GOS 1738020

From Metagenes
Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_650
Annotathon code: GOS_1738020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : UCBL-MIV-2010
Username : p0704449
Annotated on : 2010-10-04 15:16:49
  • wen YAN

Contents

Synopsis

  • Taxonomy: Gammaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1236
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Gammaproteobacteria - Order:
    Bacteria; Proteobacteria; Gammaproteobacteria;

Genomic Sequence

>JCVI_READ_650 GOS_1738020 Genomic DNA
GTCCTGAGGCAACTAGGATTTTCTCATCGGCAACGCCGTCCTGGTTACGGTCTTTTAGGGCATAAACGTTCCCCGCCTTCATTGAGCCCGCATAGACAAT
GCCTTTATCGGATACGGCAATTTCGCGCGCATTTTCAACATCATCAGCAAATAGACTTACGTTAAAGCCTTCGGCAACCGTCAGTTTATCTAAGATATTC
TTGGCCATTGCCGGCGCAGAAATACCACTCAAGACACTGAGAGATAAGAGAGAAACCGCCTTAAAACTGGCTGTTGTGAGTAGTGCGGCGCGTTTTTTAT
GATCCATTGACTCGCATCCTAGTAGGGTAAAATTATTGTCGTACAATTAACTTAGCTTCGTTTAACTTTGTTACGTTACCTTAGATATACCGTATTACCA
AATCCTCTGATTTAGCAGGTCAATCCGACTATGCGCCCCCTTAAGCGATAACTCACTCTCTGTTTGCCATGTACTCAATCCCACATATCGCGCCCTTTGT
AAAATAAGGATGAAAATCTGCTTGAGTTTTTTATCTATCAGCCGATAACTCGATAAAGCACACTTGGCACTCACATCTGTTACGCTATTGAACATAGTTG
AGCGACCGCATTGAAGTATTAAAGGAATCTATCGTGAACATTAATGGATTAAATACTACCGCAAAAAGCGGCGCCTTTAAGTCAGTGTCCAATGCCTATA
TCAACACATCGCCAGCAACCAACGCCTCCACAAGCGAGTCAACAAACTTCGCGACTGAAGAAACCGTCAATATCTCTAGTGCAGGAAGGCAAGCTCTCGC
CACCGAAGTGGGCGCAGCTTTAAGGGGTCAAGCGGCAGAAAAACTGCAACTGACGGAGAGTACTGACACCGAAGAGTCCACATCGATTATCGATGAACAA
ATTAAGCGCATAAAGGAGCAGATCAAAGCATTGCAGGAGATGCTCACTAAGCTCGAAGG

Translation

[752 - 958/959]   indirect strand
>GOS_1738020 Translation [752-958   indirect strand]
MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVADEKILVASG
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

En cherchant le nombre d'ORF par le site SMS,sans ATG au départ,on obtient plusieurs résultats.Mais Blast lui trouve soit ma protéine ne s'aligne pas sur toute la longueur soit il y a pas des homologues.Avec ATG,On trouve la région codante commence bien à la base 752 à 958,avec 69aa, en sens indirect,à la deuxième méthionine de 752 à 958, dans la deuxième phase de lecture.


Grâce aux sites d'INTERPRO,PFam et PROSITE,il ne semble pas y avoir de domaines conservés.


Avec Blast vs NR,on a trouvé un peu près 80 des séquences qui ont un E-value faible et des couvertures élevées, donc Blast indique de nombreuses protéines similaires à cette séquence.Ceux qui appartiennent au groupe des Gamma-Proteobacteria sont des homologues les plus proches de ma séquence.Ensuite le rapport taxonomique,il nous permet de supposer que cette séquence est très proche de l'espèce Shewanella qui fait partie des Gamma-Proteobacteria. Il n'y a pas beaucoup de types de protéines homologues significatifs qui sont trouvées.La plupart de type de protéine est le sorbosone dehydrogenase.


Avec l'alignement multiple,on peut voir que la séquence étudiée commence un peu après les autres, et se finit bien avant.La longueur de notre séquence est très petit.Cela est expliqué par mon ORF commence par le deuxième méthionine(donc incomplète en 5')et qui ne finit pas par un codon stop(incomplète en 3').


Les arbres produits par différentes méthodes sont cohérents entre eux Les arbres.La séquence forme un group de quatre avec Shewanella.La séquence s'intègre parfaitement dans le groupe des gamme-proteobacteria/Shewanella.


En résumé, notre séquence est codante.L'ORF étudiée possède des homologues convaincants de la famille des g-proteobacteria et pourrait jouer un rôle de metabolic process.



ORF finding

PROTOCOLE:

1)SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

2)SMS ORFinder / indirect strand/ frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

3)SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'atg codon' initiation / 'universal' genetic code

4)SMS ORFinder / indirect strand / frames 1, 2 & 3 / min 60 AA / 'atg codon' initiation / 'universal' genetic code


ANALYSE DES RÉSULTATS:


Pour la recherche en sens direct, sans ATG au départ, mon ORF le plus long va de la base 598 à 957 dans la première phase de lecture. Blast lui trouve 10 homologues avec des E-value faibes(<10e-5) et couverture maximum 90% environ,les autrs homologues ont une e-value forte(>10e-5),donc on ne le retiendra pas.


Dans le sens indirect, mon ORF le plus long va de la base 614 à 958 dans la deuxième phase de lecture, il ne commence pas par une méthionine et ne se finit pas par un codon stop.Blast lui trouve un peu près 60 homologues avec des E-value faible(<10e-5) et couverture maximum 88% environ. Comme ma protéine ne s'aligne pas sur toute la longueur. Je refait ma cherche pour les ORF commençant par une méthionine.


Si on cherche les ORF commençant par une méthionine, dans le sens direct, Blast ne lui trouve pas des homologues.On ne la retiendra pas.


Dans le sens indirect, on trouve deux ORF, mon ORF le plus long va de la base 653 à 958 dans la deuxième phase de lecture, commençant par une méthionine mais ne se finissant pas par un codon stop.Blast lui trouve un peu près 60 homologues avec des E-value faible(<10e-5).Mais ma séquence s'aligne avec seulement une séquence à 100% ,les autres sont toutes un peu près 80% 60%.Ma protéine ne commence peut-être pas à la première méthionine (ATG), mais à la deuxième.

Je regarde mon alignement,le premier acide aminé s'aligne correctement est bien une mé.thionine.Donc la région codante commence à la deuxième méthionine de 752 à 958, en sens indirect, dans la deuxième phase de lecture

1)SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code 
RÉSULTATS BRUTS:
ORF Finder results
Results for 959 residue sequence "Untitled" starting "GTCCTGAGGC"
>ORF number 1 in reading frame 1 on the direct strand extends from base 598 to base 957.
TTGAGCGACCGCATTGAAGTATTAAAGGAATCTATCGTGAACATTAATGGATTAAATACT
ACCGCAAAAAGCGGCGCCTTTAAGTCAGTGTCCAATGCCTATATCAACACATCGCCAGCA
ACCAACGCCTCCACAAGCGAGTCAACAAACTTCGCGACTGAAGAAACCGTCAATATCTCT
AGTGCAGGAAGGCAAGCTCTCGCCACCGAAGTGGGCGCAGCTTTAAGGGGTCAAGCGGCA
GAAAAACTGCAACTGACGGAGAGTACTGACACCGAAGAGTCCACATCGATTATCGATGAA
CAAATTAAGCGCATAAAGGAGCAGATCAAAGCATTGCAGGAGATGCTCACTAAGCTCGAA


>Translation of ORF number 1 in reading frame 1 on the direct strand.
LSDRIEVLKESIVNINGLNTTAKSGAFKSVSNAYINTSPATNASTSESTNFATEETVNIS
SAGRQALATEVGAALRGQAAEKLQLTESTDTEESTSIIDEQIKRIKEQIKALQEMLTKLE


No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 96 to base 302.
ACAATGCCTTTATCGGATACGGCAATTTCGCGCGCATTTTCAACATCATCAGCAAATAGA
CTTACGTTAAAGCCTTCGGCAACCGTCAGTTTATCTAAGATATTCTTGGCCATTGCCGGC
GCAGAAATACCACTCAAGACACTGAGAGATAAGAGAGAAACCGCCTTAAAACTGGCTGTT
GTGAGTAGTGCGGCGCGTTTTTTATGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
TMPLSDTAISRAFSTSSANRLTLKPSATVSLSKIFLAIAGAEIPLKTLRDKRETALKLAV
VSSAARFL*


----------------------------------------------------------------------------------------------------------------------------
2)SMS ORFinder / indirect strand/ frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code 
ORF Finder results
Results for 959 residue sequence "Untitled" starting "GTCCTGAGGC"
>ORF number 1 in reading frame 2 on the reverse strand extends from base 332 to base 565.
ATTCCTTTAATACTTCAATGCGGTCGCTCAACTATGTTCAATAGCGTAACAGATGTGAGT
GCCAAGTGTGCTTTATCGAGTTATCGGCTGATAGATAAAAAACTCAAGCAGATTTTCATC
CTTATTTTACAAAGGGCGCGATATGTGGGATTGAGTACATGGCAAACAGAGAGTGAGTTA
TCGCTTAAGGGGGCGCATAGTCGGATTGACCTGCTAAATCAGAGGATTTGGTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
IPLILQCGRSTMFNSVTDVSAKCALSSYRLIDKKLKQIFILILQRARYVGLSTWQTESEL
SLKGAHSRIDLLNQRIW*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 614 to base 958.
TTGTACGACAATAATTTTACCCTACTAGGATGCGAGTCAATGGATCATAAAAAACGCGCC
GCACTACTCACAACAGCCAGTTTTAAGGCGGTTTCTCTCTTATCTCTCAGTGTCTTGAGT
GGTATTTCTGCGCCGGCAATGGCCAAGAATATCTTAGATAAACTGACGGTTGCCGAAGGC
TTTAACGTAAGTCTATTTGCTGATGATGTTGAAAATGCGCGCGAAATTGCCGTATCCGAT
AAAGGCATTGTCTATGCGGGCTCAATGAAGGCGGGGAACGTTTATGCCCTAAAAGACCGT
AACCAGGACGGCGTTGCCGATGAGAAAATCCTAGTTGCCTCAGGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
LYDNNFTLLGCESMDHKKRAALLTTASFKAVSLLSLSVLSGISAPAMAKNILDKLTVAEG
FNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVADEKILVASG

No ORFs were found in reading frame 3.

