IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Homolog hunting: BLAST"

Thread subject: blast result

[ Return to forums ]
blast result
SAM
28 Apr 2011 16:39
Non evaluated contribution
external  group:
>gi|297180451|gb|ADI16666.1| polyketide synthase modules and related proteins [uncultured Rhodobacterales bacterium HF0010_04M21]
MTLTTEDGKPCEGIDQGPFEPIAVIGLGALMPDAHDIDAFWQNILDAKVSIKALPEGRWPGPIDHFWKEG
GPGAHTEGFTYAKIGALVSDAEFDWRRWRQPPGTLPQIDPCQLWAVTVSADAIEHAGYDGDAKDIDRTRT
GVVFANALGGENRNLSNLRVWSDHTGAVAKAHGLPEENLGAFSDAMLEGAPRVDEDTMPGELANVVSGRV
ANLLDLQGPNHAMDAACASSMAAVLDACRLLQTRQVDVMLAGASDRTMDPATFAKFSAIGALSPSHSSPF
DARANGFVMGEGAGVLVLKRLSDAMRDGDEIYSVIRGIGGSSDGRGKGITAPSQRGQIQAIARAYSQAGY
DASSVELVEAHGTSTKVGDATELSTLSRLWTGVEGAGNVAVGSIKSQIGHLKAAAGIAGIMKSVMALHHR
TIPPSANFETPNPTVDWSNIPFFVPTAPLEWPRPSSHPRRAGVSAFGFGGTNFHIALEGYEPDYHAPMAA
EWDARWTAYSGQGPISAPSIFDGSLPATMTHDEIKAVEGGLMLLSASSLEALHEAVQAISFEGPLFDDDP
RGLRLSSALQTASASFDAEAPFRMALVATSWAEFTKRQTLAGQAMLDAEKWGFLQAQGVLVTDQPAMPAE
AKIVHMYPGQGSQYVGMTADLVQRFTAPAEVWSQADETMVEVLGGETLSGFVLRSSLSKEELKEAEHKLK
QTEYTQPAMLTADLAIERTLGAYGHAPDMVAGHSLGEYAALMSSGILDMDGALRAAAARGTEMGSVEIDD
KGLMASVTAPYETVEAVLEATEGYVIAANKNSPKMTVIAGETAPVKAAMATFEEQGFSCVALATSHAFHS
RIVAPANEPLRRFLEGLEIRWPSVPITANVDGAFYPTEGADSKAAILEQLAPQMSSSVEWTKQIETMYNA
GGRVFVEVGPKRALTMFAMQILEGKPHVPVMTNHPKQGGVASFLTAIGALALAGRPPVWPSLDALQDGFK
AGPVEARSAGVLTPTVSSAELESLRVRARPLPGSGGAAPSIVAPAASPAAVVHAGPLDADYARDRAIRAY
VGDRIAAYSGYPASFCHGHVSLTDGLGLTPQQVQSVVATIAAEATTDAEYNPSGALTAGDLNRWVSAPPA
SWAPMTSLAAPAPLKVAPVQATAALQTTSRRDVDPYVVTGISLGLPGMDRVFSEDAFEKLVRGETCISEV
SDEYKQRLLDKNIVRLIKGRDGSVNMDQAKVFGDIPQLAGLKGAFDLAEEFGIDPKAILAWDISTQLAVA
AGLLALRDAGIPLTPVEQVGKGGLRLIRNWQVPQVQRERTGIVFSSCFPGLQMSIKHAKNDGDDGEGRFD
RRYLFQTLNMGHSQFAQYTGIRGPNTTINLACATATAAFGVAEDWLDAGRVDRVVIISGDDVTGDDLWEW
IAGGFAASGAAATNNVVEETALPFDRRRNGLILGMGAAAFVVERHSEAQQRGVQPIAEVLGSTTANSAYH
GTRLDVDHVGQVVNGFITDMERRWGLDRHAMAPNTVFFSHETYTPARGGSAQSEVKALRDTFGESTNKLV
IANTKGFTGHPMAVGIEDASMLYGLKTGRIPPIANHREKDPELGDLNLSTGGDYPELQYGLRFAAGFGSQ
IALSLMRRWPVQGERINGAKLLAWARGLAGTDDVVMRVLQNKLVAYVNGDDNLHGGVQGDPWPPTAEWEG
RPSVVDAPAAPAAPAAPTPPVSPAPAEAPTPAVPAPAGPVVADGEMVATVIEVVVNHTGYPADFVELDQD
LEGELGIDTVKQAEIMADIRERFGLPVDEDFVLADYPTLNHMIGYIQRMTGSGGVAPSATPTPVASSPAQ
PPAPVASQDVPAAAAPAAAMAPATVVGDAEMTATVVAVVVEHTGYPADFIELDQDLEGELGIDTVKQAEI
MADIRDKFSLPIDEDFVLADHPTLNHMIGYIQRMKGGGSGTAPPAPVPAPAVSATPAPAAATVPAPVVPA
GSHADIEEVLVAVVVDHTGYPADFIEMDQDLEGELGIDTVKQAEIMAEIRDRFALPVDEDFVLADHPTLN
HFTAYIVKMRGGTTGTAGTEPEPTGDEAAAPVGQDRPSSHEDGTRRWQVEIEDCPGEAAPLVVSGTVVVS
DDGWGIAEAFCRRMEARGLSAVRVGFESRIRTASRHDEGGRTVYRADPEQPEHLAWIAEQLEGTVVAGLV
HMAPLKLASEQWAEDSYPSSQIALAAHGWFGLLKELGGALSTDAPGFVASVTSLDGRHGNLGDRFNAVQC
AASGVTKSYAFERPDLRCRALDLHPDFVLDEAEAAQRIEDDVFGLGGEVEVGLDRDGRRWALVAFAEDVV
DELQPLTSEDTWLVSGGGSGVTAASVIGVATASNGAGANFELLGRSKLIESTAEWINWSEDQLMEEKNAL
RQRLVDASESGKVTMVEWNRAWQRFTRSRDVYITLNAIAETGNQAHYHAVDVMDRQALQDLGTSLGRPIT
GIVHGAGLEDSKLVADKGYDVFDRVVRVKVDGWQSLLSAVKASGPDAPSFACCFTSVAGRFGNGGQTDYA
AANSVLDAEMARLTAAHACRAVAIGWTGWRDVGMATRGSIEAVFAAAGIETLAVEDGVAIFVDEALRGGK
RRVLGCGSLGLMDRFSSFREAPLKLPGAMAAAMADPTRFPFVDKVVAFEEGQRLTTQSTLSTSDHPFLDD
HAIEGVPYHPGVMALEMFAQASLLLHPSSCLAGFEEVTFGLPVKLIKGPMTVRVEAEVDRVDGDLTWVRC
RLVSDLMNSKGEVFGQRDHHQAMVRLVEKQDDLRPFLEREVGMLPAIGTPPLAELLHPASFIYDRYFHGP
RFQSHGGVLGGVSDTNEPGIDGLALMRHQLPASDQFAVERSGEAVLLEALPMLIEAGFQNAGLVAMEVLG
YSSLPVGIAWSTMLRVPEEDEVLRLRTVQLEALEDGTTVHDVLVVGDDDAPVMALKGLRLKAMANVPDDQ
RFSLER
>gi|187251508|ref|YP_001875990.1| polyketide synthase [Elusimicrobium minutum Pei191]
MANKNLEPIAIIGIGAVMPEALNKETYWQNILDGKNCITEVPKDTHWDPALFYSPDHNAPDKTYSKIGGF
