBISCO o...  51.2    8e-05  Gene info
ref|NP_943051.1|  fructose-1,6-bisphosphate aldolase [Ralstoni...  51.2    9e-05  Gene info
ref|YP_001594811.1|  fructose-1,6-bisphosphate aldolase [Bruce...  51.2    1e-04  Gene info
ref|ZP_01086261.1|  fructose-bisphosphate aldolase [Synechococ...  51.2    1e-04 
ref|NP_700039.1|  fructose-1,6-bisphosphate aldolase [Brucella...  51.2    1e-04  Gene info
ref|XP_001548904.1|  hypothetical protein BC1G_12564 [Botryoti...  50.8    1e-04  Gene info
ref|YP_001242721.1|  fructose-1,6-bisphosphate aldolase [Brady...  50.8    1e-04  Gene info
ref|ZP_02977035.1|  fructose-bisphosphate aldolase, class II, ...  50.8    1e-04 
ref|ZP_03145871.1|  fructose-bisphosphate aldolase, class II, ...  50.8    1e-04 
ref|ZP_00516753.1|  Ketose-bisphosphate aldolase, class-II:Fru...  50.8    1e-04 
ref|ZP_02942810.1|  fructose-bisphosphate aldolase, class II, ...  50.8    1e-04 
ref|XP_001405585.1|  hypothetical protein MGG_13895 [Magnaport...  50.4    1e-04  Gene info
ref|ZP_00629445.1|  Ketose-bisphosphate aldolase, class-II:Fru...  50.4    1e-04  Gene info
ref|ZP_01089110.1|  fructose-1,6-bisphosphate aldolase [Blasto...  50.4    1e-04 
ref|ZP_01471998.1|  fructose-bisphosphate aldolase [Synechococ...  50.4    2e-04 
ref|ZP_01866674.1|  tagatose 1,6-diphosphate aldolase [Vibrio ...  50.4    2e-04 
ref|YP_001257802.1|  fructose-1,6-bisphosphate aldolase [Bruce...  50.1    2e-04  Gene info
ref|YP_223153.1|  fructose-1,6-bisphosphate aldolase [Brucella...  50.1    2e-04  Gene info
ref|ZP_02044270.1|  hypothetical protein ACTODO_01129 [Actinom...  50.1    2e-04 
ref|NP_541401.1|  fructose-1,6-bisphosphate aldolase [Brucella...  50.1    2e-04  Gene info
ref|YP_001227749.1|  fructose-1,6-bisphosphate aldolase [Synec...  49.7    2e-04  Gene info
ref|YP_001242214.1|  fructose-1,6-bisphosphate aldolase [Brady...  49.7    3e-04  Gene info
ref|YP_001792770.1|  fructose-bisphosphate aldolase, class II ...  49.7    3e-04  Gene info
ref|NP_436732.1|  fructose-1,6-bisphosphate aldolase [Sinorhiz...  49.3    4e-04  Gene info
gb|AAF25378.1|AF211846_5  fructose-1,6-/sedoheptulose-1,7-bisp...  48.9    4e-04 
gb|AAC43448.1|  fructose-1,6-bisphosphate aldolase                 48.9    4e-04 
ref|YP_001203773.1|  fructose-1,6-bisphosphate aldolase [Brady...  48.9    4e-04  Gene info
ref|YP_001312666.1|  fructose-1,6-bisphosphate aldolase [Sinor...  48.9    4e-04  Gene info
ref|NP_875247.1|  fructose-1,6-bisphosphate aldolase [Prochlor...  48.9    5e-04  Gene info
ref|YP_001170177.1|  fructose-1,6-bisphosphate aldolase [Rhodo...  48.9    5e-04  Gene info
ref|ZP_00048684.1|  COG0191: Fructose/tagatose bisphosphate al...  48.9    5e-04 
ref|YP_805630.1|  fructose/tagatose bisphosphate aldolase [Lac...  48.5    5e-04  Gene info
ref|ZP_02873994.1|  putative aldolase [candidate division TM7 ...  48.5    5e-04 
ref|YP_001108414.1|  tagatose-bisphosphate aldolase [Saccharop...  48.5    5e-04  Gene info
ref|XP_001936880.1|  fructose-bisphosphate aldolase [Pyrenopho...  48.5    5e-04  Gene info
ref|YP_982218.1|  fructose-1,6-bisphosphate aldolase [Polaromo...  48.5    6e-04  Gene info
ref|ZP_02544512.1|  putative aldolase [candidate division TM7 ...  48.5    6e-04 
ref|XP_001791503.1|  hypothetical protein SNOG_00832 [Phaeosph...  48.5    6e-04  Gene info
ref|ZP_02087870.1|  hypothetical protein CLOBOL_05421 [Clostri...  48.1    7e-04 
ref|YP_048465.1|  sugar-bisphosphate aldolase [Pectobacterium ...  48.1    7e-04  Gene info
ref|XP_569553.1|  hypothetical protein [Cryptococcus neoforman...  48.1    7e-04  Gene info
ref|YP_946168.1|  putative fructose/tagatose bisphosphate aldo...  48.1    7e-04  Gene info
ref|ZP_02166750.1|  ketose-bisphosphate aldolase, class-II [Ho...  47.8    0.001 
ref|XP_388220.1|  hypothetical protein FG08044.1 [Gibberella z...  47.8    0.001  Gene info
ref|ZP_02418119.1|  hypothetical protein ANACAC_00687 [Anaeros...  47.8    0.001 
gb|AAA26114.1|  cfxA                                               47.4    0.001 
sp|P27995.1|ALF1_RHOSH  RecName: Full=Fructose-bisphosphate al...  47.4    0.001 
ref|ZP_00963865.1|  fructose-bisphosphate aldolase [Sulfitobac...  47.4    0.001 
gb|AAO18429.1|  fructose 1,6 bisphosphate aldolase [Rhizobium ...  47.0    0.002 
ref|XP_001803443.1|  hypothetical protein SNOG_13232 [Phaeosph...  47.0    0.002  Gene info
ref|ZP_01442789.1|  Fructose-bisphosphate aldolase I [Roseovar...  47.0    0.002 
ref|ZP_01811400.1|  ketose-bisphosphate aldolase, class-II [ca...  46.6    0.002 
ref|ZP_01810994.1|  ketose-bisphosphate aldolase, class-II [ca...  46.2    0.003 
ref|YP_001045853.1|  fructose-1,6-bisphosphate aldolase [Rhodo...  46.2    0.003  Gene info
ref|YP_354779.1|  fructose-1,6-bisphosphate aldolase [Rhodobac...  46.2    0.003  Gene info
ref|YP_764707.1|  fructose-1,6-bisphosphate aldolase [Rhizobiu...  46.2    0.003  Gene info
ref|YP_583644.1|  fructose-bisphosphate aldolase [Ralstonia me...  45.4    0.004  Gene info
ref|YP_885301.1|  tagatose-1,6-bisphosphate aldolase GatY [Myc...  45.4    0.004  Gene info
ref|XP_001816803.1|  hypothetical protein [Aspergillus oryzae ...  45.1    0.005  Gene info
ref|YP_015619.1|  fructose-1,6-bisphosphate aldolase [Oligotro...  45.1    0.006  Gene info
ref|YP_509359.1|  fructose-bisphosphate aldolase [Jannaschia s...  45.1    0.007  Gene info
emb|CAB70623.1|  putative fructose-1,6-biphosphate aldolase [S...  44.3    0.010 
emb|CAC67555.1|  putative fructose-1,6-biphosphate aldolase [S...  44.3    0.010 
ref|NP_769224.1|  fructose-1,6-bisphosphate aldolase [Bradyrhi...  43.9    0.013  Gene info
dbj|BAA75221.1|  fructose 1,6-bisphosphate aldolase [Hydrogeno...  43.5    0.018 
ref|XP_001733402.1|  fructose-bisphosphate aldolase [Entamoeba...  43.1    0.021  Gene info
ref|ZP_01004054.1|  fructose-1,6-bisphosphate aldolase, class ...  43.1    0.024 
ref|ZP_02140716.1|  fructose-bisphosphate aldolase, putative [...  42.7    0.031 
gb|ABY64906.1|  fructose-bisphosphate aldolase [Streptococcus ...  42.7    0.033 
dbj|BAB91404.1|  putative aldolase [Vibrio vulnificus]             42.4    0.042 
dbj|BAB64348.1|  fructose-bisphosphate aldolase homologue [Str...  42.0    0.047 
ref|YP_611585.1|  fructose-bisphosphate aldolase [Silicibacter...  41.2    0.096  Gene info
gb|EDY77618.1|  Fructose-bisphosphate aldolase class-II superf...  41.2    0.099 
ref|YP_001361905.1|  ketose-bisphosphate aldolase [Kineococcus...  40.8    0.12   Gene info
ref|YP_001236647.1|  fructose-bisphosphate aldolase [Bradyrhiz...  40.4    0.14   Gene info
ref|ZP_00994720.1|  tagatose-bisphosphate aldolase [Janibacter...  40.0    0.20  
ref|ZP_01447511.1|  fructose-1,6-bisphosphate aldolase, class ...  40.0    0.21  
ref|ZP_01752261.1|  ketose-bisphosphate aldolase, class-II [Ro...  39.7    0.26  
ref|ZP_00050759.1|  COG0191: Fructose/tagatose bisphosphate al...  39.3    0.38  
ref|ZP_01742908.1|  Fructose-bisphosphate aldolase [Rhodobacte...  38.9    0.47  
ref|ZP_01227929.1|  fructose-bisphosphate aldolase [Aurantimon...  37.7    0.96  
ref|YP_680633.1|  fructose-bisphosphate aldolase, putative [Ro...  37.4    1.2    Gene info
ref|ZP_01998331.1|  Fructose-bisphosphate aldolase [Beggiatoa ...  37.4    1.2   
ref|YP_001197706.1|  fructose-bisphosphate aldolase [Streptoco...  37.4    1.3    Gene info
ref|ZP_02957189.1|  Fructose-bisphosphate aldolase [Methylocel...  37.4    1.3   
ref|YP_300195.1|  beta-D-galactosidase [Staphylococcus saproph...  36.6    2.0    Gene info
gb|EDZ41681.1|  fructose-bisphosphate aldolase [Rhodobacterale...  36.6    2.1   
ref|YP_920243.1|  xylose isomerase domain-containing protein [...  36.2    2.8    Gene info
ref|ZP_03342857.1|  tagatose-bisphosphate aldolase [Salmonella...  35.0    5.8   
ref|YP_421177.1|  parvulin-like peptidyl-prolyl isomerase [Mag...  35.0    7.1    Gene info
sp|Q8VUZ6.1|PHLC_CLOSO  RecName: Full=Phospholipase C; Short=P...  34.7    7.8   
ref|YP_001714943.1|  hypothetical protein ABAYE3162 [Acinetoba...  34.7    8.4    Gene info
ref|ZP_01165271.1|  Response regulator [Oceanospirillum sp. ME...  34.7    9.2  