------------------------------------------------------------------------------------------------------------------------------
3)SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'atg codon' initiation / 'universal' genetic code
ORF Finder results
Results for 959 residue sequence "Untitled" starting "GTCCTGAGGC"

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 99 to base 302.
ATGCCTTTATCGGATACGGCAATTTCGCGCGCATTTTCAACATCATCAGCAAATAGACTT
ACGTTAAAGCCTTCGGCAACCGTCAGTTTATCTAAGATATTCTTGGCCATTGCCGGCGCA
GAAATACCACTCAAGACACTGAGAGATAAGAGAGAAACCGCCTTAAAACTGGCTGTTGTG
AGTAGTGCGGCGCGTTTTTTATGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MPLSDTAISRAFSTSSANRLTLKPSATVSLSKIFLAIAGAEIPLKTLRDKRETALKLAVV
SSAARFL*


------------------------------------------------------------------------------------------------------------------------
4)SMS ORFinder / indirect strand / frames 1, 2 & 3 / min 60 AA / 'atg codon' initiation / 'universal' genetic code
ORF Finder results
Results for 959 residue sequence "Untitled" starting "GTCCTGAGGC"

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 365 to base 565.
ATGTTCAATAGCGTAACAGATGTGAGTGCCAAGTGTGCTTTATCGAGTTATCGGCTGATA
GATAAAAAACTCAAGCAGATTTTCATCCTTATTTTACAAAGGGCGCGATATGTGGGATTG
AGTACATGGCAAACAGAGAGTGAGTTATCGCTTAAGGGGGCGCATAGTCGGATTGACCTG
CTAAATCAGAGGATTTGGTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MFNSVTDVSAKCALSSYRLIDKKLKQIFILILQRARYVGLSTWQTESELSLKGAHSRIDL
LNQRIW*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 653 to base 958.
ATGGATCATAAAAAACGCGCCGCACTACTCACAACAGCCAGTTTTAAGGCGGTTTCTCTC
TTATCTCTCAGTGTCTTGAGTGGTATTTCTGCGCCGGCAATGGCCAAGAATATCTTAGAT
AAACTGACGGTTGCCGAAGGCTTTAACGTAAGTCTATTTGCTGATGATGTTGAAAATGCG
CGCGAAATTGCCGTATCCGATAAAGGCATTGTCTATGCGGGCTCAATGAAGGCGGGGAAC
GTTTATGCCCTAAAAGACCGTAACCAGGACGGCGTTGCCGATGAGAAAATCCTAGTTGCC
TCAGGA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
MDHKKRAALLTTASFKAVSLLSLSVLSGISAPAMAKNILDKLTVAEGFNVSLFADDVENA
REIAVSDKGIVYAGSMKAGNVYALKDRNQDGVADEKILVASG

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:

Phylogeny.fr /MUSCLE


ANALYSE DES RÉSULTATS:

Cet alignement multiple vérifie que l'ORF s'intègre correctement dans la famille de ses homologues présumés: l'alignement multiple présente des régions conservées convaincantes.L'alignement a suffisamment de mutations (positions informatives) qui a séparé ces protéines.Les séquences ne sont pas identiques et n'ont pas la même longueur.


On peut voir que la séquence étudiée commence un peu après les autres, et se finit bien avant.La longueur de notre séquence est très petit.Cela est expliqué par la séquence commence par le deuxième méthionine(donc incomplète en 5')et qui ne finit pas par un codon stop(incomplète en 3'). Notre séquence est correspond à un domaine protéique.

RÉSULTATS BRUTS:
CLUSTAL

Acido.cit/1-423 ------------------------MPSHTFPLRAAALLSLAACSF-------AAQAQLPP
Shewan519/1-373 ---------------------------------MFWACISGLFSF-------SVQAASQ-
ShewanW3/1-391  ------------MLYIKTNNYNYLKVFSAYTVLFVSVILLPIHSA-------VAASQSV-
Shewa200/1-391  ------------MLYIKTNNYNYLKVFSAYTVLFVSVILLPIHSA-------VAASQSV-
ShewaCN_3/1-391 ------------MLYIKTNNYNYLKVFSAYTVLFVSVILLPIHSA-------VAASQSV-
Burk.CCGE/1-394 MLRQPNLAFPFAFFSFFVRFAGLSRTPCRRILRVAAAALLAAQAL-------TVNAALP-
Burk.ok/1-382   -------------MRPLISLSRIVSSGLPTLLRTAAAACLVLATI-------AASAALP-
Burkpseud/1-389 -------------MRSLVALFRHVSSGPPALPRAASAACLVLATIVTVATAPAASAALP-
Burkhpseu/1-280 ------------------------------MPRAASAACLVLATIVTVATAPAASAALP-
Shewa.OS2/1-361 -----------------------------MKHLLFAIIFLASHGA-------EAIS----
Shewa.ANA/1-380 --------------MDHKKRAALLTTASFKAVSLLSLSVLSGISA-------PAMAKNI-
GOS_17380/1-69  ------------------------------------------------------MAKNI-
Shewa._4/1-369  -------------------------MVRKLQITLAALFALTGVSV-------PAMAKNI-
Shewa._7/1-369  -------------------------MVRKLQITLAALFALTGVSV-------PAMAKNI-
Altero/1-364    -----------------------------MNKLLASVLLLSLISA-------PAMAKNI-
Pseudo/1-364    -----------------------------MNTVLKIVLLLGLTSN-------TVMAKNI-
Shewa.400/1-367 ---------------------------MMKSISLCSTLIIAMGVS-------YPSFALP-
Kangiella/1-364 --------------------------MTKFIPALSSIVMLSLSV-------------LS-

Acido.cit/1-423 GDGPTTVTGGVLEPTPVRFDESLLGQLRVPAGFKVSVFARDLHNVRWLAVAPNGDVYASR
Shewan519/1-373 -----------------------PKMITVSKGFGLTLYASDLGDAKQMALGDKGTLFVGS
ShewanW3/1-391  -------------------------MITVSKGFGLSLYASDLGDAKQIAMGSNGTLFVGS
Shewa200/1-391  -------------------------MITVSKGFGLSLYASDLGDAKQIAMGSNGTLFVGS
ShewaCN_3/1-391 -------------------------MITVSKGFGLSLYASDLGDAKQIAMGSNGTLFVGS
Burk.CCGE/1-394 -----------------------VEKIKLPPGFHIEVLSDDVPSARAMTLSPKGILYVGS
Burk.ok/1-382   -----------------------IDALSVPPGFRVQVLADDVPAAREMAWSPRGILYVGS
Burkpseud/1-389 -----------------------IDELRVPPGFRVQVLADDVPTAREMAWSPRGILYVGS
Burkhpseu/1-280 -----------------------IDELRVPPGFRVQVLADDVPTAREMAWSPRGILYVGS
Shewa.OS2/1-361 -----------------------LDQLSLPPGFKIDYFAEDVVSARQMALSDKGIVYVGS
Shewa.ANA/1-380 -----------------------LDKLTVAEGFNVTLFADDVENAREIAVSDKGIVYAGS
GOS_17380/1-69  -----------------------LDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGS
Shewa._4/1-369  -----------------------LDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGS
Shewa._7/1-369  -----------------------LDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGS
Altero/1-364    -----------------------LDKLSVAPGFELSLFADDVENARQIAVSKKGIVYAGS
Pseudo/1-364    -----------------------LDKLTVAPGFELSLFASDVENARQVVVSKKGIVYVGS
Shewa.400/1-367 -----------------------LDKIKLQEGFTIDVYAENLENARQMALGDNGTVFVGS
Kangiella/1-364 -----------------------TEAAEVPEGFKIELFAENVDGARQMALSDTGIVYTGS