IRGFQFNSLKYRIPPQVAKQMDTVQYLAIETTSMALEDAGYDKKEFDRTRTAVIMGNAMGGMKAELSNTR
ANTPLFNEILKKTKTFSSLDPASAEALINEVWAGVNEAFMPITEDTMPGELSNVIAGRVANVFNLNGTNF
TVDAACATSLAALDQAVNGLRMGNYDMAVCGGIDQMMSPSAFIKFSKIGALSEDGSYPFDARANGFVMAE
GAGAVILKRLSDAVKDGDKIYCVIRAIGASSDGKGKGITAPNPKGQKLAVEKAFEQVEYTPGDVGLVEAH
GTSTRVGDATEVAALNETFAVNAKPGTIGLGSIKSQIGHAKAAAGIASLIKATLALHNKILPPSINFVTP
NPAIDWSTSPFRVITKPETWDSGKIRRANVSSFGFGGTNFHVALEEYHEGLKNFKPVSAAQDNNKTCGCN
ASNAKETVMDSKYKLLVEPEKLQGEMLTFSADSKQELFNELQRAVVASSADPLYIPKAAYANHTAPHKQF
AVVINVESIEKLKEKIAFFMKIAGTMDVWSQDSLHLRMKGIYPFKPSKHTPKVCFMFPGQGSQYVDMMKD
LSSKYKVVKDTFDEADRVLKDLIDTTLTEVIWSKEGEGKEDYAKREEAIKQTQMTQPAVMTADVAMMRLL
SSFGIKPEVVMGHSLGEYAAAVAAGIFDFENGLKSVTNRAKSMQSIKVEDPGMMISVSAPVERVEPELKK
INGYIAVANKNCPTQTVIAGDTKAGEAALKMFTDMGIQSVRVPVSHAFHSQIIKPAEAPYREFLNTLTVS
APKLPITSNVTADFFPNNTNKIKDLLVEQLVSSVEWIEQLKRTYASGVRLFVECGPKRVLSAFAANTLDD
KKDIKVMASNHPKKGGISEFNDLLANLTASGISLDWEGTGLNGGDVLNPAYKAWVTGTRHSEAEQQPAPV
AIAKAQECKMNGNDIVISGIAAGTPGSWEKVFRNGALDEILEGRNLIENLTPQMQQSQIDKNVEYVVKSP
DGNHRVEHLNSISQAIKLSARAGSFDLEKEFGLPAKWVASMDKSFKLAIAAGILALKDAGIPLTLYYKPT
STGGYLPDRWGLPAEMIDTTGVIFTSAFPNTNSMIGEVLRCLTSELAGKSKEDIYKFYEHLISKITDPSL
KREISEWFALNYAKYGDKKEVFAQDFLLKSIPIAHSHFAQWIRARGPATHLSGACASTAQAVGIANDWIK
LGRAKRVIVISGDDITNETLQGWVMTGFLASGAATTEGDVTKAAVPFDKRRNGMIVGMGAAALVVESADE
TAKRGMSPLVKVLETEIKNSAFHPTRLDVNHIAEVMDQMVARAEKHYGLTRSEIANNLVFISHETYTPAR
GGSASAEVHALKKTFGPDVEKVIVSNTKGFTGHAMGAGIEDVIAVRSLNTGIIPPIANYKEADPELSGIT
LSKGGKYNFKYSLRLGAGFGSQIGMTLMEKAWSEGTPRIIDQAKHNAWLKQISGQENPQLEVVQNTLRVK
DNFVPGHKPSLIMEGAQAFVDKVKPAAVSRPAVSQAAMPASVIQPTPAVQPAPVQAAAPAAQPAPVTVQK
ASSASLDKSTVTKEIVDLISEKTGYPQDMLELDLDMEADLGIDTVKQAELFAAIREKYGIAQVEGGAGIQ
LKDYPTINHVIGFVLGGASGSGSVAPVAATPAPVAQPAPAVQPVPVQAAAPAAPAPVTVQKASSSFLDKG
VVTKEIVDLIAEKTGYPQDMLELDLDMEADLGIDTVKQAELFAAIREKYGIAQVEGGAGIQLKDYPTINH
VIGFVLNGASGSSSVAPVAATPAPVAQPAPAVQPVPVQAAAPAAPAPVTVQKASSASLDKGVVTKEIVDL
IAEKTGYPQDMLELDLDMEADLGIDTVKQAELFAAIREKYGIAQVEGGAGIQLKDYPTIRHVIGFVLNGA
NDYDSAASVAATPAVTPAPVAAPATQPAPVVQPASAAQSAPVAQPAPAPAPASVTVQKAANSVDEGAVTK
EIVDLIAEKTGYPQDMLELDLDMEADLGIDTVKQAELFAAIREKYGIAQVEGGAGIQLKDYPTIRHVIGF
VTNPPSAPVAAQPTPATVEAAPAPAVQPAPTAQPLPVQEAAPATIKEEKPYQGENCHDKKLRYIPTLVDA
PLTEKSDRKLSKERTVLIFADNSQLIKAYTEWFKKQNIPTHVFTTLKARSKNTTIVNWDSVEETEAVLRD
YQKESPGTQGIVYLLGAGLKKFDKKNNPHAELVKHVMPLFIALKVFETDLADRKDSDTFFAVNIKVDGAF
SYATKEMFNPTVGSLSGGVQCFRKDMFEVSGCMSKFLDFEPETSPDEMAEKTMEEILHGDMRFMISFKDG
KRSTILSLPTRLNKKEKNFDIAGKTIVFTGCGRGIGSLLSQKIAAQYKSKIIVLDIIEINEKTPVWAGMN
EAELAALKNQIWADLKANPNVKATPVMLDREFGKVKDSITLYKNLEILRNLGSEVEYYQCDVMNGTQMKE
VVTKIKAKGGRVDGLIHFAGLERSKLVRDKTVEEYFRIFDVKATSGAAFLALNLVKDNGFYAFASSIAGK
YGNLGQSDYGSANDYLAKLSMSLHNQGIRSISIAMSAFSNVGMGIRPGVETFLKSNGVDFVDPQDGMQLF
LDEIVYGRVPEIVLTDVLGKLDWDSQIKTDWEEIVEENDPSSGNGGGASSAPAVQKAAEEEPEPADLKEN
HFLGQIKSLTPGESLEAEKEFTMESDYYLADHAIEGTPYVPGVMGLETFMESAAEMLGKTPKGLEDVHFY
LPIKLLRNRPQTVRIKGALVNGNGEFEIESDFINSKGVKMGDTRRHFTARALGKAESKWNAIKDTIKLSD
GFKVTKQEIYKKYFHGPSFQVLEGVLDITENTVLAKYRKPEEKLFTDGDKKLIAYPLLVEAAFQACGYRD
LSVDNRMNLPDSIGQYIVHGKGKAPESLYLYGVYKGLSIEGKSIYDAYVFDEDMNLWIELSDYYGIGQ
>gi|94967496|ref|YP_589544.1| beta-ketoacyl synthase [Candidatus Koribacter versatilis Ellin345]
MESTAHRAIAIVGLGAILPDAPDVNTFWSNVQSGRDSISEVPSERWDPNLYYDPDPSVPDKTYSKIGGWV
RQFNWDPMKWHLPLPPKVSGAMDPAQRWAIACTREALADYGFPDRPLETDRTAVILGNAMAGEMHYMTAL
RVFFPMYAKELATAPTFAALPEDLRVEITRQLHERVGERLPEITEDSMPGELANCIAGRIANLYNFHGPN
YVVDAACASAMGAMNAAIQGLVEHQFDVAVTGGIDRNMGASTFVKFCKIGALSATGSRPYAAGADGFVMG
EGAVVFLLKRLEDAERDGDKVYAVLRGIGGSSDGKGKGITAPNPVGQILCTKRAWENAGLSPADVNYIEG
HGTSTRVGDVVEVQSMIDVLSEYSLPSHSIPIGSVKSNIGHLKAAAGAAGILKTVLALHHKVLPPSVHCD