__________________________________________________________________________________________________

c) Les 10 premiers alignements deux à deux

>ref|ZP_00951104.1|  fructose-bisphosphate aldolase [Croceibacter atlanticus HTCC2559]
 gb|EAP86812.1|  fructose-bisphosphate aldolase [Croceibacter atlanticus HTCC2559]
Length=355

 Score =  474 bits (1219),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 226/275 (82%), Positives = 245/275 (89%), Gaps = 0/275 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GG  FNAGK LSNEN++AAIAG +AGAKH+HELA  YGATVILHTDHCAKKLLPWIDGLL
Sbjct  61   GGGQFNAGKGLSNENEKAAIAGCVAGAKHVHELAEAYGATVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE FY E GKSL+SSHMIDLSEEP+EENIEICK YL RM KM MTLEIELGITGGEED
Sbjct  121  DASEKFYNETGKSLYSSHMIDLSEEPLEENIEICKEYLARMSKMGMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDN+DVD SKLYTQPEEVAYAYEELSK+SDQFTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNTDVDDSKLYTQPEEVAYAYEELSKVSDQFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ +IS KYN+  N +DFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQ+AFTEG RDY+
Sbjct  241  SQEYISNKYNVEHNHIDFVFHGGSGSTVEEIREAIGYGVIKMNIDTDLQYAFTEGCRDYI  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
             D  +Y+  QIGNP+G D PNKKYYDPRKW+R GE
Sbjct  301  LDKKDYISAQIGNPDGDDIPNKKYYDPRKWVREGE  335


>ref|ZP_01733428.1|  fructose-bisphosphate aldolase [Flavobacteria bacterium BAL38]
 gb|EAZ96497.1|  fructose-bisphosphate aldolase [Flavobacteria bacterium BAL38]
Length=379

 Score =  468 bits (1203),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 222/275 (80%), Positives = 245/275 (89%), Gaps = 0/275 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSNEN+++AI GA+AGAKHIH LA  YGATVILHTDHCAKKLLPWIDGLL
Sbjct  85   GGAQFNAGKGLSNENEKSAILGAVAGAKHIHTLAEAYGATVILHTDHCAKKLLPWIDGLL  144

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE  +AE GK LFSSHMIDLSEEPIEEN+EI K YLERM KM MTLEIELGITGGEED
Sbjct  145  DASEKHFAETGKPLFSSHMIDLSEEPIEENLEISKKYLERMSKMGMTLEIELGITGGEED  204

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSDVD+SKLYTQP+EVAYAYEEL K+S +FTIAA+FGNVHGVYKPGNVKLTPKIL+N
Sbjct  205  GVDNSDVDSSKLYTQPDEVAYAYEELMKVSPRFTIAASFGNVHGVYKPGNVKLTPKILKN  264

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ ++  K+N   N VDFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQFAFTEGIRDYM
Sbjct  265  SQEYVQNKFNTGNNPVDFVFHGGSGSTLEEIREAIGYGVIKMNIDTDLQFAFTEGIRDYM  324

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
             + ++YLR QIG+P+GAD PNKK+YDPRKW+R GE
Sbjct  325  VNKVDYLRTQIGSPDGADSPNKKHYDPRKWIREGE  359


>ref|ZP_01200852.1|  fructose 1, 6-bisphosphate aldolase [Flavobacteria bacterium 
BBFL7]
 gb|EAS20270.1|  fructose 1, 6-bisphosphate aldolase [Flavobacteria bacterium 
BBFL7]
Length=355