Acido.cit/1-423 REQGDVLWLRDSDGDGRADQQKVVLQNAKYAHGLALRDGRLYLVTDKKLMVADVQPDGTL
Shewan519/1-373 HRKGTILALVDSNQDGRVDKRYVVAKGLDNPEAIAFYNGDLYAAVDERIIRFK-DIENRL
ShewanW3/1-391  HKSGTIHALVDSNQDGRVDKRYVIAKGLKSPEAIAFYDGDLFVATENRVMRFI-DIEQRL
Shewa200/1-391  HKSGTIHALVDSNQDGRVDKRYVIAKGLKSPEAIAFYDGDLFVATENRVMRFI-DIEQRL
ShewaCN_3/1-391 HKSGTIHALVDSNQDGRVDKRYVIAKGLKSPEAIAFYDGDLFVATENRVMRFI-DIEQRL
Burk.CCGE/1-394 ED-GHVYALELRN--GHVTGRHVIASGLQMPTGVAWGDGALYVSAVSKIVRFD-AIDSHL
Burk.ok/1-382   ME-GRVHALVVRD--GHVRAHHVIASGLEMPVGVAYRNGALYVSAVSRILRLD-RIDERL
Burkpseud/1-389 MN-GRVHALVVRD--GHVREHHVIASGLEMPVGVAYRNGALFVSAVSRILRLD-RIDERL
Burkhpseu/1-280 MN-GRVHALVVRD--GHVREHHVIASGLEMPVGVAYRSGALFVSAVSRILRLD-RIDERL
Shewa.OS2/1-361 MNAGNVYALQDKDNDGKAEKRWLIAKGLKRPSGIAFKDGDLYVADINRILKFS-QIDDHL
Shewa.ANA/1-380 MKAGNVYALIDRNQDGVADEKILVASGLKLPSGVVIKDGDLYVSEVERIIRFK-DIDNNL
GOS_17380/1-69  MKAGNVYALKDRNQDGVADEKILVASG---------------------------------
Shewa._4/1-369  MKAGNVYALIDRNQDGVADEKILVASGLKLPSGVVIKDGDLYVSEVERIIRFK-DIDNNL
Shewa._7/1-369  MKAGNVYALIDRNQDGVADEKIIVASGLKLPSGVVIKDGDLYVSEVERIIRFK-DIDNNL
Altero/1-364    RKAGNVYALIDHNSDGVADKKIVIAEGLNMPSGLAIKDGDLYVGEVHRIIRFK-NIDTQL
Pseudo/1-364    RKAGNVYALIDHNSDGVADKKMLVAEGLNMPSGLAMKDGDLYVGEVHRIIRFK-NIDTQL
Shewa.400/1-367 RKAGNVYALIDSDNDFKADKKIIIATDLFMPSGLAYHNGSLYVAEVDKIWRYP-DIEQSL
Kangiella/1-364 RKPGKVHAMIDKDNDFKVDEVVLVADGLYMPSGVAYKDGDLYVAEVDKILRFK-DIDKNY

Acido.cit/1-423 SAP---RILADDLPDAGQHPNRTIAFGPDGWLYLTVGSTCNNCRETNGESATMLRMRPDG
Shewan519/1-373 RRPGRGKEVYDRLPGKTNKSHRALNFGPDGRLYVSIGAPCNVC-EAEDPFGSIIAIDIET
ShewanW3/1-391  RRPSRPKEIYSDLPASDKKSTRAMNFGPDGRLYISIGAPCNVC-EAPAPYSSIIAINVDT
Shewa200/1-391  RRPSRPKEIYSDLPASDKKSTRAMNFGPDGRLYISIGAPCNVC-EAPAPYSSIIAINVDT
ShewaCN_3/1-391 RRPSRPKEIYSDLPASDKKSTRAMNFGPDGRLYISIGAPCNVC-EAPAPYSSIIAINVDT
Burk.CCGE/1-394 NDPPKPVVVTDKLPTDTHHGWKFVAFGPDGKLYVPQGAPCNICQRDPDRFALIGRMDPDG
Burk.ok/1-382   AAPPKPVVVTDALPTERHHGWKFIAFGPDGKLYVPTGAPCNICVADRDRYAMIGRMNPDG
Burkpseud/1-389 AAPPKPVVVTNALPTDRHHGWKFIAFGPDGKLYVPTGAPCNICVADRDRYAMVGRMNADG
Burkhpseu/1-280 AAPPKPVVVTNALPTDRHHGWKFIAFGPDGKLYVPTGAPCNICVADRDRYAMIGRMNADG
Shewa.OS2/1-361 DQP-KSEVFFSDLPHDSHHGWKFLRFAPNGELIIPVGAPCNICEAPTDKHARLFSLNMAT
Shewa.ANA/1-380 NSP-KFEVVFDGFPSETHHGWKVLGVSPTGELIIPVGVPCNVC-AENERYGRIFSLNLET
GOS_17380/1-69  ------------------------------------------------------------
Shewa._4/1-369  NSP-KFEMVFDGFPSETHHGWKVLGVSPTGELIIPVGVPCNVC-AENERYGRIFSLNLET
Shewa._7/1-369  NSP-KFEVVFDGFPSETHHGWKVLGFSPTGELIIPVGVPCNVC-AENERYGRIFSLNLET
Altero/1-364    KDP-KFDVIYNALPSERHHGWKFLRFTPTGELLIPVGVPCNIC-AEDERFGRIFSLNVET
Pseudo/1-364    KNP-QFEVLYDALPSERHHGWKFLRFAPTGELIIPVGVPCNIC-AEDERFGRIFALNVET
Shewa.400/1-367 PKIPKPELVYDKLPNKSHHGWKFIAFGPDGKLYIPVGAPCNVC-ESEQPFASILQLDLET
Kangiella/1-364 NKKPEPEVVFDQLPDESHHGWKYIKFGPDGHLYIPIGVPCNICNEKDERFGTIGRLNIET

Acido.cit/1-423 SGREVVAQGLRNTIGFGWHPRTGVLYGFDHGSDFQGDDTPPEELNAI-LPNKHYGWPYCW
Shewan519/1-373 GSSEQIASGIRNVTGFDWSPQDQSLWFADLGRDWMGDRLPPDEINRVETVGGHYGFPYLH
ShewanW3/1-391  GANEQIVSGVRDTTGFDWSPIDGKLWFADQGRDWMGDNLPPDEINRVDSIGSHYGFPYLH
Shewa200/1-391  GANEQIVSGVRDTTGFDWSPIDGKLWFADQGRDWMGDNLPPDEINRVDSIGSHYGFPYLH
ShewaCN_3/1-391 GANEQIVSGVRDTTGFDWSPIDGKLWFADQGRDWMGDNLPPDEINRVDSIGSHYGFPYLH
Burk.CCGE/1-394 SHYEVVARGIRNSVGFAWHPVTHELWFTDNGRDLLGDDIPSDKLSRAPQVGMNFGFPYCH
Burk.ok/1-382   SGYEVYARGVRNTVGFAWHPATSELWFTDNGRDLMGDDRPDDKLNRAPHAGLDFGYPFCH
Burkpseud/1-389 SGYEVYARGVRNTVGFAWHPATRELWFTDNGRDLMGDDRPDDKLNRAPRAGLDFGYPFCH
Burkhpseu/1-280 SGYEVYARGVRNTVGFAWHPATRELWFTDNGRDLMGDDRPDDKLNRAPRAGLDFGYPFCH
Shewa.OS2/1-361 KTLTELAQGVRNSVGFDFHPSSGELWFSDNGADMLGDDVPADEINRLSKPGSHFGYPYFH
Shewa.ANA/1-380 KKLTTIAQGVRNSVGFDFQPGTQTLWFSDNGRDMMGDDIPPCEINKVSYLGEHFGFPYVH
GOS_17380/1-69  ------------------------------------------------------------
Shewa._4/1-369  KKLTTIAQGVRNSVGFDFQPGTQTLWFSDNGRDMMGDDIPPCEINKVSYLGEHFGFPYVH
Shewa._7/1-369  KKLTTIAQGVRNSVGFDFQPSTQTLWFSDNGRDMMGDDIPPCEINKVSYLGEHFGFPYVH
Altero/1-364    KQIKTIAQGVRNSVGFDFHPSTQALWFSDNGRDMMGDDIPPDEINRVSKEGEHFGFPYIH
Pseudo/1-364    KQITTLAQGVRNSVGFDFHPSTQALWFSDNGRDMMGDDIPPDELNRVTKEGEHFGFPYVH
Shewa.400/1-367 KQTTIVAQGVRNSVGFDFHPQTGELWFTDNGRDMMGDDLPDDELNRVSKKGQHFGFPYIH
Kangiella/1-364 KEFELIATGVRNSVGFDWHPETKELWFTDNGRDWMGDDLPPCELNRVTEKGQFFGFPYVH

Acido.cit/1-423 GDRQVTKFQVNEPPNTTKADFCPTTEVPLLQYTAHAAPIGFVFYTGEQFPQQYRGDAFVA
Shewan519/1-373 AKSVLE-------PAYEKPKNL-KITLPNYELPAHVAPMGLHFYRGEQFPPRYHNQMFVA
ShewanW3/1-391  ATSVIE-------PAYEKPKNL-KISVPIYELPAHVAPTGLAFYRGVQFPEVFHNQLFIA
Shewa200/1-391  ATSVIE-------PAYEKPKNL-KISVPIYELPAHVAPTGLAFYRGVQFPEVFHNQLFIA
ShewaCN_3/1-391 ATSVIE-------PAYEKPKNL-KISVPIYELPAHVAPTGLAFYRGVQFPEVFHNQLFIA
Burk.CCGE/1-394 GGDTPD-------PQFGKDHPCSEFTPPVVKLGAHVAALGMRFYDGPMFPADYRNNIFIA
Burk.ok/1-382   GGDVLD-------PQFGRGHTCASYVPPVLKLGAHVAALGMRFYTGDMFPPEYRNNIFIA
Burkpseud/1-389 GGDVLD-------PQFGRGHTCSSYAPPVLKLGAHVAALGMRFYTGGMFPPEYRDNIFIA
Burkhpseu/1-280 GGDVLD-------PQFGRGHTCSSYAPPVLKLGAHVAALGMRFYT---------------
Shewa.OS2/1-361 EGTIAD-------TNFSEGKKSTDYVQPALKLGAHVAPLGIHFYLGKHFPAAYQQQLFVA
Shewa.ANA/1-380 AGTILD-------PEFGQGKDPAKYTAPALSLGAHVAPLGIHFYLGKQFPSDYQQQLFVA
GOS_17380/1-69  ------------------------------------------------------------
Shewa._4/1-369  AGTILD-------PEFGNGNDPAKYTAPALSLGAHVAPLGIHFYLGKQFPSDYQQQLFVA
Shewa._7/1-369  AGTILD-------PEFGKGNDPAKYTAPALSLGAHVAPLGIHFYLGKQFPSDYQQQLFVA
Altero/1-364    AGAIVD-------PEFGEGKNIADYTSPALALPAHVAPLGIHFYNAKQFPASYKEQLFVA
Pseudo/1-364    AGAIID-------PEFGKGKKIADYTSPALALPAHVAPLGIHFYNGKQFPASYKQQLFVA
Shewa.400/1-367 NTDIAD-------PDFTNPKIATLNTPPVLTLGAHVAALGMEFYQGNQFPAAYKQSILIA
Kangiella/1-364 GNDVID-------PEFGDELGEREYRKPEWEYQAHVAPLGMMFYTGDMFPSEYKNTPLVT