RPTPDIDFANSPLFVNTKLRPWEMPPDSVRRAGVSAFGFGGTNFHTVLEEYIPGRLKPKARNARGAADNP
VNAHEIVAAAAPQNGLKAPMRGVLVLGAASKSELKGRLRNWNPEGAETPKPPLASDLQADYRIAIDYGAP
AELKQKIAAALKAFDADQFAVWKALRAQGIFHGQGPAAKVAFLYTGQGSQYVNMFRSLKEREPIVTQTFA
AADRVLTPLLGKPLTEYIFVDSKDEKAVEQAELDLRQTAITQPAVLCVDLGITRLLDAYGIRPDMTMGHS
LGEYGALVASGCLPFEEALEAVSARGREMTRVSVKDKGKMAAVFAPLFEVERLLKTVAGYVEIANLNSEQ
QSVIGGASDAVDEACTKLLAAGFNVVPLPVSHAFHTSIVAPASGPMRDTLERMHLQSPQIPIVANVNGEF
YPTGPNVIPQMLDILAKQIASPVQFIKGLQTLYRSGARIFVEVGPKKALHGFAEDVLGKDEDVLALFTNH
PKWEDTAAFNQALCGLYAAGLGRGRTDHAIETVSENKQPSIPALAHTALEELNMPVTTVLSEDRFSRLGH
LVAEFLDRASEMREIPSLAPRSNEPIAITGAALGLPGTDRIFDDSNIARLLRGDQFIDVVPNRFRRAMVD
RHIRRLVKRENGDPTFETIEDVSEAIKLAGRGGAFDLEKEFGVPADRVAAFDRTTALALGAGIDALRDAG
IPLVMRYKTTSTGSQLPEHWALPDAMRDDTGIIFASAFPGSDSFAEIMGGYYDDRLRREQLQMLRELRQQ
VVSNGHGGVAQEIDRRITELAAAMEQNPYSFERRFLLRVLSMGHSQLAEYIGARGPNTQINAACASTTQA
VSIAEDWIGAGRCRRVLIVSADDVTSDNLLPWFGSGFLASGVAATDDSVEKAALPFDRRRHGMIIGMGAA
SLVVESAAAAKERGILPICEVLSTVTRNSAFHATRLDVQHIGGVMDELLLRAEASRGIRRKEIAPHTVFV
SHETYTPARGGSASAEVFALRKAFGETADQVVIANTKGFTGHAMATGIEDVLAVKTLETGCVPPVANFRE
IDPELGALNLSRGGSYPIEYALRLGAGFGSQISMSLLRWVKSSDGLRATPSALGFQRRIADREVWSQWLE
KVANVSNPDLEVVNRTLRIRDSGAPAVVAVTATKGAAVTASQAPQKPVTVAVQPIEPPKPQTIEDPVRQR
ILQLVADKTGYPSDMLALDLDLEADLGVDTVKQAEVFAAIREQYNIPRRENLRLRDFPTLAHVIQFVYDN
RPDLSSPAPVAPTVNTPAIVVLPLVEEENDEVKDRLLELVVEKTGYPKDMLEMDLDLEADLGVDTVKQAE
LFAAIREIYSIPRQESLRLRDFPTLKHVVKFVYDMRPDLAQNAPVVPKTNVASPASSEQPTANAAVADSI
TDRILDMVVEKTGYPKDMLDLELDLEADLGVDTVKQAEMFAAIRSIYNIPRDENLKLRDFPTLKHVIQFA
RERSTIAGPAVETPVVATQAETALASKARSIANFAETNLVPRRVPVPVLRPPLELCKPTGVVLGTGTRVI
VMPDTGGVAVQLIEQLRALDVEVLTFDTTPDSAALDTAIQKWSVAGPIQGVYWLSALDFEGTLTEISSEA
WRNAIVVRVKLLYRTMRALYEQFASPSTFLVSATRLGGQHGYDSAGALSPMGGAVAGFTKAFKRERMNAT
VKAVDFGPEPSPVQVAESLISETRFDPGAVEIGYKQSLRWTIGLHERPAEDGGAGLELGPQTVFLVTGAA
GSIVSAITADLAAASGGIFYLLDLVPKPDPINNDLKQFAADKEGLKRTLATRLSTGKKRATPAMVEKALA
ELERQIAAQSAIDAVQSAGGVVHYHALNLTDEQAVEKVIDEVRKEHGRIDVLLHAAGLERSHFLPDKEPK
EFDLVFDVKADGFFHLLHAIGEMPVSAVVAFSSIAGRFGNGGQTDYSSANDLLCKIVSSFRSQRSGTRGI
AIDWTAWDKIGMASRGSIPKMMEIAGIDMLDPQAGIPLIRRELTMGATRGEVVAAKRLGMLLDEFEATGG
LDLEALENSREQLALRGPMVGKITGMGIHNGLTMETQLDPIAQPFLNDHRIDGTPVLPGVMGIEAFAEAA
LCVHPGWHIEAIEEVNFLAPFKFYKDEPRTILVEAVFRQDNDHLITECRLIGRRILATQQEEQETTHFTA
KVRLHKHPPELSSGVRPHLSPDSIVDSAKIYRVYFHGPAYQVLERAWWDGTHLIGEMSINLPFNHQPESL
PTQIAPRLIELCFQTAGLWEMGANSKLGLPTRVDQVVAWPMANAVPHPLYAVVTPHPEHGTFDAEVVDAD
GNRYLRVDGYHTTALPAPIDPEVLTSLQQLITPEGVTVPSTH
>gi|148657018|ref|YP_001277223.1| beta-ketoacyl synthase [Roseiflexus sp. RS-1]
MSDSAERAIAIVGVGAILPDAPNAPAFWNNILNKRYSITETPPERWSIADYYDPDPAAPDKTYSKIGGWV
RGFTFDWKRFKIPPRVAAAMDEGQQWAVTIAAEALADYGYPERPLDTDRTGVILGTAMGGELHYITHQRI
VFPDYVHLLERTEAWRRLPRDVQQALIAQWHAELDRSLPPVTEDTMPGELPNIVSGRVANVLNLRGPNFI
TDAACASTLAAVDAACEQLIHHQCDAVLTGGVDRNMGASTFVKFCKIGALSATGTRPFGDGADGFVMGEG
SAAFLLKRLADAERDGDRIYAVIRGVGGSSDGKGKGITAPNPIGQILAVERAWQDAGLDPATATLVEAHG
TSTRVGDVVEVESLSSCFGRAERGSIGLGSVKSNIGHLKAGAGAAGLLKAVMAIYHKILPPTLNCEKPNP
NINFNATPFYLLTEAREWERRGNTPRRAGVSAYGFGGTNFHVVLEEYIPGMIRTEPKVYASAAVPQTGTT
SSTTAAMGVASSTVTASAPPPTGPKLRSAKMPLRGILAIGAPTPKALKDKIDAIYQKVEGGWTPPVAPPD
PNELAQPERVVIDFGNHDELLDRLKKAQKAAGFDSPAAWKSLQAQGVFRGSGPKPGKIAFLFPGQGSQYV
NMGRELLSEPAFAEVIKEGDAVMTPILGKPLTSYIYVDANDPDALKKAEYDLMQTAITQPAMLMLDAALC
RLLKEYGFEPDMVMGHSLGEYAALNAAGIMPFAEALEASAARGAEMSKVKVDDNGWMAAVMGPLDVVLST
LNEIDGYVIPANINSYNQVVIGGASKAVERAIEVFTQKGYQAQRIPVSHAFHTRIVAPASGPLRKQLDRF
HIAPPRIPLVANVTGELYPTTVEEIKDILEKQIASPVQWVKGLETLYREGVRCFVEVGPKKALKGFVDDV
LGNKPDVVSLFTNHPKTGTLQSFNQALCGLYAAGYGLADETIDARQDGATQSSATVAATVASAAPSVASA