 Score =  463 bits (1192),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 218/276 (78%), Positives = 245/276 (88%), Gaps = 0/276 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GG++FNAGK L+N+  +AAI G IAGA+H+H LA  YGATVILHTDHCAKKLLPWIDGLL
Sbjct  61   GGSVFNAGKGLNNDGHRAAILGGIAGAEHVHRLAEAYGATVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASEA + E GKSL+SSHMIDLSEEP+EENIEICK YLERM KMDMTLEIELGITGGEED
Sbjct  121  DASEARFRESGKSLYSSHMIDLSEEPLEENIEICKRYLERMSKMDMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSDVD SKLYTQPEEVAYAYEEL K+SD+FTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNSDVDESKLYTQPEEVAYAYEELKKVSDRFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ +I++KY +  N +DFVFHGGSGST EEI+EAIGYGV+KMNIDTDLQ+AF  G++ YM
Sbjct  241  SQEYITQKYGVEHNHIDFVFHGGSGSTLEEIREAIGYGVVKMNIDTDLQWAFATGVKGYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
              + +YL +QIGNP GAD PNKKYYDPRKWLR+GEE
Sbjct  301  DTNNDYLLSQIGNPTGADAPNKKYYDPRKWLRVGEE  336


>ref|ZP_01059853.1|  fructose-bisphosphate aldolase [Flavobacterium sp. MED217]
 gb|EAQ50321.1|  fructose-bisphosphate aldolase [Leeuwenhoekiella blandensis MED217]
Length=355

 Score =  457 bits (1177),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 228/276 (82%), Positives = 247/276 (89%), Gaps = 0/276 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK  SN+NQQAA+AGAIAGAKH+HELA  YGATVILHTDHCAKKLLPWIDGLL
Sbjct  61   GGAQFNAGKGYSNDNQQAAVAGAIAGAKHVHELAKRYGATVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE +Y EHG SLFSSHMIDLSEEPIEENIE+CK YLERM KM+MTLEIELGITGGEED
Sbjct  121  DASEEYYKEHGHSLFSSHMIDLSEEPIEENIELCKKYLERMSKMEMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSDVD SKLYTQPEEVAYAYEELSK+SDQFTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNSDVDVSKLYTQPEEVAYAYEELSKVSDQFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ +I+EKY + EN +DFVFHGGSGST EEI+E I YGVIKMNIDTDLQ+AFTEGIR+Y 
Sbjct  241  SQEYITEKYGVEENHIDFVFHGGSGSTVEEIREGISYGVIKMNIDTDLQWAFTEGIREYF  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
              + +YL+ QIGNP G D PNKK+YDPR WLR GEE
Sbjct  301  DANADYLQTQIGNPTGEDSPNKKFYDPRVWLRKGEE  336


>ref|ZP_01253293.1|  fructose-bisphosphate aldolase [Psychroflexus torquis ATCC 700755]
 gb|EAS71840.1|  fructose-bisphosphate aldolase [Psychroflexus torquis ATCC 700755]
Length=355

 Score =  457 bits (1175),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 226/276 (81%), Positives = 248/276 (89%), Gaps = 0/276 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSN+N+ AAI GA  GAKH+H+LA  YGATVILHTDHCAKKLLPWIDGLL
Sbjct  61   GGAQFNAGKGLSNDNELAAIKGAATGAKHVHDLAEAYGATVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
               E F+  HGK L+SSHMIDLSEEPIEENIEICKTYLERMKKM MTLEIELG+TGGEED
Sbjct  121  DEGEEFFKVHGKPLYSSHMIDLSEEPIEENIEICKTYLERMKKMGMTLEIELGVTGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDN+D+D+SKLYTQPEEVAYAYEELSK+SDQFTIAAAFGNVHGVYK GNVKLTPKIL+N
Sbjct  181  GVDNTDIDSSKLYTQPEEVAYAYEELSKVSDQFTIAAAFGNVHGVYKSGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ ++S+KYN+ EN +DFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQ+AF EGIRDYM
Sbjct  241  SQEYVSKKYNVEENHIDFVFHGGSGSTVEEIKEAIGYGVIKMNIDTDLQYAFAEGIRDYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
            +DH EY+  QIGNPEG D PNKKYYDPRKWLR GE+
Sbjct  301  SDHAEYVSTQIGNPEGGDVPNKKYYDPRKWLREGEK  336


>ref|YP_860437.1| Gene info fructose-bisphosphate aldolase [Gramella forsetii KT0803]
 emb|CAL65369.1| Gene info fructose-bisphosphate aldolase [Gramella forsetii KT0803]
Length=355

 GENE ID: 4652250 fbaA | fructose-bisphosphate aldolase
[Gramella forsetii KT0803] (10 or fewer PubMed links)

 Score =  456 bits (1173),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 224/275 (81%), Positives = 249/275 (90%), Gaps = 0/275 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSN+N++AAIAG +AGAKH+HE+A +YGATVI+HTDHCAKKLLPWIDGLL
Sbjct  61   GGAQFNAGKGLSNDNEKAAIAGGVAGAKHVHEMAKVYGATVIMHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE  Y + GK L+SSHMIDLSEE +EENIEICK YL+RM KM MTLEIELGITGGEED
Sbjct  121  DASEKHYEQFGKPLYSSHMIDLSEESLEENIEICKKYLKRMSKMGMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDN+DVD+SKLYTQPEEVAYAYEELSK+SDQFTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNTDVDSSKLYTQPEEVAYAYEELSKVSDQFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ +I++KYN+ EN +DFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQ+AF EGIRDYM
Sbjct  241  SQEYITKKYNVEENHIDFVFHGGSGSTVEEIREAIGYGVIKMNIDTDLQYAFLEGIRDYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
             D  +YL NQIGNP+G D PNKKYYDPRKWLR GE
Sbjct  301  GDKKDYLANQIGNPDGDDVPNKKYYDPRKWLREGE  335


>ref|ZP_01053831.1|  fructose-bisphosphate aldolase [Tenacibaculum sp. MED152]
 gb|EAQ40580.1|  fructose-bisphosphate aldolase [Polaribacter dokdonensis MED152]
Length=355

 Score =  453 bits (1165),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 230/276 (83%), Positives = 245/276 (88%), Gaps = 0/276 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSNENQ++AIAG IAGAKH++ELA  YG  VILHTDHCAKKLLPWIDGLL
Sbjct  61   GGAQFNAGKGLSNENQKSAIAGGIAGAKHVNELAEAYGVPVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE  + E GK L+SSHMIDLSEEPIEENIEICK YL RM KM MTLEIELGITGGEED
Sbjct  121  DASEKHFEETGKPLYSSHMIDLSEEPIEENIEICKEYLARMSKMGMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSDVDASKLYTQPEEVAYAYEEL K+S QFTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNSDVDASKLYTQPEEVAYAYEELMKVSPQFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ  I++KY + EN +DFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQFAFTEGIRDYM
Sbjct  241  SQEFITKKYGVEENHIDFVFHGGSGSTLEEIREAIGYGVIKMNIDTDLQFAFTEGIRDYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
                +YL  QIGNP+GADQPNKKYYDPRKWLRLGEE
Sbjct  301  QGKADYLATQIGNPDGADQPNKKYYDPRKWLRLGEE  336