Acido.cit/1-423 FRGSWNRSQPSGYNVVRVRFDAEGRPTGTEEFAAGWLMSTPAAVASQPGPAAAPAEQDKA
Shewan519/1-373 ENGSWNRSSKIGYQVVMLEIE-NNKVIKRSPVVS-FLD-GEFP-----------------
ShewanW3/1-391  ENGSWNRSSKVGYQVVMLKIE-NQQVVSRETVVS-FLD-GEFP-----------------
Shewa200/1-391  ENGSWNRSSKVGYQVVMLKIE-NQQVVSRETVVS-FLD-GEFP-----------------
ShewaCN_3/1-391 ENGSWNRSSKVGYQVVMLKIE-NQQVVSRETVVS-FLD-GEFP-----------------
Burk.CCGE/1-394 EHGSWNRSKKVGYRVVRVITDPDGSHARQQVFAEGWLQPGESV-----------------
Burk.ok/1-382   EHGSWNRSRKVGYRVMRVIASPDGRSAHQEAFAQGWLRPDESV-----------------
Burkpseud/1-389 EHGSWNRSRKVGYRVVRVIASPDGRAAREETFVHGWLRPDESV-----------------
Burkhpseu/1-280 ------------------------------------------------------------
Shewa.OS2/1-361 EHGSWNRSKKSGYKVGMVTLN-GSTVVKYEPFITGFMK-DEKT-----------------
Shewa.ANA/1-380 EHGSWNRTKKAGYKVAVATIE-QGKVVKYTPFLTGFMQ-DEQT-----------------
GOS_17380/1-69  ------------------------------------------------------------
Shewa._4/1-369  EHGSWNRTKKAGYKVAVATIE-QGKVVKYTTFLTGFMQ-DEQT-----------------
Shewa._7/1-369  EHGSWNRTKKAGYKVAVATIE-QGKVVKYTPFLTGFMQ-DEQT-----------------
Altero/1-364    EHGSWNRSKKAGYKVAIATIE-QGRVTKYTPFITGFMK-DETT-----------------
Pseudo/1-364    EHGSWNRSKKSGYKVALASIE-QGRVTKYTPFITGFMQ-DETT-----------------
Shewa.400/1-367 QHGSWNRTNKVGYRIMQVALE-GNKVIDYKQFATGWLE-GEQS-----------------
Kangiella/1-364 LHGSWNRSTKVGYKVVNMPLE-ANRVLSEDDFVTGWLK-GDEV-----------------

Acido.cit/1-423 RRPAQFGRLAGLAQARDGALLLAEDQNGVIYRISHGSR--------------
Shewan519/1-373 -----VARPYSVLTAPDGAMYISDDLKGNIYRLYYKETINEKSEPEPEQDNE
ShewanW3/1-391  -----VARPYALLSADDGAMYISDDLKGNVYRLFFKGGDSTEEPQELEENE-
Shewa200/1-391  -----VARPYALLSADDGAMYISDDLKGNVYRLFFKGGDSTEEPQELEENE-
ShewaCN_3/1-391 -----VARPFALLSADDGAMYISDDLKGNVYRLFFKGGDSTEEPQELEENE-
Burk.CCGE/1-394 -----WGRPADVLPLPDGSLLISDDTAGAIYRVTYSAP--------------
Burk.ok/1-382   -----WGRPADVLPLPDGSLLVSDDYAGAIYRITYDAAH-------------
Burkpseud/1-389 -----WGRPADVLPLPDGSLLVSDDYAGAIYRITYDATH-------------
Burkhpseu/1-280 ----------------------------------------------------
Shewa.OS2/1-361 -----LGRPAALMELGDGSLLVADDFANVIYRVTYGD---------------
Shewa.ANA/1-380 -----FGRPVAFAELADGSLLVSDDYAGAIYRVTYPQTK-------------
GOS_17380/1-69  ----------------------------------------------------
Shewa._4/1-369  -----FGRPVAFAELADGSLLVSDDYAGAIYRVTYPQTK-------------
Shewa._7/1-369  -----FGRPVAFAELADGSLLVSDDYAGAIYRVTYPQTK-------------
Altero/1-364    -----FGRPVAFAELGDGSLLVSDDYANVIYRVSYKKN--------------
Pseudo/1-364    -----YGRPVAFAELGDGSLLVSDDYANVIYRVSYKKN--------------
Shewa.400/1-367 -----WGRPVDVMTLADGSILVSDDFANAVYRISYTKQ--------------
Kangiella/1-364 -----LGRPNDIIMLTDGSILVSDDGFSKVYRVSYQKGK

Protein Domains

PROTOCOLE:

1)INTERPRO defaut parametres EBI

2)PROSITE

3)PFam


ANALYSE DES RÉSULTATS:


D'après les trois méthodes, aucun domaine protéique n'est trouvés dans ma séquence.

Donc il ne semble pas y avoir de domaines conservés.

RÉSULTATS BRUTS:

1)INTERPRO defaut parametres EBI
no hit!
-----------------------------------------------------------------------------------------------------
2)PROSITE
no hit!
-----------------------------------------------------------------------------------------------------
3)PFam 
No hits in Pfam

Phylogeny

PROTOCOLE:

a) Phylogeny.fr / méthode PhyML

b) Phylogeny.fr / méthode BioNJ



ANALYSE DES RÉSULTATS:

ANALYSE DES RÉSULTATS:


a)La séquence forme un group de quatre avec Shewanella.La séquence s'intègre parfaitement dans le groupe des gamme-proteobacteria/Shewanella.


b) La séquence forme un group de quatre avec Shewanella.La séquence s'intègre parfaitement dans le groupe des gamme-proteobacteria/Shewanella.


Les arbres produits par différentes méthodes sont cohérents entre eux.On peut voir qu'il y a bien une séparation entre notre groupe extérieur et notre groupe d'étude.On constate qu'il y d des différences de la longueur des branches et de l'agencement pour ces deux méthodes.

RÉSULTATS BRUTS:
a) Phylogeny.fr / méthode PhyML 
  
 ----0.1---
 
                                                                         +Burkpseud/1-389                    (beta-proteobacterie)
                                                                         |
                                                                         |Burkhpseu/1-280                    (beta-proteobacterie)
                                                   +---------------------+
                                                   |                     +--------Burk.ok/1-382              (beta-proteobacterie)
         +-----------------------------------------+
         |                                         |
 +-------+                                         +------------------------Burk.CCGE/1-394                  (beta-proteobacterie)
 |       |
 |       +-------Shewa.OS2/1-361                                                                             (gamma-proteobacterie)
 |
 |                       +-------------------------------------------------------------------------------Acido.cit/1-423  (beta-proteobacterie)
 |                       |
 |                       |                                                        +-------Shewan519/1-373    (gamma-proteobacterie)
 |                       |                                                        |
 |            +----------+                                                        |     +ShewanW3/1-391      (gamma-proteobacterie)
 |            |          |       +------------------------------------------------+     |
 |            |          |       |                                                |     |Shewa200/1-391      (gamma-proteobacterie)
 |            |          |       |                                                +-----+
 |            |          +-------+                                                      |
 |            |                  |                                                      +ShewaCN_3/1-391     (gamma-proteobacterie)
 |            |                  |
 |            |                  +---------------Shewa.400/1-367                                             (gamma-proteobacterie)
 |            |
 |            |------------------------------------Kangiella/1-364                                           (gamma-proteobacterie)
 +------------+
              |                           +---Altero/1-364                                                   (gamma-proteobacterie)
              |                   +-------+
              |                   |       +--------Pseudo/1-364                                              (gamma-proteobacterie)
              |                   |
              +-------------------+        +-Shewa._7/1-369                                                  (gamma-proteobacterie)
                                  |        |
                                  |        |
                                  +--------+-GOS_17380/1-69
                                           |
                                           |Shewa._4/1-369                                                   (gamma-proteobacterie)
                                           |
                                           +-Shewa.ANA/1-380                                                 (gamma-proteobacterie)
b) Phylogeny.fr / méthode BioNJ
 ----0.1---
 