SAPVVSASASASAPVVSAPVSTPAPVASATAVASAPARPTTEEANMVNGIPIDTLGKLLVQALQGAQAVH
PATPGAPVYDRNLPPTGSVVISGTGLGLPGAEKPVMDEQNALRILHGEQFIDLIPERFRRQMLAHNITRV
VKSEDGSGSFETLTEPDEVIRLAGRPGPFNLSEEYGVPAKLVEALDSTTQLAMAAGLDALREAGIPLVQT
YRRTTTGKDLPDRWMLPEALRDETGVIFASAFPGLDRVAEEFERYYTYEHRREQLEMLEALRQTTTDPAT
LSEIVRRIGELRSLLEREPYVFDRRFLFRILAMGHSQFAEYIGARGPNTHVNAACAATTQAIAIAEDWIR
TGRCRRVLVIAADNVTSDHLLGWIGAGFLATGAAATDDRVEEAALPFDRRRHGMILGMGACALVVESEDA
VRERGMRGIVEVLSTEAANSAFHGTRLDVEHISSVMNSLMTAAERRFGIDRRTIAPHLVFVSHETFTPAR
GGSASAEVVALRKTFGEAANQVIVANTKGFTGHPMGVGIEDVIAVKILEHGIVPPVPNYKEVDPDLGTLN
LSRGGRYPVQYALHLAAGFGSQIAMTLLRRVPGSIDRIDNRARYDYWLDQVSGYDHAETEVVKRVLRIKA
QGAPARRPAPSTWQPGTGPTLRAAAPGDSVTVAPATIQYAPAPQPTPVAPPPPPKPVEPPAPVAPAPING
KPVETAPVAPPPPAPEPVVAPPVAPAPAPVAPAPAPVAPAPAPVTAAPAMDGVTAKVLQIVAEKTGYPPE
MLDLDLDLEADLGVDTVKQAETFVAVREAFGIPQVENLRLRDFPTLRDVVGFVYKQKPELKPSAPSVAAP
AVAAPPAPAPAVAPAPTSVPAPAAAPAVDPVAAKVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAET
FAAIREAFGIERIENLKLRDYPTLRHVIDFVYERRPDLKPLAAPAPAPAMAMAAAAPVAAPAAPAAAPAP
AADPVAAKVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFAAIREAFGIERIENLKLRDYPTLRH
VINFVYERRPDLKPSAAPAPAPAMAMAAAPAATSAPVTAPVTPAAAAAPVADPVTERVLAVVAEKTGYPP
EMLDLDLDLEADLGVDTVKQAETFAAIREAFGIERVEDLKLRDYPTLRHVINFVYERRPDLKPTAAPTPE
PAAPPVAVAAATPAPATATTVAADPVTAKVLAVVAEKTGYPPEMLELDLDLEADLGVDTVKQAETFAAIR
EAFGIERVEDLKLRDYPTLRHVINFVYERRPDLKPTAAPTPEPAAPPVAVAAATPAPATATTVAADPVTA
KVLAVVAEKTGYPPEMLELDLDLEADLGVDTVKQAETFAAIREAFGIERVEDLKLRDYPTLRHVINFVYE
RRPDLKPTGEASATPVAPVADPSAPTAPAPAARPAVTLVPVENADMVPRRVVVPALRPPIELCKPTGVVL
DGNTRVVVMMDRGGVGKALLNRLEKRGVGTLVFDEPPSAEALEQQLKGWLAEGPIHGVYWLPALDVEPAI
EDMDLATWREHNRVRVKNLYLTLRTLYDTLVGPGTFLVSATRLGGLHGYGPEGASAPLGGAVVGCTKSYK
RERQNILVKAVDFEPGRKTAEPADLLIAETLFDPGVVEVGYRDGLRYTVTFEERPAVDGTPGMYLGKDTV
FVVTGAAGGITSAITADLAAASGGVFYLLDLTPKPDPDDPNIALFRQDKEALKRKLIDDFRAAGERPTPV
MIDRKILAIEREEAALRAIEAVQAAGGTAHYFSVNLLDGPGVAAVIADVRERYGRIDVLLHAGGIEISKA
LPDKEPKEFDLVFDIKADGYFSILNAAKGMPIGAAVVFSSVAGRFGNSGQSDYSSANDLLCKVTSSMRSW
RPETRGIAIDWTAWGGIGMATRGSIPKIMEMAGIDMLPPEAGIPTIRRELTQSAFRGEIVVGQRLGILGA
EFDETGGLDLSKVDTGGRLMIGSVKAFKLYGGIEVETTLDPKEQPFLYDHQIDGVPVLPGVMGTEAFAEL
ATLLTPGFRVASITEQFSSPFKFHRSQPRTLYMSATIHPTGHGTLVAKTTLRGMVQPRPDMPPRFDTHFV
GEVYLTTAPVEERTINFTPPSAEALDIDRERIYRVYFHGPAYQVMERVGVMGDQAVALMTDGLPPNSVPE
TPMLVAPRLIELCFQTAGMWEMVTHRAMALPAAIGSVTIYRHPESAEGRRLYALVTAINNGSSYDAHVVD
TDGNVYVELRGYRTVRLPGEVNV

>gi|310818848|ref|YP_003951206.1| beta-ketoacyl synthase [Stigmatella aurantiaca DW4/3-1]
MTLEAMEGEVVAALARGTGYVPELFGRDADLVNGLGMTQEELRDAVAGVEQKLGLPVRLSNNAAQHATVG
MIARNMLKIVEGGAPAATAGDVTLDQVLAFVDDCASRNERPVLETLLAETNGALSRLDAAAGAKATPVPV
KAEPGPGLLADPASVMKLLVGALVERTGYPEDMLEPQLDLEADLGIDTVKQVEAFAMARVALGVEKDENF
RLRDHNTLRKMVDYLVPRASGASPAAAAASPSLAPAAVVPAPAPALPAPAVQPTMAVGPVLEFLSQGMAE
KTGYGLEVLQPDLDMEVDLGIDTITQIEVFALARTKYGVERNGEFRVRHYNTLRKMAEYLVSKASGAVHA
EAPAAPVAPAAPAAVAQDAKPASAAPAAAPDAVMNLLVGALVERTGYPSDMLEPDLDLEADLGIDTVKQV
EAFAIARTALGVEKDENFRLRDYNTLRKMVGYLTGRAAPTAAAPAPTVLSPAPVVAPAVPVAAAAPSAAL
EARPEAVMALLVKALVERTGYPEDMLEPDLDLEADLGIDTVKQVEAFAMARVALGVEKDENFRLRDYNTL
RKMVDYLVRMAATGPAPLASQAPSVSAPDVPPPSPVAPPSAPAGQAVSVEKVQAFLVSVLQEKTGYNTEI
IQPDLDMEVELGIDTVTQIEAFAIAREKFGVPRNESFRVRNYNTVGKMSAYLAANIPGGKGAPPPQAEPQ
AAASAAAPKGLSLEDVRRFVAQCEAKGDVESLRRLAAHLGGTLQAPARPRTPLAPPAQFAGKRYEVHPVE
QSAQVRNENIAHLKGKTIGISTDAHGAHKQLAQMLESAGARVVVLYTGLAPGGGVSLDWKQPEAAGSRLK
ELQQTQPLDGLILLHTTAAAPKLSELDAPAWASAVNTFTLGLYYGGLAVYDRINEIPGGGWYLVATAGGG
LFGHANAHGQVPLAGAAGGFIKCLRRELPNSRCKAVDLDGQDSSSWAKQIWTELVSSDPDVEVGYNGGRR
YAFRDIETPLATAKQALSIRPGAVVVVSGGGRGVVYHSAKLLAQVTGARVIVTGRTVPPEGNEEWLKVSD