>ref|ZP_01117668.1|  fructose-bisphosphate aldolase [Polaribacter irgensii 23-P]
 gb|EAR13975.1|  fructose-bisphosphate aldolase [Polaribacter irgensii 23-P]
Length=355

 Score =  450 bits (1157),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 224/275 (81%), Positives = 243/275 (88%), Gaps = 0/275 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSN +++AAIAG +AGAKH+HELA  YG  VILHTDHC+KKLLPWIDGLL
Sbjct  61   GGAQFNAGKGLSNVDEKAAIAGGVAGAKHVHELAVAYGVPVILHTDHCSKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE  + E GK L+SSHMIDLSEEPIEENI ICKTYLERM KM MTLEIELGITGGEED
Sbjct  121  DASEKHFKETGKPLYSSHMIDLSEEPIEENIAICKTYLERMSKMGMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSDVD SKLYTQPEEVAYAYEEL K+S QFTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNSDVDVSKLYTQPEEVAYAYEELLKVSPQFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ ++SEKY +  N +DFVFHGGSGST EEI+E+IGYGVIKMNIDTDLQFAFTEGIRDYM
Sbjct  241  SQEYVSEKYKVAHNHIDFVFHGGSGSTLEEIRESIGYGVIKMNIDTDLQFAFTEGIRDYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
              +  YL NQIGNP+GA+QPNKKYYDPRKWLR GE
Sbjct  301  QGNAAYLANQIGNPDGAEQPNKKYYDPRKWLREGE  335


>ref|ZP_02161395.1|  fructose-bisphosphate aldolase [Kordia algicida OT-1]
 gb|EDP97812.1|  fructose-bisphosphate aldolase [Kordia algicida OT-1]
Length=355

 Score =  444 bits (1143),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 224/275 (81%), Positives = 241/275 (87%), Gaps = 0/275 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSNE+Q+AAIAG+IAGAKH+HE+A  YG  VILHTDHCAKKLLPWIDGLL
Sbjct  61   GGAQFNAGKGLSNEDQKAAIAGSIAGAKHVHEMAEAYGVPVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASE  +AE GK L+SSHMIDLSEEP+EENIEICK YL RM KM MTLEIELGITGGEED
Sbjct  121  EASEKHFAETGKPLYSSHMIDLSEEPLEENIEICKEYLARMSKMGMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSDVD SKLYTQPEEVAYAYEEL K+S +FTIAAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNSDVDDSKLYTQPEEVAYAYEELMKVSPRFTIAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ HIS+KYN+  N +DFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQFAF  GIRDYM
Sbjct  241  SQEHISQKYNVGHNHIDFVFHGGSGSTLEEIREAIGYGVIKMNIDTDLQFAFMSGIRDYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
             D  +YL  QIGNP+G D PNKK YDPRKWLR GE
Sbjct  301  LDKKDYLMTQIGNPDGDDIPNKKTYDPRKWLREGE  335


>ref|ZP_01122309.1|  fructose-bisphosphate aldolase [Robiginitalea biformata HTCC2501]
 gb|EAR14300.1|  fructose-bisphosphate aldolase [Robiginitalea biformata HTCC2501]
Length=355

 Score =  444 bits (1141),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 223/276 (80%), Positives = 242/276 (87%), Gaps = 0/276 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA FNAGK LSNE Q+AAI GAIAGA+H+HELA  YGATVILHTDHCAKKLLPWIDGLL
Sbjct  61   GGAQFNAGKGLSNEGQRAAIKGAIAGARHVHELAEAYGATVILHTDHCAKKLLPWIDGLL  120

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             ASEA +   GKSLFSSHMIDLSEEPIEENI +CK YL RM KM+MTLEIELGITGGEED
Sbjct  121  DASEAHFNATGKSLFSSHMIDLSEEPIEENIALCKDYLARMSKMNMTLEIELGITGGEED  180

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDN+DVD SKLYTQPEEVAYAYEELSK+S +FT+AAAFGNVHGVYKPGNVKLTPKIL+N
Sbjct  181  GVDNTDVDDSKLYTQPEEVAYAYEELSKVSHRFTVAAAFGNVHGVYKPGNVKLTPKILKN  240

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ  ISEKY +  N +DFVFHGGSGST EEI+EAIGYGVIKMNIDTDLQ+AF  G+RDYM
Sbjct  241  SQEFISEKYKVGHNHIDFVFHGGSGSTLEEIREAIGYGVIKMNIDTDLQYAFMTGVRDYM  300

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
             +   YL+ QIGNPEGAD PNKKYYDPR WLR GE+
Sbjct  301  KEKEGYLQAQIGNPEGADSPNKKYYDPRVWLREGEK  336


______________________________________________________________________________________________________

II)Blastp contre Swissprot

a)Entête des résultats

Query ID
    lcl|14593
Description
    GOS_677020 Traduction [2-829 sens direct]
Molecule type
    amino acid
Query Length
    276

Database Name
    swissprot
Description
    Non-redundant SwissProt sequences See details
Program
    BLASTP 2.2.19+ Citation

Database	Description	Posted Date
Reference
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference - compositional score matrix adjustment
Stephen F. Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Other reports: Search Summary [Taxonomy reports] [Distance tree of results]
________________________________________________________________________________________________________=
b)Liste complète des hits