                                   +----------------Shewan519/1-373          (gamma-proteobacterie)
                                   |
 +---------------------------------+                   +ShewanW3/1-391       (gamma-proteobacterie)
 |                                 |                   |
 |                                 |                   |Shewa200/1-391       (gamma-proteobacterie)
 |                                 +-------------------+
 |                                                     |
 |                                                     +ShewaCN_3/1-391      (gamma-proteobacterie)
 |
 |                                         +---Shewa.ANA/1-380               (gamma-proteobacterie)
 |                                         |
 |                                         | +-Shewa._4/1-369                (gamma-proteobacterie)
 |                                         |-+
 |                            +------------+ +-Shewa._7/1-369                (gamma-proteobacterie)
 |                            |            |
 |                            |           -+OS_17380/1-69                    
 |                  +---------+
 |                  |         |     +----Altero/1-364                        (gamma-proteobacterie)
 |                  |         +-----+
 |        +---------+               |
 |        |         |               +-------Pseudo/1-364                     (gamma-proteobacterie)
 |        |         |
 |        |         +---------------------------Shewa.OS2/1-361              (gamma-proteobacterie)
 |        |
 |        |              +-------------------------------------------------------------------------------Acido.cit/1-423  (beta-proteobacterie)
 +--------+              |
          |  +-----------+                 +--------------------Burk.CCGE/1-394                                      (beta-proteobacterie)
          |  |           |                 |
          |  |           +-----------------+             +----Burk.ok/1-382                                         (beta-proteobacterie)
          |  |                             |             |
          |  |                             +-------------+  +-Burkpseud/1-389                                       (beta-proteobacterie)
          +--+                                           |  |
             |                                           +--+
             |                                              +-Burkhpseu/1-280                                       (beta-proteobacterie)
             |
             |   +------------------------------Shewa.400/1-367                (gamma-proteobacterie)
             +---+
                 +----------------------------------Kangiella/1-364            (gamma-proteobacterie)

Taxonomy report

PROTOCOLE:

1)BLASTp vs SWISSPROT defaut NCBI parameters



ANALYSE DES RÉSULTATS:

Toutes les sequences sont soit des Gamma-Proteobacteria, Alpha-Proteobacteria ou Beta-Proteobacteria ou Delta-Proteobacteria.


Pour notre groupe d'étude, nous prenons soin de choisir des homologues proches notre orf.

Pour former notre groupe d'étude nous choisissons parmi les homologues de notre orf, ceux qui appartiennent au groupe des Gamma-Proteobacteria(groupe des homologues les plus proches) et ayant une e-value inférieure à 10e-5.


Pour notre groupe d'extérieur , nous prenons soin de choisir des homologues moins proches notre orf.

De même, notre groupe extérieur est constitué des homologues appartenant au groupe des Beta-proteobacteria ayant un e-value un peu plus fort que les e-values de notre groupe d'étude.



Groupe d'étude

ref|YP_734563.1| Shewa.MR-4 Shewanella sp. MR-4 [g-proteobacteria] 3e-30

ref|YP_870230.1| Shewa.ANA-3 Shewanella sp. ANA-3 [g-proteobacteria] 4e-30

ref|YP_738547.1| Shewa. MR-7 Shewanella sp. MR-7 [g-proteobacteria] 5e-30

ref|ZP_01613231.1| Altero Alteromonadales bacterium TW-7 [g-proteobacteria] 4e-23

ref|YP_341076.1| Pseudo Pseudoalteromonas haloplanktis TAC125 [g-proteobacteria] 5e-22

ref|YP_561911.1| Shewa.OS217 Shewanella denitrificans OS217 [g-proteobacteria] 6e-14

ref|YP_750732.1| Shewa.400 Shewanella frigidimarina NCIMB 400 [g-proteobacteria] 7e-12

ref|YP_003145905.1| Kangiella kore Kangiella koreensis DSM 16069 [g-proteobacteria] 6e-10

ref|YP_001762540.1| Shewa.51908 Shewanella woodyi ATCC 51908 [g-proteobacteria] 1e-08

ref|YP_964767.1| Shewa.W3-18-1 Shewanella sp. W3-18-1 [g-proteobacteria] 3e-08

ref|ZP_01707763.1| Shewa.200 Shewanella putrefaciens 200 [g-proteobacteria] 3e-08

ref|YP_001182303.1| Shewa.CN-32 Shewanella putrefaciens CN-32 [g-proteobacteria] 3e-08


GROUPE EXTERIEUR

ref|ZP_04963102.1| Burkho.pseudo1 Burkholderia pseudomallei [b-proteobacteria] 4e-06

ref|ZP_01764698.1| Burkho.pseudo2 Burkholderia pseudomallei [b-proteobacteria] 4e-06

ref|YP_972833.1|AAC00-1 Acido.citr Acidovorax citrulli AAC00-1 [b-proteobacteria] 4e-06

ref|ZP_02363642.1| Burkho.ok Burkholderia oklahomensis C6786 [b-proteobacteria] 2e-05

ref|YP_003605778.1| Burk.CCGE1002 Burkholderia sp. CCGE1002 [b-proteobacteria] 2e-04






cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Gammaproteobacteria [g-proteobacteria]
. . . . Alteromonadales     [g-proteobacteria]
. . . . . Shewanella          [g-proteobacteria]
. . . . . . Shewanella sp. MR-4 ------------------  134 4 hits [g-proteobacteria]    L-sorbosone dehydrogenase (SNDH) [Shewanella sp. MR-4] >gi|
. . . . . . Shewanella sp. ANA-3 .................  134 4 hits [g-proteobacteria]    L-sorbosone dehydrogenase (SNDH) [Shewanella sp. ANA-3] >gi
. . . . . . Shewanella sp. MR-7 ..................  134 4 hits [g-proteobacteria]    L-sorbosone dehydrogenase (SNDH) [Shewanella sp. MR-7] >gi|
. . . . . . Shewanella denitrificans OS217 .......   80 4 hits [g-proteobacteria]    putative L-sorbosone dehydrogenase (SNDH) [Shewanella denit
. . . . . . Shewanella frigidimarina NCIMB 400 ...   73 4 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella frigidimari
. . . . . . Shewanella woodyi ATCC 51908 .........   62 4 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella woodyi ATCC
. . . . . . Shewanella sp. W3-18-1 ...............   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella sp. W3-18-1
. . . . . . Shewanella putrefaciens 200 ..........   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella sp. W3-18-1
. . . . . . Shewanella putrefaciens CN-32 ........   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella putrefacien
. . . . . . Shewanella baltica OS223 .............   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella baltica OS2
. . . . . . Shewanella baltica OS185 .............   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella baltica OS1
. . . . . . Shewanella baltica OS155 .............   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella baltica OS1
. . . . . . Shewanella baltica OS195 .............   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella baltica OS1
. . . . . . Shewanella oneidensis MR-1 ...........   61 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella oneidensis 
. . . . . . Shewanella piezotolerans WP3 .........   61 4 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella piezotolera
. . . . . . Shewanella sediminis HAW-EB3 .........   60 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella sediminis H
. . . . . . Shewanella loihica PV-4 ..............   60 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella loihica PV-
. . . . . . Shewanella amazonensis SB2B ..........   57 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella amazonensis
. . . . . . Shewanella violacea DSS12 ............   55 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella violacea DS
. . . . . . Shewanella halifaxensis HAW-EB4 ......   55 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella halifaxensi
. . . . . . Shewanella benthica KT99 .............   54 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella benthica KT
. . . . . . Shewanella pealeana ATCC 700345 ......   52 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase, putative [Shewanella pealeana AT
. . . . . Alteromonadales bacterium TW-7 ---------  110 2 hits [g-proteobacteria]    putative L-sorbosone dehydrogenase (SNDH) [Alteromonadales 
. . . . . Pseudoalteromonas haloplanktis TAC125 ..  107 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase (SNDH) [Pseudoalteromonas halopla
. . . . . Pseudoalteromonas atlantica T6c ........   59 2 hits [g-proteobacteria]    L-sorbosone dehydrogenase (SNDH) [Pseudoalteromonas atlanti
. . . . . Marinobacter algicola DG893 ............   47 2 hits [g-proteobacteria]    putative Glucose/sorbosone dehydrogenase [Marinobacter algi
. . . . Kangiella koreensis DSM 16069 ------------   67 2 hits [g-proteobacteria]    NHL repeat containing protein [Kangiella koreensis DSM 1606
. . . . Legionella pneumophila str. Lens .........   48 2 hits [g-proteobacteria]    hypothetical protein lpl2684 [Legionella pneumophila str. L
. . . . Legionella pneumophila str. Paris ........   47 2 hits [g-proteobacteria]    hypothetical protein lpp2815 [Legionella pneumophila str. P
. . . . Legionella pneumophila 2300/99 Alcoy .....   46 2 hits [g-proteobacteria]    Glucose/sorbosone dehydrogenase [Legionella pneumophila 230
. . . . Legionella pneumophila str. Corby ........   46 2 hits [g-proteobacteria]    hypothetical protein LPC_3052 [Legionella pneumophila str. 
. . . Geobacter sulfurreducens PCA ---------------   65 2 hits [d-proteobacteria]    L-sorbosone dehydrogenase, putative [Geobacter sulfurreduce
. . . Geobacter uraniireducens Rf4 ...............   58 2 hits [d-proteobacteria]    glucose/sorbosone dehydrogenase-like protein [Geobacter ura
. . . Haliangium ochraceum DSM 14365 .............   55 2 hits [d-proteobacteria]    Glucose/sorbosone dehydrogenase-like protein [Haliangium oc
. . . Burkholderia pseudomallei 1710a ............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 1710a]
. . . Burkholderia pseudomallei MSHR346 ..........   54 2 hits [b-proteobacteria]    putative L-sorbosone dehydrogenase homolog [Burkholderia ps
. . . Burkholderia mallei GB8 horse 4 ............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase homolog [Burkholderia mallei GB8 
. . . Burkholderia pseudomallei 576 ..............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase homolog [Burkholderia pseudomalle
. . . Burkholderia pseudomallei Pasteur 52237 ....   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase homolog [Burkholderia pseudomalle
. . . Burkholderia pseudomallei S13 ..............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase homolog [Burkholderia pseudomalle
. . . Burkholderia pseudomallei 406e .............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 406e] 
. . . Burkholderia pseudomallei 1106a ............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 1106a]
. . . Burkholderia pseudomallei 305 ..............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 1106a]
. . . Burkholderia pseudomallei Pakistan 9 .......   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 1106a]
. . . Burkholderia pseudomallei 668 ..............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 668] >
. . . Burkholderia pseudomallei 1106b ............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 668] >
. . . Burkholderia pseudomallei 1655 .............   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia pseudomallei 668] >
. . . Burkholderia mallei NCTC 10229 .............   54 1 hit  [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia mallei NCTC 10229] 
. . . Burkholderia mallei PRL-20 .................   54 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia mallei NCTC 10229] 
. . . Burkholderia mallei SAVP1 ..................   54 2 hits [b-proteobacteria]    glucose/sorbosone dehydrogenases [Burkholderia mallei SAVP1
. . . Burkholderia pseudomallei 1710b ............   54 2 hits [b-proteobacteria]    hypothetical protein BURPS1710b_2969 [Burkholderia pseudoma
. . . Burkholderia pseudomallei K96243 ...........   54 2 hits [b-proteobacteria]    hypothetical protein BPSL2493 [Burkholderia pseudomallei K9
. . . Stigmatella aurantiaca DW4/3-1 .............   54 2 hits [d-proteobacteria]    L-sorbosone dehydrogenase [Stigmatella aurantiaca DW4/3-1] 
. . . Acidovorax citrulli AAC00-1 ................   54 2 hits [b-proteobacteria]    glucose sorbosone dehydrogenase [Acidovorax avenae subsp. c
. . . Acidovorax avenae subsp. avenae ATCC 19860 .   54 2 hits [b-proteobacteria]    glucose sorbosone dehydrogenase [Acidovorax avenae subsp. a
. . . Burkholderia thailandensis Bt4 .............   54 1 hit  [b-proteobacteria]    L-sorbosone dehydrogenase, putative [Burkholderia thailande
. . . Burkholderia thailandensis E264 ............   54 3 hits [b-proteobacteria]    L-sorbosone dehydrogenase, putative [Burkholderia thailande
. . . Burkholderia thailandensis TXDOH ...........   54 1 hit  [b-proteobacteria]    L-sorbosone dehydrogenase, putative [Burkholderia thailande
. . . Methylobacterium sp. 4-46 ..................   52 2 hits [a-proteobacteria]    NHL repeat-containing protein [Methylobacterium sp. 4-46] >
. . . Burkholderia oklahomensis C6786 ............   52 1 hit  [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia oklahomensis C6786]
. . . Burkholderia oklahomensis EO147 ............   51 1 hit  [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia oklahomensis EO147]
. . . Burkholderia sp. H160 ......................   51 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase [Burkholderia sp. H16
. . . Gluconacetobacter hansenii ATCC 23769 ......   50 2 hits [a-proteobacteria]    putative L-sorbosone dehydrogenase [Gluconacetobacter hanse
. . . Nitrosospira multiformis ATCC 25196 ........   50 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase oxidoreductase protei
. . . Gluconacetobacter diazotrophicus PAl 5 .....   50 4 hits [a-proteobacteria]    putative L-sorbosone dehydrogenase [Gluconacetobacter diazo
. . . Burkholderia sp. CCGE1002 ..................   48 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase [Burkholderia sp. CCG
. . . Ralstonia solanacearum IPO1609 .............   48 2 hits [b-proteobacteria]    soluble quinoprotein glucose dehydrogenase [Ralstonia solan
. . . Ralstonia solanacearum MolK2 ...............   48 2 hits [b-proteobacteria]    soluble quinoprotein glucose dehydrogenase [Ralstonia solan
. . . Ralstonia solanacearum UW551 ...............   48 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase (FAD) [Ralstonia solanacearum UW5
. . . Nitrosomonas europaea ATCC 19718 ...........   48 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase oxidoreductase protei
. . . Methylobacterium radiotolerans JCM 2831 ....   47 2 hits [a-proteobacteria]    putative membrane-bound dehydrogenase oxidoreductase protei
. . . Bradyrhizobium japonicum USDA 110 ..........   47 2 hits [a-proteobacteria]    hypothetical protein bll0591 [Bradyrhizobium japonicum USDA
. . . Methylobacillus flagellatus KT .............   47 2 hits [b-proteobacteria]    NHL repeat-containing protein [Methylobacillus flagellatus 
. . . alpha proteobacterium BAL199 ...............   47 2 hits [a-proteobacteria]    L-sorbosone dehydrogenase [alpha proteobacterium BAL199] >g
. . . Starkeya novella DSM 506 ...................   46 1 hit  [a-proteobacteria]    NHL repeat containing protein [Starkeya novella DSM 506]
. . . Cupriavidus taiwanensis ....................   46 2 hits [b-proteobacteria]    putative quinone deshydrogenase [Cupriavidus taiwanensis] >
. . . Burkholderia phytofirmans PsJN .............   46 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase [Burkholderia phytofi
. . . Rhodobacter sphaeroides ATCC 17025 .........   46 2 hits [a-proteobacteria]    glucose/sorbosone dehydrogenase-like protein [Rhodobacter s
. . . Burkholderia ubonensis Bu ..................   46 1 hit  [b-proteobacteria]    glucose/sorbosone dehydrogenase-like protein [Burkholderia 
. . . Nitrosomonas eutropha C91 ..................   45 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase oxidoreductase protei
. . . Burkholderia glumae BGR1 ...................   45 2 hits [b-proteobacteria]    L-sorbosone dehydrogenase [Burkholderia glumae BGR1] >gi|23
. . . Burkholderia sp. Ch1-1 .....................   45 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase [Burkholderia sp. Ch1
. . . Burkholderia xenovorans LB400 ..............   45 2 hits [b-proteobacteria]    putative membrane-bound dehydrogenase [Burkholderia xenovor
. . . Bradyrhizobium sp. ORS278 ..................   45 2 hits [a-proteobacteria]    putative glucose/sorbosone dehydrogenase [Bradyrhizobium sp
. . Algoriphagus sp. PR1 -------------------------   59 2 hits [CFB group bacteria]  L-sorbosone dehydrogenase, putative [Algoriphagus sp. PR1] 
. . Microscilla marina ATCC 23134 ................   57 2 hits [CFB group bacteria]  L-sorbosone dehydrogenase [Microscilla marina ATCC 23134] >
. . bacterium Ellin514 ...........................   53 2 hits [verrucomicrobia]     glucose sorbosone dehydrogenase [bacterium Ellin514] >gi|22
. . Robiginitalea biformata HTCC2501 .............   51 2 hits [CFB group bacteria]  L-sorbosone dehydrogenase [Robiginitalea biformata HTCC2501
. . Deinococcus geothermalis DSM 11300 ...........   50 2 hits [bacteria]            NHL repeat-containing protein [Deinococcus geothermalis DSM
. . Dyadobacter fermentans DSM 18053 .............   49 2 hits [CFB group bacteria]  glucose sorbosone dehydrogenase [Dyadobacter fermentans DSM
. . Deinococcus radiodurans R1 ...................   47 2 hits [bacteria]            L-sorbosone dehydrogenase [Deinococcus radiodurans R1] >gi|
. . Cyanothece sp. PCC 7822 ......................   47 2 hits [cyanobacteria]       L-sorbosone dehydrogenase [Cyanothece sp. PCC 7822] >gi|196
. . Spirosoma linguale DSM 74 ....................   46 2 hits [CFB group bacteria]  glucose sorbosone dehydrogenase [Spirosoma linguale DSM 74]
. . Deinococcus deserti VCD115 ...................   46 2 hits [bacteria]            putative glucose/sorbosone dehydrogenase, precursor [Deinoc
. . Methylacidiphilum infernorum V4 ..............   45 2 hits [verrucomicrobia]     Glucose/sorbosone dehydrogenase [Methylacidiphilum infernor
. . Cyanothece sp. PCC 7424 ......................   45 2 hits [cyanobacteria]       NHL repeat containing protein [Cyanothece sp. PCC 7424] >gi
. uncultured methanogenic archaeon RC-I ----------   65 4 hits [euryarchaeotes]      putative L-sorbosone dehydrogenase [uncultured methanogenic
. Methanoculleus marisnigri JR1 ..................   61 2 hits [euryarchaeotes]      L-sorbosone dehydrogenase [Methanoculleus marisnigri JR1] >
. Methanosarcina mazei Go1 .......................   58 2 hits [euryarchaeotes]      L-sorbosone dehydrogenase [Methanosarcina mazei Go1] >gi|20
. Methanosarcina barkeri str. Fusaro .............   58 2 hits [euryarchaeotes]      L-sorbosone dehydrogenase [Methanosarcina barkeri str. Fusa
. Ricinus communis ...............................   47 2 hits [eudicots]            conserved hypothetical protein [Ricinus communis] >gi|22352

BLAST

PROTOCOLE:

1)BLASTp vs NR defaut NCBI parameters par défaut

2)BLASTp vs SWISSPROT defaut NCBI parameters par défaut


ANALYSE DES RÉSULTATS:


Avec NR,on a trouvé un peu près 80 des séquences qui ont un E-value faible,(inférieur à 10e-5)et les couvertures sont élevées qui varient de 90% à 100%.