KDLPAYRMGWIKRYMAEHRGSTPVQAMRAFDSGVAYRREVHRNLEDCRAQGVHLEYKVCDMTDVASVRAL
LAGVRQQYGRIDGIVHGATIEESKSLPMKTPDSFVRTLNAKAHLWQLLVQETWKDDLQFFINFGSGSGRY
GNKGQTDYSAANYLVARAGQVYGALRPEVRSVTIDWPVWVGAGIVENNADYLERLRKLGVCVIDIAEGAY
WFVGEILHGGASGEVVIADDKTFESVGWPRHDKEGLRVVGKEAGGTRYAI

Study group

>gi|156742830|ref|YP_001432959.1| beta-ketoacyl synthase [Roseiflexus castenholzii DSM 13941]
MSDTTERAIAIVGVGAILPDAPNAPAFWTNILNKRYSITETPPERWSIADYYDPDPAAPDKTYSKIGGWV
RGFTFDWKRFKIPPRVAAAMDEGQQWAVTIAAETLADYGYPERALDTDRTGVILGTAMGGELHYITHQRV
VFPEYVHLLERTEAWRRLPREVQEALIAQWHAELDRTLPPVTEDTMPGELPNIVSGRVANVLNLRGPNFI
TDAACASTLAAVDAACEQLIQHQCDAVLTGGVDRNMGASTFVKFCKIGALSATGTRPFGDGADGFVMGEG
SAAFLLKRLADAERDGDRIYAVIRGVGGSSDGKGKGITAPNPIGQILAVERAWKDAGLDPATATLVEAHG
TSTRVGDVVEVESLSSCFGKAERGSIGLGSVKSNIGHLKAGAGAAGLLKAVMAIYHKILPPTLNCEKPNP
NINFSATPFYLLTEAREWERRGNIPRRAGVSAYGFGGTNFHVVLEEYIPGMIRTEPKVYAGAAVPSAGAA
GGASVALSAATSTVSASVPPPTGPRLRSEKKPLRGILAIGAPTPKELKDKIDAIFQKVEAGWTPPITPPD
PNELAQQERVVIDFGDHDELLDRLKKAQKAAGFDNPAAWKALQAQGVFRGSGPKPGKIAFLFPGQGSQYV
NMGRELLSEPAFAEVIKESDAVMTPILGKPLSSFIYVDASDPAALKKAEHDLMQTAITQPAMLTLDAALC
RLLKEYGFEPDMVMGHSLGEYAALNAAGIMPFAEALEASAARGAEMSKVKVDDNGWMAAVMAPLDVVLRT
LDEIDGYVIPANINSYNQVVIGGASKAVEKAIEVFTQKGYQAQRIPVSHAFHTRIVAPASGPLRKQLDRF
HIAPPRITMVANVTGELYPTTVEEIKDILEKQIASPVQWVKGIETLYREGARCFVEVGPKKALKGFVDDV
LGNKPDVVSLFTNHPKTGTIQSFNQALCGLYAAGYGLVDETADVQKDGSAQARVATAAVATTGASAPVAA
SAPAPTPAPIAANAPAPQPVSASAPAVPQVAAGAAVSQTVEEATMGNGIPLDTLGKLLTQALQGAQTTQR
PAYNAPVYDRNLPPTGSVIISGTGLGLPGAEKPVMDEQNALRILHGEQFIDLIPERFRRQMLAHNITRVV
KSEDGSGSFETLTEPDEVIRLAGRPGPFNLSEEYGVPAKLVEALDSTTQLAMAAGLDALREAGIPLVQTY
RRTTTGKDLPDRWMLPEALRDETGVIFASAFPGLDRLAEEFERYYTYEHRREQLEALEALRRVTTDPATL
AEIVRRIGELRDLLEREPYIFDRRFLFRILAMGHSQFAEYIGARGPNTHVNAACAATTQAIAIAEDWIRS
GRCRRVLVIAADNVTSDHLLPWIGAGFLATGAAATDDRVEEAALPFDRRRHGMILGMGACALVVESEDAV
RERGMRGIVEVLSTEAANSAFHGTRLDVEHIAGVMNSLMTAAERRFGIDRRTIAPHLVFVSHETYTPARG
GSASAEVVALRKTFGESASQVIVSNTKGFTGHPMGVGIEDVIAVKILEHGIVPPVPNYKEVDPELGTLNL
SRGGRYPVQYALHLAAGFGSQIAMTLLRRIPGSVDRIDNRARYDYWLDQVSGYDHAETEVVKRVLRIKPQ
GAPARRPAPSAWVPGTGPTLRAAAPGDGVAFAPAAIQYAPAPQPVPIAPSSVPSTPAPVAPAPTNGKPAP
TPVASAPLPAPAPTPVASTPPPALAPTPVASAPPPALAPTPVAPVAPVPEMDGVTEKVLQIVAEKTGYPP
EMLDLDLDLEADLGVDTVKQAETFVAVREAFGIPQVENLRLRDFPTLRDVVGFVYKQKPELKPSAAPVVA
APPAPAAAPADGAPSAPAIAPAVAASSAPVVDTVAAKVLDVVAEKTGYPPEMLDLDLDLEADLGVDTVKQ
AETFAAIREAFGIERIENLKLRDYPTLRHVINFVYEHRPDLKTMAVSAPEPVAAPASAPAPAAAAAPAAP
AATADPVTERVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFAAIREAFGIERIENLKLRDYPTL
RHVINFVYEHRPDLKTVAVSAPEPVAAPASAPAPAAAAAPADPVTERVLAVVAEKTGYPPEMLELDLDLE
ADLGVDTVKQAETFAAIREAFGIERIENLKLRDYPTLRHVINFVYDHRPDLKPSATPAASAPAPTAAAAP
AAPATTADPVTERVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFAAIREAFGIERVEDLKLRDY
PTLRHVINFVYDRRPDLKPSEGVTTTPVATGAAPVASAAPTPAAQPAVTLAPVENADMVPRRVVVPALRP
AIDLCKPTGVALDGNTRVVVMMDRGGVGKALLNRLEKRGVGTLVIEEPPSAEELEQRLKGWLAEGPIHGV
YWLPALDVEPAIEEMDLATWRELNQVRVKNLYLTLRTLYDTLVGPGTFLVSATRLGGLHGYGPEGASAPL
GGAVVGCTKSYKRERQDILVKAVDFEPGRKTAEPADLLIAETLFDPGVVEVGYRDSLRYTVTFEERPTAD
GTPGMTLGKDTVFVVTGAAGGITSAITADLAAASGGIFYLLDLTPKPNPDDPNIALFRQDKEALKRKLIE
DFRAAGERPTPVMIDRKILAIEREEAALRAIEAVQAAGGTAHYFSVNLLDGPGVAAVIADVRERYGRIDV
LLHAGGIEISKALPDKEPKEFDLVFDIKADGYFSILNAAKGMPIGATVVFSSVAGRFGNSGQSDYSSAND
LLCKVTSSMRTWRPETRGIAIDWTAWGGIGMATRGSIPKIMEMAGIDMLPPEAGIPTIRRELTKSAFRGE
IVVGQRLGILAAEFDETGGLDPAKVDTGGRLMIGSVKAFKLYGGIEVETTLDPKEQPFLYDHQIDGVPVL
PGVMGTEAFAELATLLTPGFRVASISEQFSSPFKFHRNQPRTLYLSATIHPTGNGTLVAKTTLRGMVQPR
PELSPRFDTHFVGEVYLTTAPVEERTIDFVPPSTEALDIDRERIYRVYFHGPAYQVMERIGVMGDRAVAL