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P0AB72.2|ALF_ECO57  RecName: Full=Fructose-bisphosphate ald...   396    6e-110
sp|O52402|ALF_EDWIC  Fructose-bisphosphate aldolase                 394    4e-109
sp|P44429|ALF_HAEIN  Fructose-bisphosphate aldolase                 373    7e-103
sp|A1VYV7|ALF_CAMJJ  Fructose-bisphosphate aldolase                 362    1e-99  Gene info
sp|Q0PAS0.1|ALF_CAMJE  RecName: Full=Fructose-bisphosphate ald...   361    2e-99 
sp|P57526|ALF_BUCAI  Fructose-bisphosphate aldolase class 2 (F...   338    1e-92 
sp|Q8K9B2|ALF_BUCAP  Fructose-bisphosphate aldolase class 2 (F...   337    5e-92 
sp|O51401|ALF_BORBU  Fructose-bisphosphate aldolase                 332    2e-90 
sp|Q89AB6|ALF_BUCBP  Fructose-bisphosphate aldolase class 2 (F...   329    8e-90 
sp|Q9HGY9|ALF_ASPOR  Fructose-bisphosphate aldolase                 329    9e-90 
sp|P53444|ALF_NEUCR  Fructose-bisphosphate aldolase                 327    3e-89 
sp|P14540.3|ALF_YEAST  RecName: Full=Fructose-bisphosphate ald...   315    2e-85  Gene info
sp|P36580|ALF_SCHPO  Fructose-bisphosphate aldolase                 314    4e-85  Gene info
sp|Q9C2U0|ALF_KLULA  Fructose-bisphosphate aldolase                 312    1e-84 
sp|Q8J0N6|ALF_PARBR  Fructose-bisphosphate aldolase                 221    4e-57 
sp|P19537.3|ALF_CORGL  RecName: Full=Fructose-bisphosphate ald...   197    6e-50 
sp|O69600|ALF_MYCLE  Fructose-bisphosphate aldolase                 196    1e-49 
sp|Q9X8R6|ALF_STRCO  Fructose-bisphosphate aldolase                 194    5e-49 
sp|P67476|ALF_MYCBO  Fructose-bisphosphate aldolase >sp|P67475...   193    8e-49 
sp|Q9ZEM7|ALF_STRGB  Fructose-bisphosphate aldolase (FBP aldol...   184    5e-46 
sp|P94453|ALF_BACST  Fructose-bisphosphate aldolase                 102    2e-21 
sp|Q8CNI3|ALF2_STAES  Fructose-bisphosphate aldolase >sp|Q5HM9...  99.0    3e-20  Gene info
sp|P47269|ALF_MYCGE  Fructose-bisphosphate aldolase                97.8    5e-20 
sp|P37192.4|GATY_ECOLI  RecName: Full=Tagatose-1,6-bisphosphat...  97.1    9e-20 
sp|P75089.1|ALF_MYCPN  RecName: Full=Fructose-bisphosphate ald...  97.1    9e-20 
sp|P67478|ALF2_STAAW  Fructose-bisphosphate aldolase >sp|P9907...  95.1    3e-19  Gene info
sp|Q9PPP3|ALF_UREPA  Fructose-bisphosphate aldolase                91.7    4e-18 
sp|P0A4S1|ALF_STRPN  Fructose-bisphosphate aldolase >sp|P0A4S2...  87.4    8e-17 
sp|P0AB76.1|KBAY_ECO57  Tagatose-1,6-bisphosphate aldolase kba...  84.3    6e-16 
sp|P13243.2|ALF_BACSU  RecName: Full=Probable fructose-bisphos...  82.0    3e-15 
sp|P42420.1|IOLJ_BACSU  RecName: Full=6-phospho-5-dehydro-2-de...  80.1    1e-14 
sp|Q8K5W5|ALF_STRP3  Fructose-bisphosphate aldolase                79.7    1e-14 
sp|Q5XA12|ALF_STRP6  Fructose-bisphosphate aldolase                79.7    2e-14 
sp|P68905|ALF_STRP1  Fructose-bisphosphate aldolase >sp|P68906...  79.7    2e-14 
sp|A7ZAH2.1|IOLJ_BACA2  RecName: Full=6-phospho-5-dehydro-2-de...  79.3    2e-14 
sp|Q9KAH3.1|IOLJ_BACHD  RecName: Full=6-phospho-5-dehydro-2-de...  78.6    3e-14 
sp|Q5WKY5.1|IOLJ_BACSK  RecName: Full=6-phospho-5-dehydro-2-de...  78.2    4e-14 
sp|Q703I2|ALF_THECA  Fructose-bisphosphate aldolase (Fructose-...  73.9    9e-13 
sp|Q65D09.1|IOLJ_BACLD  RecName: Full=6-phospho-5-dehydro-2-de...  72.4    2e-12 
sp|Q56815.1|ALF_XANFL  RecName: Full=Fructose-bisphosphate ald...  70.1    1e-11 
sp|Q9I5Y1|ALF_PSEAE  Fructose-bisphosphate aldolase                64.3    6e-10 
sp|O87796|ALF_PSEST  Fructose-bisphosphate aldolase                63.5    1e-09 
sp|Q9ZMQ6|ALF_HELPJ  Fructose-bisphosphate aldolase                60.8    7e-09  Gene info
sp|P56109|ALF_HELPY  Fructose-bisphosphate aldolase                60.8    8e-09 
sp|Q9XDP3|ALF_NOSCO  Fructose-bisphosphate aldolase                60.1    1e-08 
sp|O83668.1|ALF_TREPA  RecName: Full=Fructose-bisphosphate ald...  58.2    4e-08 
sp|P77704.1|YDJI_ECOLI  RecName: Full=Uncharacterized protein ...  56.6    1e-07 
sp|Q55664.3|ALF2_SYNY3  RecName: Full=Fructose-bisphosphate al...  56.6    1e-07  Gene info
sp|Q59100.2|ALF1_RALEH  RecName: Full=Fructose-bisphosphate al...  55.5    3e-07  Gene info
sp|Q59101.2|ALF2_RALEH  RecName: Full=Fructose-bisphosphate al...  51.2    6e-06  Gene info
sp|P58336.1|ALF_RHIME  RecName: Full=Fructose-bisphosphate ald...  49.3    2e-05 
sp|P56888.2|ALF_SINMW  RecName: Full=Fructose-bisphosphate ald...  48.9    3e-05  Gene info
sp|P27995.1|ALF1_RHOSH  RecName: Full=Fructose-bisphosphate al...  47.4    8e-05 
sp|P29271.1|ALF2_RHOSH  RecName: Full=Fructose-bisphosphate al...  46.2    2e-04 
sp|Q8VUZ6.1|PHLC_CLOSO  RecName: Full=Phospholipase C; Short=P...  34.7    0.53  
sp|P50923.1|ALF2_RHOCA  RecName: Full=Fructose-bisphosphate al...  34.3    0.76  
sp|O32164|CSD_BACSU  Probable cysteine desulfurase                 32.3    2.5   
sp|Q5UNX9.1|YR721_MIMIV  RecName: Full=Uncharacterized protein...  32.3    2.8   
sp|Q9V4T3.1|C4AD1_DROME  RecName: Full=Probable cytochrome P45...  32.3    3.0   
sp|Q9K7A0|CSD_BACHD  Probable cysteine desulfurase                 32.3    3.0   
sp|Q892A0.1|TGT_CLOTE  RecName: Full=Queuine tRNA-ribosyltrans...  32.0    3.6   
sp|Q63HN8.2|RN213_HUMAN  RecName: Full=RING finger protein 213     31.6    5.3    Gene info
sp|Q09541.1|YQS6_CAEEL  RecName: Full=Putative subtilase-type ...  31.2    6.9    Gene info
sp|A3D600.1|ACKA_SHEB5  Acetate kinase (Acetokinase) >sp|A6WPT...  30.8    7.7    Gene info
sp|Q9F6D4.1|FABH_STRLI  RecName: Full=3-oxoacyl-[acyl-carrier-...  30.8    8.2   
sp|Q6F155|FMT_MESFL  Methionyl-tRNA formyltransferase              30.4    9.9   

__________________________________________________________________________________________________=

c)Les dix premiers alignements deux à deux

>sp|P0AB72.2|ALF_ECO57  RecName: Full=Fructose-bisphosphate aldolase class 2; AltName: 
Full=Fructose-bisphosphate aldolase class II; Short=FBP aldolase
 sp|P0AB71.2|ALF_ECOLI  RecName: Full=Fructose-bisphosphate aldolase class 2; AltName: 
Full=Fructose-bisphosphate aldolase class II; Short=FBP aldolase
 sp|P0AB73.2|ALF_SHIFL  RecName: Full=Fructose-bisphosphate aldolase class 2; AltName: 
Full=Fructose-bisphosphate aldolase class II; Short=FBP aldolase
Length=359

 Score =  396 bits (1018),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 190/276 (68%), Positives = 226/276 (81%), Gaps = 1/276 (0%)

Query  1    GGAIFNAGKTL-SNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGL  59
            GGA F AGK + S+  Q AAI GAI+GA H+H++A  YG  VILHTDHCAKKLLPWIDGL
Sbjct  64   GGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGL  123