Ceux qui appartiennent au groupe des Gamma-Proteobacteria sont des homologues les plus proches qui a des e-values faibles et des scores élevés.On peut faire l'hypothèse que notre séquence provient d'une espèce proche de Shewanella.


Il n'y a pas beaucoup de types de protéines homologues significatifs qui sont trouvées.La plupart de type de protéine

est le sorbosone dehydrogenase.


Avec BLASTp vs SWISSPROT,on a pas trouvé les séquence homologue.La banque nr est beaucoup plus complète comme attendue.

La banque Swissprot sont peu nombreux.


Sequences producing significant alignments:                       (Bits)  Value

ref|YP_734563.1|  L-sorbosone dehydrogenase (SNDH) [Shewanella...   134    3e-30
ref|YP_870230.1|  L-sorbosone dehydrogenase (SNDH) [Shewanella...   134    4e-30
ref|YP_738547.1|  L-sorbosone dehydrogenase (SNDH) [Shewanella...   134    5e-30
ref|ZP_01613231.1|  putative L-sorbosone dehydrogenase (SNDH) ...   110    4e-23
ref|YP_341076.1|  L-sorbosone dehydrogenase (SNDH) [Pseudoalte...   107    5e-22
ref|YP_561911.1|  putative L-sorbosone dehydrogenase (SNDH) [S...  80.5    6e-14
ref|YP_750732.1|  L-sorbosone dehydrogenase, putative [Shewane...  73.6    7e-12
ref|YP_003145905.1|  NHL repeat containing protein [Kangiella ...  67.0    6e-10
ref|NP_951254.1|  L-sorbosone dehydrogenase, putative [Geobact...  65.9    1e-09
ref|YP_684659.1|  putative L-sorbosone dehydrogenase [uncultur...  65.9    2e-09
ref|YP_001762540.1|  L-sorbosone dehydrogenase, putative [Shew...  62.8    1e-08
ref|YP_564218.1|  L-sorbosone dehydrogenase, putative [Shewane...  62.8    1e-08
ref|YP_964767.1|  L-sorbosone dehydrogenase, putative [Shewane...  61.6    3e-08
ref|YP_001182303.1|  L-sorbosone dehydrogenase, putative [Shew...  61.6    3e-08
ref|YP_002356753.1|  L-sorbosone dehydrogenase, putative [Shew...  61.6    3e-08
ref|YP_001365007.1|  L-sorbosone dehydrogenase, putative [Shew...  61.6    3e-08
ref|YP_001051917.1|  L-sorbosone dehydrogenase, putative [Shew...  61.6    3e-08
ref|YP_001047421.1|  L-sorbosone dehydrogenase [Methanoculleus...  61.2    3e-08
ref|NP_719429.1|  L-sorbosone dehydrogenase, putative [Shewane...  61.2    3e-08
ref|YP_002313531.1|  L-sorbosone dehydrogenase, putative [Shew...  61.2    4e-08
ref|YP_752001.1|  glucose sorbosone dehydrogenase [Shewanella ...  60.8    4e-08
ref|YP_001472519.1|  L-sorbosone dehydrogenase, putative [Shew...  60.8    5e-08
ref|YP_001092681.1|  L-sorbosone dehydrogenase, putative [Shew...  60.5    6e-08
ref|YP_735355.1|  L-sorbosone dehydrogenase, putative [Shewane...  60.5    6e-08
ref|YP_868375.1|  L-sorbosone dehydrogenase, putative [Shewane...  59.7    1e-07
ref|YP_660091.1|  L-sorbosone dehydrogenase (SNDH) [Pseudoalte...  59.7    1e-07
ref|YP_001759329.1|  L-sorbosone dehydrogenase, putative [Shew...  59.3    1e-07
ref|YP_684660.1|  putative L-sorbosone dehydrogenase [uncultur...  59.3    1e-07
ref|ZP_01720585.1|  L-sorbosone dehydrogenase, putative [Algor...  59.3    2e-07
ref|YP_001232218.1|  glucose/sorbosone dehydrogenase-like prot...  58.9    2e-07
ref|NP_634897.1|  L-sorbosone dehydrogenase [Methanosarcina ma...  58.9    2e-07
ref|YP_306253.1|  L-sorbosone dehydrogenase [Methanosarcina ba...  58.5    2e-07
ref|YP_002310169.1|  L-sorbosone dehydrogenase, putative [Shew...  58.5    2e-07
ref|ZP_01689517.1|  L-sorbosone dehydrogenase [Microscilla mar...  57.8    4e-07
ref|YP_928914.1|  L-sorbosone dehydrogenase, putative [Shewane...  57.4    5e-07
ref|YP_003555217.1|  L-sorbosone dehydrogenase, putative [Shew...  55.5    2e-06
ref|YP_001675851.1|  L-sorbosone dehydrogenase, putative [Shew...  55.1    2e-06
ref|YP_003266441.1|  Glucose/sorbosone dehydrogenase-like prot...  55.1    3e-06
ref|ZP_02156580.1|  L-sorbosone dehydrogenase, putative [Shewa...  54.7    3e-06
ref|ZP_04951822.1|  L-sorbosone dehydrogenase [Burkholderia ps...  54.7    4e-06
ref|YP_002897724.1|  putative L-sorbosone dehydrogenase homolo...  54.7    4e-06
ref|ZP_00441641.2|  L-sorbosone dehydrogenase homolog [Burkhol...  54.7    4e-06
ref|ZP_03452028.1|  L-sorbosone dehydrogenase homolog [Burkhol...  54.7    4e-06
ref|ZP_04963102.1|  L-sorbosone dehydrogenase [Burkholderia ps...  54.7    4e-06
ref|YP_001067166.1|  L-sorbosone dehydrogenase [Burkholderia p...  54.7    4e-06
ref|YP_001059879.1|  L-sorbosone dehydrogenase [Burkholderia p...  54.7    4e-06
ref|YP_001026910.1|  L-sorbosone dehydrogenase [Burkholderia m...  54.7    4e-06
ref|YP_993848.1|  glucose/sorbosone dehydrogenases [Burkholder...  54.7    4e-06
ref|YP_334349.1|  hypothetical protein BURPS1710b_2969 [Burkho...  54.7    4e-06
ref|YP_109088.1|  hypothetical protein BPSL2493 [Burkholderia ...  54.7    4e-06
ref|ZP_01459297.1|  L-sorbosone dehydrogenase [Stigmatella aur...  54.3    4e-06
ref|YP_972833.1|  glucose sorbosone dehydrogenase [Acidovorax ...  54.3    4e-06
ref|ZP_06211768.1|  glucose sorbosone dehydrogenase [Acidovora...  54.3    4e-06
ref|ZP_02387787.1|  L-sorbosone dehydrogenase, putative [Burkh...  54.3    4e-06
ref|ZP_02373950.1|  L-sorbosone dehydrogenase, putative [Burkh...  54.3    4e-06
ref|YP_442197.1|  L-sorbosone dehydrogenase, putative [Burkhol...  54.3    4e-06
ref|ZP_03630705.1|  glucose sorbosone dehydrogenase [bacterium...  53.9    6e-06
ref|YP_001503405.1|  L-sorbosone dehydrogenase, putative [Shew...  52.8    1e-05
ref|YP_001769657.1|  NHL repeat-containing protein [Methylobac...  52.8    1e-05
ref|ZP_02363642.1|  L-sorbosone dehydrogenase [Burkholderia ok...  52.4    2e-05
ref|ZP_02356520.1|  L-sorbosone dehydrogenase [Burkholderia ok...  51.2    4e-05
ref|YP_003195958.1|  L-sorbosone dehydrogenase [Robiginitalea ...  51.2    4e-05
ref|ZP_03270250.1|  putative membrane-bound dehydrogenase [Bur...  51.2    4e-05
ref|ZP_06834683.1|  putative L-sorbosone dehydrogenase [Glucon...  50.4    6e-05
ref|YP_411803.1|  putative membrane-bound dehydrogenase oxidor...  50.4    6e-05
ref|YP_604471.1|  NHL repeat-containing protein [Deinococcus g...  50.4    6e-05
ref|YP_002275820.1|  putative L-sorbosone dehydrogenase [Gluco...  50.4    7e-05
ref|YP_001600858.1|  putative L-sorbosone dehydrogenase [Gluco...  50.4    7e-05
ref|YP_003085055.1|  glucose sorbosone dehydrogenase [Dyadobac...  49.7    1e-04
ref|YP_003605778.1|  putative membrane-bound dehydrogenase [Bu...  48.9    2e-04
ref|YP_002260109.1|  soluble quinoprotein glucose dehydrogenas...  48.1    3e-04
ref|YP_002255741.1|  soluble quinoprotein glucose dehydrogenas...  48.1    3e-04
ref|ZP_00942859.1|  L-sorbosone dehydrogenase (FAD) [Ralstonia...  48.1    3e-04
ref|NP_841793.1|  putative membrane-bound dehydrogenase oxidor...  48.1    3e-04
ref|YP_128012.1|  hypothetical protein lpl2684 [Legionella pne...  48.1    3e-04
ref|YP_001758077.1|  putative membrane-bound dehydrogenase oxi...  47.8    4e-04
ref|NP_767231.1|  hypothetical protein bll0591 [Bradyrhizobium...  47.8    4e-04
ref|NP_294981.1|  L-sorbosone dehydrogenase [Deinococcus radio...  47.8    4e-04
ref|YP_544646.1|  NHL repeat-containing protein [Methylobacill...  47.8    4e-04
ref|YP_125120.1|  hypothetical protein lpp2815 [Legionella pne...  47.4    5e-04
ref|ZP_03155384.1|  L-sorbosone dehydrogenase [Cyanothece sp. ...  47.4    5e-04
ref|ZP_01893505.1|  putative Glucose/sorbosone dehydrogenase [...  47.4    5e-04
ref|ZP_02190341.1|  L-sorbosone dehydrogenase [alpha proteobac...  47.4    6e-04
ref|XP_002535678.1|  conserved hypothetical protein [Ricinus c...  47.4    6e-04
gb|ADH87980.1|  NHL repeat containing protein [Starkeya novell...  47.0    6e-04
ref|YP_003620112.1|  Glucose/sorbosone dehydrogenase [Legionel...  47.0    8e-04
ref|YP_002004845.1|  putative quinone deshydrogenase [Cupriavi...  46.6    8e-04
ref|YP_001252288.1|  hypothetical protein LPC_3052 [Legionella...  46.6    0.001
ref|YP_001896596.1|  putative membrane-bound dehydrogenase [Bu...  46.6    0.001
ref|YP_001167969.1|  glucose/sorbosone dehydrogenase-like prot...  46.6    0.001
ref|YP_003387306.1|  glucose sorbosone dehydrogenase [Spirosom...  46.2    0.001
ref|ZP_02378944.1|  glucose/sorbosone dehydrogenase-like prote...  46.2    0.001
ref|YP_002787233.1|  putative glucose/sorbosone dehydrogenase,...  46.2    0.001
ref|YP_747161.1|  putative membrane-bound dehydrogenase oxidor...  45.8    0.001
ref|YP_002910789.1|  L-sorbosone dehydrogenase [Burkholderia g...  45.4    0.002
ref|YP_001939721.1|  Glucose/sorbosone dehydrogenase [Methylac...  45.4    0.002
ref|ZP_06841139.1|  putative membrane-bound dehydrogenase [Bur...  45.4    0.002
ref|YP_559994.1|  putative membrane-bound dehydrogenase [Burkh...  45.1    0.002
ref|YP_002378502.1|  NHL repeat containing protein [Cyanothece...  45.1    0.002
ref|YP_001202528.1|  putative glucose/sorbosone dehydrogenase ...  45.1    0.003