MVDGLPPNSSPDMPMLIAPRVIELCFQAAGMWEMVTHRAMALPSAIGSVTILRHPERAEGRRLYALVTAI
DGGASYDVQVVDTDGTVYVDLRGYRTSRLPGEVTV
>gi|115380763|ref|ZP_01467647.1| heterocyst glycolipid synthase [Stigmatella aurantiaca DW4/3-1]
MVDYLVPRASGASPAAAAASPSLAPAAVVPAPAPALPAPAVQPTMAVGPVLEFLSQGMAEKTGYGLEVLQ
PDLDMEVDLGIDTITQIEVFALARTKYGVERNGEFRVRHYNTLRKMAEYLVSKASGAVHAEAPAAPVAPA
APAAVAQDAKPASAAPAAAPDAVMNLLVGALVERTGYPSDMLEPDLDLEADLGIDTVKQVEAFAIARTAL
GVEKDENFRLRDYNTLRKMVGYLTGRAAPTAAAPAPTVLSPAPVVAPAVPVAAAAPSAALEARPEAVMAL
LVKALVERTGYPEDMLEPDLDLEADLGIDTVKQVEAFAMARVALGVEKDENFRLRDYNTLRKMVDYLVRM
AATGPAPLASQAPSVSAPDVPPPSPVAPPSAPAGQAVSVEKVQAFLVSVLQEKTGYNTEIIQPDLDMEVE
LGIDTVTQIEAFAIAREKFGVPRNESFRVRNYNTVGKMSAYLAANIPGGKGAPPPQAEPQAA
>gi|87309991|ref|ZP_01092124.1| probable multi-domain beta keto-acyl synthase-possibly involved in fatty acid or polyketide biosynthesis [Blastopirellula marina DSM 3645]
MTISTDRTDIPVAIVGMACRLPGAANLNEYWQLISEGRSAVGEVPADRLNRELYYHPDKGVRGKTYSTKA
AVLSDRTFHRDRCPLPQDLIDSVDNTHLLMTETAAEAFRHAGYDPFQLKDRNCSVFIGHAQGSSRLGELT
FRAYVDEAVALLEQTPEFQDLAPAERQAVEQQLLQDLLATIPEGAEGFRYLNCNMVAGTVAKAFGLNGSW
LALNSACASSLHAMLMGARALQRGRADMVVVGGASDCKSDSLVLFSNAQTLTKDDSRPFDSGADGLIMSE
GYVALVMKTLERAIADGDQIQAVVRGLGVATDGRGKSLWAPRKEGQMRAMRRAYRSGVDVSRLQYLECHA
TATQLGDATELETLREVLEPNFPKGKKIPITSAKANIGHALEAAGVAGMIKTILCMQHQQFPAAINIKEL
NTKVPWNESPFFVPMQPAPWSAPADGGPRCAAVNAFGIGGLNMHVVIDEYVGQTSEQITGGPRPVAETAD
DRAIAIIGLGCIAPGAAEINAFWETLQQGTDPKIEPPADRWSPLARQKAADKGIQVLGGFITDYAYDWRK
HKVPPKQVLEADPLQFMFLDASEQALADAGYDRESIQRELCGVVIGTEFGGDFGDQLEMGLRLPEMQAKL
TTLLQARGLAAEKIEAINQDFANVLLKKWPALVDETGSFTSSTLASRISKTLDLNGGAVAIDSGTTSGMS
GIALCIDSLLSGDNDMMICAAGQRRMGITMFDGLRESGLLHCDAEPKNVLDAGYNGVVPSEGAAVVVLKR
LSDARRDGDRIRAVIRGLGVATHDSPAEAMRMAVERASKIADIAPSEIQFVDIETDENNSSVSQSLSALA
HEHTSPDRKQPLHLTSGTAQFGHMGGGSSLITVLKAALESQHHEVSAARELQQSTAAFNGSTASVQTATV
NVKLGGRGVGAVASWSKGQAFYLMLDDGSVAPPKAIVQASTPSTAEPVQAARIVRLGAASLSELKNMVNV
ALADADSTFDQAEAKTFTPSDKIRLAIVADSVPALTKKLMMALPQLGNSASRQVLEQQGIFCREPLAAIP
RIAFLFPGQGSQYEGMLRDLVRQSPAAAQMMSEADAAMRRLGYPIFADLAWNAPTQLGADVWKTQIAMLL
ADLICLAALSERGVKPDVVLGHSYGEFPALYAAGVWNLDAVIRMTRARCDGINATSLNNAGLLATTAPPE
EIKQVIAACGCQAYLANYNAPDQTVIGGKLAALEQLSNALAAKSYPTRILAVPAAFHTPLMAGSSRMLQQ
ALETADMRTPQTPFISTVDNNLTEDPVRIRRNLGVQLTTPVKYAPLIEQLALETPTIFVEVGPQQTLTKL
NRRILSGDATVIASDNPKHGGIEPILCVEALLECLGVRAPVVSTPKPVPAKTATETRATFTAPQPAAAAV
VSQPITSSTDRAPVKPQPVASSRSSISTNEKNQMDDIPHFDATERRRAKMRGSAQASPPAASPPTPAPAV
VTPPAPAPVAAPIVPRPTFAAPPAPVAVQPPAPQPAPPTPPPAPVAPAPVSAAASSKSEGVDLEKFLVNF
VVEQTGYPPEVVDLDADMEADLGIDSIKKAQLFGELQEYFDISTSATDLSLDDFPTLRHVMDFLSASGQG
STAPAAPTPVVAPPQPVAPVAAAEPVAAASDTSPAELESFLVNFVVEQTGYPPEVVDMDADLEADLGIDS
IKKAQLFGELQEYFDISTSATDMSLDDFPTLRHVLNFLSASGQASESSAAAPVATPAAVSPPPMAETPAA
TGTSPAELESFLVNFVVEQTGYPPEVVDMDADLEADLGIDSIKKAQLFGELQEYFDISTSATDMSLDDFP
TLRHVLNFLAGNASAATEEPASFSLAAPAPALETKDNAPAAASSTNGAAATELNGKNLDFGAAAPLTLVG
TPYEMGWRHGSQYRAEIRRVLRTYAEYVGESIDELPGSAHTAQALQLLTPDQLDELQGIADAIETPLSNV
LAHHFAVAETLTGMEQAASTGQSEGSLLHAAQFGSPVINPMRETIRLATFLRRPTNGLSHVVVAPIGTML
VLGGVNAAGLTFSGENHSAYVLQNGVDLEAAIDLTLHSPAAAGNVVLGDLHGGRLASVQSHGQQRQVISD
QPSIHCGKRQMALAGGASLTEQDVDSSEVANLLLSADSDALAFLIDFGSGQLSLKKSTTSRSMEHFSLNG
LFADANITAPAVRQKGAATPLAQPHVTARFELEMCDSPLSASSMTPVFHGAAIVLGDGETAAALIEQLQQ
ASVTVYQIADASNLESAVAQVESICAAGPAPHLFVTTARDDRANLRFSVESAWNAQQQSSMETPLFVCQK
WLSLADAGGWLENTTVVAVTALGGDFGFSRGATAVQGGALTGLMKAIFIEYTVMRGGKGPRVKAFDTCSQ
ESPCQIACNIFVELASGNQDYEVSYTGGVRRVPFAMDRPAATKAAAQLPQGVWVVTGGARGITAACALEL
GKRYGLKLHLIGSSELPAIDPAWRQLDEAGLQKLKAETMIAARNAGQQAPQAWERVQKSLEIDKSLRAFV
DSGVSATYHACDVSDRAALAVVLEEIRRVDGPISGILHGAGIDKSCRMEKKRRDVVQATIGVKDGGVVHL