Query  60   LTASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEE  119
            L A E  +A  GK LFSSHMIDLSEE ++ENIEIC  YLERM K+ MTLEIELG TGGEE
Sbjct  124  LDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEE  183

Query  120  DGVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILR  179
            DGVDNS +DAS LYTQPE+V YAY ELSKIS +FTIAA+FGNVHGVYKPGNV LTP ILR
Sbjct  184  DGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILR  243

Query  180  NSQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
            +SQ ++S+K+NLP N+++FVFHGGSGST +EI++++ YGV+KMNIDTD Q+A  EG+ +Y
Sbjct  244  DSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNY  303

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
               +  YL+ Q+GNP+G DQPNKKYYDPR WLR G+
Sbjct  304  YKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQ  339


>sp|O52402|ALF_EDWIC  Fructose-bisphosphate aldolase
Length=358

 Score =  394 bits (1011),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 187/275 (68%), Positives = 220/275 (80%), Gaps = 0/275 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA F AGK L  E QQ AI GAIAGA H+H++A  YG  VILHTDHCAKKLLPW+DGLL
Sbjct  64   GGAAFIAGKGLKLEGQQGAILGAIAGAHHVHQMAEYYGVPVILHTDHCAKKLLPWLDGLL  123

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             A E  +A  GK LFSSHMIDLSEE +EENIEIC  YL RM K+ MTLE+ELG TGGEED
Sbjct  124  DAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSQYLARMSKIGMTLELELGCTGGEED  183

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNS +D S LYTQPE+V YA+ +LS IS +FTIAA+FGNVHGVYKPGNV+LTP IL+N
Sbjct  184  GVDNSHLDNSALYTQPEDVDYAFTKLSAISPRFTIAASFGNVHGVYKPGNVQLTPVILKN  243

Query  181  SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM  240
            SQ ++S+K+NLP N+++FVFHGGSGST  EI+EA+ YGV+KMNIDTD Q+A  EG+  Y 
Sbjct  244  SQEYVSKKHNLPHNSLNFVFHGGSGSTAAEIKEAVSYGVVKMNIDTDTQWATWEGVLKYY  303

Query  241  TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
              +  YL+ Q+GNPEG D+PNKKYYDPR WLR  +
Sbjct  304  KKNEGYLQGQLGNPEGDDKPNKKYYDPRVWLRAAQ  338


>sp|P44429|ALF_HAEIN  Fructose-bisphosphate aldolase
Length=359

 Score =  373 bits (957),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 211/277 (76%), Gaps = 1/277 (0%)

Query  1    GGAIFNAGKTLS-NENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGL  59
            GGA F AGK +      +  + GAIAGAK +H LA  YG  VILHTDH AKKLLPWIDGL
Sbjct  64   GGAAFYAGKGIKPTSGTRPDVLGAIAGAKQVHTLAKEYGVPVILHTDHAAKKLLPWIDGL  123

Query  60   LTASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEE  119
            L A E  +AE G+ LFSSHMIDLSEE +EEN+ IC+ YL RM KM MTLEIE+GITGGEE
Sbjct  124  LDAGEKHFAETGRPLFSSHMIDLSEESMEENMAICREYLARMDKMGMTLEIEIGITGGEE  183

Query  120  DGVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILR  179
            DGVDNSDVD S+LYTQP +V Y Y++L  +S  FT+AAAFGNVHGVYKPGNVKL P IL 
Sbjct  184  DGVDNSDVDESRLYTQPSDVLYVYDQLHPVSPNFTVAAAFGNVHGVYKPGNVKLKPSILG  243

Query  180  NSQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
             SQ  +S++ NLP   ++FVFHGGSGS++EEI+EAIGYG IKMNIDTD Q+A   GI ++
Sbjct  244  ESQEFVSKERNLPAKPINFVFHGGSGSSREEIREAIGYGAIKMNIDTDTQWASWNGILNF  303

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
               +  YL+ Q+GNPEG D PNKKYYDPR WLR  EE
Sbjct  304  YKANEAYLQGQLGNPEGPDAPNKKYYDPRVWLRKMEE  340


>sp|A1VYV7|ALF_CAMJJ Gene info Fructose-bisphosphate aldolase
Length=354

 GENE ID: 4683407 fbaA | fructose-bisphosphate aldolase
[Campylobacter jejuni subsp. jejuni 81-176]

 Score =  362 bits (928),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/277 (61%), Positives = 214/277 (77%), Gaps = 5/277 (1%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA F AGK   N      + GAI+GAKH+H LA  YG  VILHTDH A+KLLPWIDGL+
Sbjct  63   GGAKFYAGKNCPN----GEVLGAISGAKHVHLLAKAYGVPVILHTDHAARKLLPWIDGLI  118

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             A+  +   HG++LFSSHM+DLSEE +EEN+  C+ YL+++  + + LEIELG TGGEED
Sbjct  119  EANAQYKKTHGQALFSSHMLDLSEESLEENLSTCEVYLQKLDALGVALEIELGCTGGEED  178

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDN+ +D SKLYTQPE+VA AYE L KISD+F+IAA+FGNVHGVYKPGNV L P+IL+N
Sbjct  179  GVDNTGIDNSKLYTQPEDVALAYERLGKISDKFSIAASFGNVHGVYKPGNVSLQPEILKN  238

Query  181  SQTHISEKYNL-PENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
            SQ  + +K+ L  +  ++FVFHGGSGS  ++I+ A+ YGVIKMNIDTD Q+AF +G+R+Y
Sbjct  239  SQKFVKDKFALNSDKPINFVFHGGSGSELKDIKNAVSYGVIKMNIDTDTQWAFWDGVREY  298

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
               +  YL+ QIGNPEG D+PNKKYYDPR WLR GEE
Sbjct  299  ELKNRAYLQGQIGNPEGDDKPNKKYYDPRVWLRSGEE  335


>sp|Q0PAS0.1|ALF_CAMJE  RecName: Full=Fructose-bisphosphate aldolase
Length=354

 Score =  361 bits (927),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/277 (61%), Positives = 214/277 (77%), Gaps = 5/277 (1%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA F AGK   N      + GAI+GAKH+H LA  YG  VILHTDH A+KLLPWIDGL+
Sbjct  63   GGAKFYAGKNCPN----GEVLGAISGAKHVHLLAKAYGVPVILHTDHAARKLLPWIDGLI  118

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
             A+  +   HG++LFSSHM+DLSEE +EEN+  C+ YL+++  + + LEIELG TGGEED
Sbjct  119  EANAQYKKTHGQALFSSHMLDLSEESLEENLSTCEVYLQKLDALGVALEIELGCTGGEED  178

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDN+ +D SKLYTQPE+VA AYE L KISD+F+IAA+FGNVHGVYKPGNV L P+IL+N
Sbjct  179  GVDNTGIDNSKLYTQPEDVALAYERLGKISDKFSIAASFGNVHGVYKPGNVSLQPEILKN  238

Query  181  SQTHISEKYNL-PENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
            SQ  + +K+ L  +  ++FVFHGGSGS  ++I+ A+ YGVIKMNIDTD Q+AF +G+R+Y
Sbjct  239  SQKFVKDKFALNSDKPINFVFHGGSGSELKDIKNAVSYGVIKMNIDTDTQWAFWDGVREY  298