ALIGNMENTS
>ref|YP_734563.1| L-sorbosone dehydrogenase (SNDH) [Shewanella sp. MR-4]
 gb|ABI39506.1| L-sorbosone dehydrogenase (SNDH) [Shewanella sp. MR-4]
Length=369

 Score =  134 bits (338),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/69 (98%), Positives = 68/69 (98%), Gaps = 0/69 (0%)

Query  1   MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVA  60
           MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYAL DRNQDGVA
Sbjct  23  MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALIDRNQDGVA  82

Query  61  DEKILVASG  69
           DEKILVASG
Sbjct  83  DEKILVASG  91


>ref|YP_870230.1| L-sorbosone dehydrogenase (SNDH) [Shewanella sp. ANA-3]
 gb|ABK48824.1| L-sorbosone dehydrogenase (SNDH) [Shewanella sp. ANA-3]
Length=380

 Score =  134 bits (336),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 68/69 (98%), Gaps = 0/69 (0%)

Query  1    MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVA  60
            MAKNILDKLTVAEGFNV+LFADDVENAREIAVSDKGIVYAGSMKAGNVYAL DRNQDGVA
Sbjct  34   MAKNILDKLTVAEGFNVTLFADDVENAREIAVSDKGIVYAGSMKAGNVYALIDRNQDGVA  93

Query  61   DEKILVASG  69
            DEKILVASG
Sbjct  94   DEKILVASG  102


>ref|YP_738547.1| L-sorbosone dehydrogenase (SNDH) [Shewanella sp. MR-7]
 gb|ABI43490.1| L-sorbosone dehydrogenase (SNDH) [Shewanella sp. MR-7]
Length=369

 Score =  134 bits (336),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 68/69 (98%), Gaps = 0/69 (0%)

Query  1   MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVA  60
           MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYAL DRNQDGVA
Sbjct  23  MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALIDRNQDGVA  82

Query  61  DEKILVASG  69
           DEKI+VASG
Sbjct  83  DEKIIVASG  91


>ref|ZP_01613231.1| putative L-sorbosone dehydrogenase (SNDH) [Alteromonadales bacterium 
TW-7]
 gb|EAW27506.1| putative L-sorbosone dehydrogenase (SNDH) [Alteromonadales bacterium 
TW-7]
Length=364

 Score =  110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/69 (79%), Positives = 61/69 (88%), Gaps = 0/69 (0%)

Query  1   MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVA  60
           MAKNILDKL+VA GF +SLFADDVENAR+IAVS KGIVYAGS KAGNVYAL D N DGVA
Sbjct  19  MAKNILDKLSVAPGFELSLFADDVENARQIAVSKKGIVYAGSRKAGNVYALIDHNSDGVA  78

Query  61  DEKILVASG  69
           D+KI++A G
Sbjct  79  DKKIVIAEG  87


>ref|YP_341076.1| L-sorbosone dehydrogenase (SNDH) [Pseudoalteromonas haloplanktis 
TAC125]
 emb|CAI87634.1| putative L-sorbosone dehydrogenase (SNDH) [Pseudoalteromonas 
haloplanktis TAC125]
Length=364

 Score =  107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/69 (76%), Positives = 58/69 (84%), Gaps = 0/69 (0%)

Query  1   MAKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVA  60
           MAKNILDKLTVA GF +SLFA DVENAR++ VS KGIVY GS KAGNVYAL D N DGVA
Sbjct  19  MAKNILDKLTVAPGFELSLFASDVENARQVVVSKKGIVYVGSRKAGNVYALIDHNSDGVA  78

Query  61  DEKILVASG  69
           D+K+LVA G
Sbjct  79  DKKMLVAEG  87


>ref|YP_561911.1| putative L-sorbosone dehydrogenase (SNDH) [Shewanella denitrificans 
OS217]
 gb|ABE54188.1| putative L-sorbosone dehydrogenase (SNDH) [Shewanella denitrificans 
OS217]
Length=361

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 52/64 (81%), Gaps = 0/64 (0%)

Query  6   LDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVADEKIL  65
           LD+L++  GF +  FA+DV +AR++A+SDKGIVY GSM AGNVYAL+D++ DG A+++ L
Sbjct  21  LDQLSLPPGFKIDYFAEDVVSARQMALSDKGIVYVGSMNAGNVYALQDKDNDGKAEKRWL  80

Query  66  VASG  69
           +A G
Sbjct  81  IAKG  84


>ref|YP_750732.1| L-sorbosone dehydrogenase, putative [Shewanella frigidimarina 
NCIMB 400]
 gb|ABI71894.1| L-sorbosone dehydrogenase, putative [Shewanella frigidimarina 
NCIMB 400]
Length=367

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/63 (50%), Positives = 49/63 (77%), Gaps = 0/63 (0%)

Query  6   LDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVADEKIL  65
           LDK+ + EGF + ++A+++ENAR++A+ D G V+ GS KAGNVYAL D + D  AD+KI+
Sbjct  26  LDKIKLQEGFTIDVYAENLENARQMALGDNGTVFVGSRKAGNVYALIDSDNDFKADKKII  85

Query  66  VAS  68
           +A+
Sbjct  86  IAT  88


>ref|YP_003145905.1| NHL repeat containing protein [Kangiella koreensis DSM 16069]
 gb|ACV26137.1| NHL repeat containing protein [Kangiella koreensis DSM 16069]
Length=364

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 43/59 (72%), Gaps = 0/59 (0%)

Query  11  VAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVADEKILVASG  69
           V EGF + LFA++V+ AR++A+SD GIVY GS K G V+A+ D++ D   DE +LVA G
Sbjct  26  VPEGFKIELFAENVDGARQMALSDTGIVYTGSRKPGKVHAMIDKDNDFKVDEVVLVADG  84


>ref|NP_951254.1| L-sorbosone dehydrogenase, putative [Geobacter sulfurreducens 
PCA]
 gb|AAR33527.1| L-sorbosone dehydrogenase, putative [Geobacter sulfurreducens 
PCA]
Length=379

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)

Query  2   AKNILDKLTVAEGFNVSLFADDVENAREIAVSDKGIVYAGSMKAGNVYALKDRNQDGVAD  61
           A+ +   +T+  GF+++++AD+V  AR +A+  KG ++ GS   G VYAL DRN D VAD
Sbjct  26  ARTLPAAITLPPGFSIAVYADNVPGARSMALGAKGTLFVGSRGEGKVYALADRNSDQVAD  85

Query  62  EKILVASG  69
           E I +A G
Sbjct  86  EVITIAKG  93

Personal tools