AALTERDPIRHFIGFGSIAGRLGSFGQADYCLASDLLCKLMNAYRRTRPWVRAVGFHWHGWDEVGMAARP
ETKNVLNDKSALKLMPLAEGVGHLIREIEADVPRGEILITERRHWQRFADGLGILAESRAEAKPSAAPAE
PVSTEPLGPADAAVELRTERCELKLIDSPLAAGTPTAPTFDGPVWILGENADAVELEQRLQQAGVEVYRF
GARADLDETLAWLDALHPEKPAKRLFLMTSRDALSADSLSVAEIDRRRHEGIIAPYFIAQNWYKRLLKFP
EAGTGDLVAATSLGGDFGFESTVQTPDGGGVAGFMKSLHIEDSRLDNRVARCKVIDAPSDESPATLFDAL
MRELAADQPEVEVSWSRGVRRVIRPIGTPLELGPAANIPRGGTWVVTGGARGITAIAARELAARYGWKLH
LLGKSPAPLADAIWRTFDEEQLKTYKTQIAREAVAAGGSPGQAWDRVLKDCEIFNNLQRFADSGVQATYH
QCDVTDRDAVAAVLEKVRRVDGPINGLMHGAGLIEPGRFDHKRRPFVEKLIRAKFDGLLHLFALTQKDPL
THCIGFGSISGRFGGNGLSDYAAGNDSMSKALDWFRSTRPDCTTLCIHWESWEGAGIATLSRFAWGPRSV
MKMKYMLPEEGVRRMEEEMAGGGLKAETLYTFGDFYPMFYPNEQFPLGEFQPRSGDAVDGSFPLVATSRT
EGDEFVGDVPLDPVNDPFLALHRLRGKPLMPVVVTLEALREAAELASGKKVVAFCDVDMIDGLAFHTDNA
ATAQARAKMVGDHVAECRWTCDFRNRTGGLIQKDRLYLQAKLELSDAPAAITADLPPFPSEWSAVTYPED
SAIYHGAPFRCLKALSCDSTGGWGHIVAQPLADLTKPERVEGWRVPSCVLDSALYACGCQLYLHSEGAIS
LPRKIERLELGRLPRDGENCYVHFVCRDVAEKSAIYDLTLFGENGDVILKAIGYQKVILGRGGIA
>gi|320161155|ref|YP_004174379.1| beta-ketoacyl synthase family protein [Anaerolinea thermophila UNI-1]
MTITRPVAVVGLGVVLPDAEDVKTFWENLKSGKYSIGEVPPDRWRIDLYYDPDPKAPDKTYSKIGAFVRN
FHFEPYKWGIAIPPRVIEQMDQTQQWAISAARQALSDYGYPQRPLDPQRVAVILGNALGGERHYQSSMRI
RAAEYQAALVAVPEFQSLPLSVQEAILDGVRKQIRSVVPDITEDTMPGELGNIIAGRVANVFNFQGPNFI
TDAACASSLAAIQAAIDGLNNGQFDAVLTGGVDRSMSIEGYVKFSKIGALSPDGSRPYADGANGFVQGEG
AALFLLKRLEDAEKDGDHIYAVIRGVGSSSDGKGKGITAPNPTGQQQAIERAWKNAGVSPATVSMIEGHG
TSTRVGDVVEVNSLTAIFGQFDLKPGSVALGSVKSNIGHLKSAAGAAGLMKTVLALHHKQIPPTLNVERP
NPNIDFAHIPFYPNTVLRDWEIKQGEVRRAGVSSFGFGGTNFHLVVDEYVPGILQGEKKIYSGVDLTSRA
EVLSVQAASREESLPKPYRGLYFASAETVEGLKNELQKALQLAQSGNLPESRIPSVEELERKERMAIDYN
DRDEFIKRAERALKGFESAPESNPWQALVAHGVFRGSGKPGKLAFLFPGQGSQYVNMLKDLCEVEPVAAQ
TFAEADRIMTPILGKPLTEYIYVAGDEVSLAEAEKALRNTEITQPAMLTANVAMMRLLNKFGFTPDMVIG
HSLGEYAALVAAGVLTFAEALEVVSARGREMKRVAMEDNGAMAAVSAPIEKVAEILKTIPEYVVIANINS
PLQCVIGGTTKGVDLALEAFQQAGFQGTKIPVSHAFHTKIVAPASQPLREVIARMNIQPPRLTIAANVTG
DVYPNTRDEILDLLAAQVASPVQFIKGIETLYREGARVFIEVGPKRVLNALAMDILKGKTDVTILATNHP
REGSVVSFNKALCGLLAAGVVPKGTQHEQSTFSLVSSRVESRTVEIPEPQLQTNSPGLEGKDREEIKQFV
LNLVSEKTGYPVEMLDLELDLEADLGIDTVKQAELFAAIRTHYNIPRREDLRLSDYNTLAKVIDFMANAL
ANVSEIQKLPAPIPVGAVKQTESLVSVSRINASGVIQKETNQMSSNGNGKLPLTSSVVVSGAGLGLPGKN
RHVFDDSNIASILRGEIRIEPLSEDLRRRMAEKRAIRLVKSEAGAIQEVIDHVDQTVKLGGQRGKFDLIE
EFGVPADRVEATDISTQLAIAAGIEALRDAGIPLVMAYRRTSKGTYLPDRWKLPEALADETGVIFASAFP
GLDRMAEETQRFYEVQNLESQIQQLRSLQRLISPDTEVYREIQRRADEIDEKIRALDYHFDRRFVFRVLS
MGHSQFAEYIGARGPNTHVNAACATTTHAIAIAEDWIRAGRARRVVIIAGDDVTSGALSEWIGTSLMASG
AATVEGDPRKAILPFDRRRNGMIMGMGAAALVIESEDAVRERGMYGIAEILATQIANSAYHGTRLDVEHV
ALVMEHLIQQAEERFGIRRGEIAGQTVFVSHETYTPARGGSASAEIRALRQVFGVHAPQVIIANTKGFTG
HSMGVGIEDVVAVKSLETGIVPPIAHIHDGFEPDPELGDLNLSKGGQYNPVYALRLGAGFGSQIAMVLLR
KIPVAVRVEKERYINWLREVSGYDQVTLEVDHRTLRIRHDGPPKQVPRKSNWKYGFGPTMWAVSPQSTQE
ILLPSQSPAEFSEVAPAEGIIETRVAESATLSAVPVNIAGVDEEAIKQFVLQVVSEKTGYPQEMLDLDLD
LEADLGIDTVKQAELFATIRTHYNIPRREDLRLADYNTLAKVIQFMKEALTTQSQQPVPGGQNKAGGRLE
NVAPLASSSVPDEDSIKQFVLSVVSEKTGYPVEMLDLDLDLEADLGIDTVKQAELFATIRTHYNIPRRED
LRLSDYNTLAKVIDFMRDALESQVNLASGETTEPTHSEIEGFSQPSEAWEANVPKDQEPLSSDERLLEED
LSAEGKVKVRIPVPVLIPHPSLCVPSGIFLDQQARVLIVDGEGGVGESLEKLLNQKGVQAHRFKPESVRQ
MAEEVQKFVSKGEIHGVYFLPALDSRFSMKEFDPQGWQSSVELHANSLFTLIRTLNGQPFVVCATRMGGL
HGVESPHKDGAFGGLVSGFAKALSMERPNCLVKVVDFERKATSEWIAERLLEETLYDASTCEVGWKDNQR
FTFVLKDVETLSLRNLEGVQTFVVTGASGGIVGPILLDLAKFTRGTFYLLSRTSLPDPSDPDLQALAQDR
NAFRKALAERLHQQGERATPSAVEQRIAVLERGAATLKVVEKMKALGARVHYLPCDVTRFEAVEEAVEQI