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
               +  YL+ QIGNPEG D+PNKKYYDPR WLR GEE
Sbjct  299  ELKNRAYLQGQIGNPEGDDKPNKKYYDPRVWLRSGEE  335


>sp|P57526|ALF_BUCAI  Fructose-bisphosphate aldolase class 2 (Fructose-bisphosphate 
aldolase class II) (FBP aldolase)
Length=358

 Score =  338 bits (868),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/278 (56%), Positives = 210/278 (75%), Gaps = 3/278 (1%)

Query  1    GGAIFNAG--KTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDG  58
            GGA F AG  K LS ENQ+ AI GA++GA+H+H +A  Y   VILHTDHC K+ L WIDG
Sbjct  63   GGASFIAGYKKKLS-ENQEQAIQGAVSGAQHVHLMAKHYEIPVILHTDHCPKETLSWIDG  121

Query  59   LLTASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGE  118
            LL   + +Y  + + LF+SHMIDLS+E +EENI  CK Y +R+K ++M LEIELG TGGE
Sbjct  122  LLEVGQNYYFNNNRPLFTSHMIDLSKESLEENISTCKKYFKRIKNINMMLEIELGCTGGE  181

Query  119  EDGVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKIL  178
            EDG+DN+ +D   LYTQP++V YAYEEL+ IS  F+IAA+FGN+HGVY+PGN+ L P IL
Sbjct  182  EDGIDNTKIDKKLLYTQPQDVNYAYEELNTISKNFSIAASFGNIHGVYQPGNIDLRPIIL  241

Query  179  RNSQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRD  238
            +NSQ  +S K+NL +N ++ VFHGGSGS  +EI+E+I YGV+KMNIDTD+Q+A  +G+ D
Sbjct  242  KNSQEFVSSKHNLEKNPLNLVFHGGSGSNLKEIKESIQYGVVKMNIDTDIQWAAWKGVLD  301

Query  239  YMTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
            +   + E+L++Q+GN     +PNKKYYDPR W+R  +E
Sbjct  302  FYKQNKEFLQHQLGNTTNKHKPNKKYYDPRTWIRKSQE  339


>sp|Q8K9B2|ALF_BUCAP  Fructose-bisphosphate aldolase class 2 (Fructose-bisphosphate 
aldolase class II) (FBP aldolase)
Length=359

 Score =  337 bits (863),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 211/278 (75%), Gaps = 2/278 (0%)

Query  1    GGAIFNAG--KTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDG  58
            GGA F AG  +T S   +  AI G+I+GA+H+H ++  Y   VILHTDHC+K++LPWIDG
Sbjct  63   GGASFIAGYKRTSSKNPEDQAIQGSISGAQHVHLMSQYYQIPVILHTDHCSKEMLPWIDG  122

Query  59   LLTASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGE  118
            LL   +  Y   GK LF+SHMIDLS+E ++ENI IC  YL+++KK++M LEIELG TGGE
Sbjct  123  LLEEGKKHYKNFGKPLFTSHMIDLSKEHLKENIAICSNYLKKIKKINMILEIELGCTGGE  182

Query  119  EDGVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKIL  178
            EDG+DNS++D   LYTQP++V YAY++LSKIS  FTIAA+FGNVHGVY+PGNV L P IL
Sbjct  183  EDGIDNSNIDKKLLYTQPKDVNYAYKKLSKISTNFTIAASFGNVHGVYQPGNVNLKPNIL  242

Query  179  RNSQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRD  238
            + SQ ++S K+NL +  ++ VFHGGSGS  +EI E+I YG++KMNIDTD+Q+A  +G+ +
Sbjct  243  KESQEYVSTKHNLKKLPLNLVFHGGSGSDLKEIHESIEYGIVKMNIDTDIQWASWKGVFN  302

Query  239  YMTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
            +   + ++L+ QIGN  G + PNKKYYDPR W+R  +E
Sbjct  303  FYKKNKDFLQKQIGNKNGKNIPNKKYYDPRSWIRESQE  340


>sp|O51401|ALF_BORBU  Fructose-bisphosphate aldolase
Length=359

 Score =  332 bits (850),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/276 (58%), Positives = 204/276 (73%), Gaps = 2/276 (0%)

Query  2    GAIFNAGKTLSNENQQ-AAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            G+ F +GK L  E  Q  +I GAI+GA H+H +A  YG  V+LHTDHCAK LLPW++GLL
Sbjct  64   GSAFISGKGLKMEKPQGVSIVGAISGAMHVHLMAEHYGVPVVLHTDHCAKNLLPWVEGLL  123

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
               E +Y++H K LFSSHM+DLSEEPI+ENIEI K +LERM K++M LEIELGITGGEED
Sbjct  124  EYGEKYYSQHKKPLFSSHMLDLSEEPIKENIEISKKFLERMAKIEMFLEIELGITGGEED  183

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GVDNSD    +L++ PE++ Y Y EL K+S  F IAAAFGNVHGVYKPGNVKLTPK+L++
Sbjct  184  GVDNSDRALHELFSTPEDIYYGYSELLKVSPNFQIAAAFGNVHGVYKPGNVKLTPKVLKD  243

Query  181  SQTHISEKYNLP-ENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
             Q ++  K  +     V +VFHGGSGST +EI EA+ YGV+KMNIDTD Q+A  EG+ +Y
Sbjct  244  GQDYVISKTGVNMAKPVSYVFHGGSGSTIDEINEALSYGVVKMNIDTDTQWAAWEGVLNY  303

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGE  275
               +   L+ Q+G+ +  D PNKK+YDPR WLR  E
Sbjct  304  YKKNESRLQGQLGDGKDIDIPNKKFYDPRVWLREAE  339


>sp|Q89AB6|ALF_BUCBP  Fructose-bisphosphate aldolase class 2 (Fructose-bisphosphate 
aldolase class II) (FBP aldolase)
Length=359

 Score =  329 bits (844),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 204/273 (74%), Gaps = 1/273 (0%)

Query  1    GGAIFNAGKTLS-NENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGL  59
            GG+ F +G  L+ N   + AI GA++GA H+H +A  Y   VILHTDHC K +LPWID L
Sbjct  64   GGSNFISGPGLTTNILHKKAIIGALSGANHVHIMAKHYNVPVILHTDHCNKNMLPWIDEL  123

Query  60   LTASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEE  119
            +      +  + K LF+SHMIDLS E ++ NI IC  YLE+M+K++M LEIELG TGGEE
Sbjct  124  INVGTKHFKTYNKPLFTSHMIDLSNEKLDYNINICSKYLEKMRKINMLLEIELGCTGGEE  183

Query  120  DGVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILR  179
            DG++N+ ++ S LYTQP EV YAYE LS +  +F IAA+FGNVHGVYK GNV+LTP IL+
Sbjct  184  DGINNTKINKSLLYTQPNEVNYAYERLSSVGPEFIIAASFGNVHGVYKSGNVRLTPDILK  243

Query  180  NSQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
             SQ ++S+K+NL  N + FVFHGGSGS++++I+++I YGVIKMNIDTD+Q+A  +GI ++
Sbjct  244  KSQNYVSKKHNLSCNPLCFVFHGGSGSSEKDIKKSIKYGVIKMNIDTDIQWATWQGILNF  303

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLR  272
               + +YL NQIGN +  ++PNKKYYDPR W+R
Sbjct  304  YNKNNKYLHNQIGNLDNENKPNKKYYDPRTWIR  336


>sp|Q9HGY9|ALF_ASPOR  Fructose-bisphosphate aldolase
Length=362

 Score =  329 bits (844),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 163/277 (58%), Positives = 208/277 (75%), Gaps = 1/277 (0%)

Query  1    GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL  60
            GGA + AGK +SN+ QQA+IAG IA A +I  LA  YG  V+LHTDHCAKKLLPW+DGLL
Sbjct  67   GGAAYFAGKGVSNDGQQASIAGGIAAAHYIRSLAPAYGIPVVLHTDHCAKKLLPWLDGLL  126

Query  61   TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED  120
               E ++  HG+ LFSSHMIDLSEEP++ NI+    YL+R   M   LE+E+GITGGEED
Sbjct  127  DEDERYFKLHGEPLFSSHMIDLSEEPVDYNIQTTAAYLKRAAPMKQWLEMEIGITGGEED  186

Query  121  GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN  180
            GV+N DVD + LYTQPE++   ++ LS IS  F+IAA FGNVHGVYKPGNVKL P++L+ 
Sbjct  187  GVNNEDVDNNSLYTQPEDILAIHKALSPISPYFSIAAGFGNVHGVYKPGNVKLHPELLKK  246

Query  181  SQTHISEKY-NLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDY  239
             Q ++ EK  +  +  V FVFHGGSGS++EE +EAI YGV+K+N+DTD+QFA+  GIRDY
Sbjct  247  HQAYVKEKIGSNKDKPVFFVFHGGSGSSKEEYKEAISYGVVKVNVDTDMQFAYMSGIRDY  306

Query  240  MTDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE  276
            +    +YL   +GNPEG D+PNKK +DPR W+R GE+
Sbjct  307  ILKKKDYLMTAVGNPEGEDKPNKKSFDPRVWVREGEK  343









---------------------------------------------------------------------------------------------------

ORF finding

PROTOCOLE:
a)SMS ORFinder/sens direct/cadres 1,2&3/min 60 AA/initiation'any codon'/code génétique'standard'
b)SMS ORFinder/sens indirect/cadres 1,2&3/min 60 AA/ initiation 'any codon'/code génétique 'standard'
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:
L'orf le plus grand est le numéro 1 dans le deuxième cadre de lecture du sens direct. 
Cet orf s'étend du nucléotide 2 au nucléotide 829, il esr donc probable qu'il soit codant.
Apres avoir fait l'alignement multiple,on peut estimer qu'il manque environ 60 acides aminés en 5'
de l'orf et environ 20 en 3'.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a)sens direct

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 829.
GGAGGTGCGATTTTCAACGCAGGAAAAACCCTTTCGAATGAAAACCAACAAGCCGCCATT
GCCGGTGCTATTGCCGGTGCCAAACACATCCACGAATTGGCTACATTATACGGAGCAACC
GTTATTCTTCATACCGATCATTGCGCAAAAAAATTATTGCCTTGGATTGACGGTTTATTG
ACCGCCAGCGAAGCCTTTTATGCAGAACACGGAAAATCTTTGTTCAGTTCGCACATGATT
GATCTATCCGAGGAACCCATTGAAGAAAATATCGAGATTTGCAAAACCTATCTTGAACGC
ATGAAGAAAATGGACATGACCCTCGAAATTGAATTGGGAATCACTGGTGGTGAAGAAGAC
GGAGTGGACAACAGCGATGTGGATGCCTCCAAACTCTACACCCAACCCGAGGAAGTGGCC
TATGCCTATGAAGAGCTAAGCAAAATAAGCGATCAATTTACCATTGCCGCCGCCTTTGGA
AATGTACATGGGGTTTACAAGCCTGGGAATGTTAAATTGACGCCCAAGATTTTAAGAAAC
TCTCAAACGCATATCTCAGAGAAATACAACTTGCCCGAAAATACGGTTGACTTTGTATTT
CATGGAGGTTCCGGATCTACGCAAGAAGAAATTCAAGAAGCGATTGGATATGGCGTTATT
AAAATGAACATTGATACCGACCTTCAATTTGCTTTTACTGAAGGAATACGTGACTATATG
ACGGATCATATCGAGTATTTGAGAAATCAAATTGGAAACCCAGAAGGTGCCGATCAACCC
AATAAAAAATATTACGACCCAAGAAAATGGTTGCGCTTGGGAGAAGAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
GGAIFNAGKTLSNENQQAAIAGAIAGAKHIHELATLYGATVILHTDHCAKKLLPWIDGLL
TASEAFYAEHGKSLFSSHMIDLSEEPIEENIEICKTYLERMKKMDMTLEIELGITGGEED
GVDNSDVDASKLYTQPEEVAYAYEELSKISDQFTIAAAFGNVHGVYKPGNVKLTPKILRN
SQTHISEKYNLPENTVDFVFHGGSGSTQEEIQEAIGYGVIKMNIDTDLQFAFTEGIRDYM
TDHIEYLRNQIGNPEGADQPNKKYYDPRKWLRLGEE

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 182.
GAGGTGCGATTTTCAACGCAGGAAAAACCCTTTCGAATGAAAACCAACAAGCCGCCATTG
CCGGTGCTATTGCCGGTGCCAAACACATCCACGAATTGGCTACATTATACGGAGCAACCG
TTATTCTTCATACCGATCATTGCGCAAAAAAATTATTGCCTTGGATTGACGGTTTATTGA


>Translation of ORF number 1 in reading frame 3 on the direct strand.
EVRFSTQEKPFRMKTNKPPLPVLLPVPNTSTNWLHYTEQPLFFIPIIAQKNYCLGLTVY*

____________________________________________________________________________________________________=


b)sens indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 273.
TTCTTCTCCCAAGCGCAACCATTTTCTTGGGTCGTAATATTTTTTATTGGGTTGATCGGC
ACCTTCTGGGTTTCCAATTTGATTTCTCAAATACTCGATATGATCCGTCATATAGTCACG
TATTCCTTCAGTAAAAGCAAATTGAAGGTCGGTATCAATGTTCATTTTAATAACGCCATA
TCCAATCGCTTCTTGAATTTCTTCTTGCGTAGATCCGGAACCTCCATGAAATACAAAGTC
AACCGTATTTTCGGGCAAGTTGTATTTCTCTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
FFSQAQPFSWVVIFFIGLIGTFWVSNLISQILDMIRHIVTYSFSKSKLKVGINVHFNNAI
SNRFLNFFLRRSGTSMKYKVNRIFGQVVFL*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 394 to base 585.
CTCTTCATAGGCATAGGCCACTTCCTCGGGTTGGGTGTAGAGTTTGGAGGCATCCACATC
GCTGTTGTCCACTCCGTCTTCTTCACCACCAGTGATTCCCAATTCAATTTCGAGGGTCAT
GTCCATTTTCTTCATGCGTTCAAGATAGGTTTTGCAAATCTCGATATTTTCTTCAATGGG
TTCCTCGGATAG

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
LFIGIGHFLGLGVEFGGIHIAVVHSVFFTTSDSQFNFEGHVHFLHAFKIGFANLDIFFNG
FLG*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.
---------------------------------------------------------------------------------------------------