LKEVPQIDVVLHAAGMEKSRKVETKPFEEFAQIVSVKVNGFYHLFKALENRRSLPKQVVFFSSVVGRFGN
AGQTDYSAANDFLSKLANTLSQEYPQTNFLSIDWGAWAEVGMASRGFLPDLMKRAGIEMLSPKSAAPQVR
YLISQDIKGEVVVAGSLGMLESQRLEQRMLNIEQINQLLADPTLKHFLYERVVDFNLKDGLTFEAELDPN
QHPFLQDHALNGIPLLPGVMGIEGLAIVSQRTAMLFSNLQKSYRVTSLSDIHFHLPLKFYRNQARKLIWK
VLLKYQAGQLIGDVRLESTIQRYGKEPESMVHFTAQVFLVPDGVKRSDMKSNPPYWNGSQQLSAEEVYRL
YFHGPSFQVVEGVQRKENQVIGKWKADLPPVTDSITEWTTLPMLVELCLQTAGVWEIGKTGVLALPRSIE
WLEIYRTSLPKQPVLYAEVEPVPSENHSMAFDARVVDAKGRVYLELKGYRTEALPYPVEQELLSSLTQWA
QSPEA
>gi|17232843|ref|NP_489391.1| heterocyst glycolipid synthase [Nostoc sp. PCC 7120]
MSANPIDTALAELEAQINNCEKALLRCIEEKKMKSEKPMSINKINRQLQHNPIAIIGMASLLPEARNLRE
YWQNIVNKIDCITDVPATHWSVEDYYDPNPRTTEDKTYCKRGGFIPEVDFNPMEFGIPPSILEVTDVSQL
LSLVVAKEAMEDAGYGESREFNRDLVGVILGVAMAKQLGMPLSARLEYPIWEKVLKNSGLSDEDTKKIVD
KIKSAYVKWDENAFPGMLANVVAGRIANRLNFGGMNCVVDAACASSFGALKMAISELVEHRADMMLTGGV
DTDNTIMAYISFSKTPAVSPSDNVKPFDAKSDGMMLGEGICMLVLKRLEDAERDGDRIYATIKGIGTSSD
GRYKSIYAPRKEGQVNALRRAYEDAGFSPATVGLMEAHGTGTMAGDPTEFGSLRDYFGEHDKKKQHIALG
SVKSQIGHTKAAAGAASLIKTALALHHKVLPATINITEPNPKLNITESAFYLNTETRPWIRPEGEAPRRA
GVSSFGFGGTNYHVVLEEHEAEQNRPYRLHNSASEILLFAANPAELLKQCEEVLGKLQSAGGNKHYSQLV
QDCQSVEIPQNAARLGFVAENMQEACKFMQTSIDWLKHKAGAANWEHPQGIYYRASGMELNGKVVSLFSG
QGSQYLEMGRELVMNFPTLRRLFGYMDGLLLKNNLRPLSEIVFPNPVFDEAQKNAQVAALQRTEYAQPAI
GAFSAGLYSILKQAGFKSDFVAGHSFGEITALWAAGVLSDADYMYLVKARGQAMAAPEDPDHDAGTMLAV
KEDLNKIEPILKQFPQVSIANYNSPTQIVLAGPTGEIAKVRQALQAQGYAAVPLPVSAAFHTSLIAFAQK
SFAIATKSVQFNEPKIPVFTNVTGKPYPKDPQAIQKILETHLANSVLFKQEIENIYAAGGHCFVEFGPKR
ILTNLVKDILGDRPHITVSLNPSTQKNSDRSLREAAVQMRVIGMQLHNLDPYQAPPALPPAETKKGLNVT
LRGINYRSEKTKKAWEDAMNDGFKVSLPSAPTVTVPPVISEPVTPVKETNGNGHGKIAELPKILNNSTSI
TPAKPEMNSAIVSPKLVEEKKMQTPEKLDNYKRVLESLEYLTTQFQKNQTENLQVHGTYLNHQMEYTKAF
FQLMQQQNALFANAKSSQEAAQLKLVVMESLDRSMMQFHSQQGETLRIHEKYLQEQVAYARNFFELIQQQ
YSMVLSGQVNTPVIETPVKETPAFTIEAPVTPTAKIVEPQPESVVKNGFNIVDAPVTLAPTAWQIQSEPV
VAATASVVSTIEPEPVIEAPVAAPVVNQVVEFTSAPAPVAAPAIDVADLDKNLLAIISDKTGYPVEMLEL
EMDMEADLGIDSIKRVEILGGLQEVYPDLPKPNLEELAEKRTIGQIVDYLKANTAISQSVGIAIQQAQQA
AEIPAPVVTASIAAPEPVVAPTPIAPEPVAIPATPEPEAVADTTDYADLAQTLLNITSDKTGYPVEMLEL
DMDMEADLGIDSIKRVEILGAMQETYPNLPKPNIEELGDLRTIRQIVDYLQKLAGGEKKSLSLSGTGSQS
V
>gi|224370274|ref|YP_002604438.1| predicted polyketide synthase [Desulfobacterium autotrophicum HRM2]
MITRLFNSRLPLMVYNPAKVFSLDFFINAYRAGALPVFDTEFMLDHDILEGIKRLATANILFGVRVVGPS
QTLLNNIKALDLTNLNCLVLPFSGTDNPDEFKENLEGFFETKIILEVREISMNKAIETVDPHGLVLRGNE
ACGRVSNFSAFILMQWYLKNQARPVIIHGGVGRYTAAGMFAAGVSGVVLDSQLWLSKQSPLSENFKKLLA
TVDESDSLEIILDNHTRYRVFAKLGTKIARDLKERAIILVDDNQAGETLYREIGEQLTALDDDTTTPVQS
LFYLGQDAFFAKDFSRDSTDLDTIISTFFTTIGRNLDLVDRFDPMQPGTALAEEHGTRLPLIQGPMANIT
DNTDFANQVLEAGALPFFAVGSLPETLADTMLNNAHTKVKTFGAGLVGIRAFNPAIESHMEMVKKYKVPF
ALFAGGGASQAQALEKEGTKVYLHTPSISMLNSAAKNNCTRFILEGREAGGHVGSLSSLVLWEAGVSKLL
NGTDFDLGNLSLVFAGGISTRYGSWFISGLASVLAEKGVKIGIQVGSAYLFSQEIVKTGSIKAQYQEIIS
KENETMVIGESVGLASRTAPNEFARMMIQTERQMIQDHKPLEQRKRSFEKRNIGSLLIGAKGFLPDFKKP
GKNNFTYFEGAEQLNRGNFLVGESLAYFNNPISLADIHATLFDHKKGLIQNLGALEIFSSDQNSINDEIA
VIGMGCVLPGAKSPEELWTAILERRYSIREMPETRMRRDLYYDADKSAEDKSYTLLAGQVEDYTFDHERF
GYTPEKAANLSRSQQMLLDATYQAVEASGYLGKDNHFQCEDPERTAVIVATCLGNELGNNLQLKYHFPEI
VAMLQRTEAYSTLTDQEKKTIKDQLQTGLEADNPGYDPVHGMLLNIEASRVAKHLGVRGTNYVVDAACAS
SFTAIDAAQGELLSGEVDQVIVGGVNTHLAPESFVGFCKMGALSAKGSFPFDERADGFVLGEGATTFILK
RMKDAIRDKDNILGIIKSVGSSSDGKGKAIAAPNKAGQIFSLERCFERMKSDVKPSDIDFIEAHGTSTIM
GDQAEIETLKNFYKGCKVGISSLKSQIGHLLGGAGAAGLAKAILAVKNGILPPNGQFKRLSSNHNLTDTD
LYIIEEQKPWITQNNATRKAAVSAYGFGGINYHLVVEESRSDYQPVERSIFKDTDYDFNDDRIVMAGVGV
CLPGAGNCEAFWERLESGEKQLSPIPEDRFSNDVYASFDKDSIYYLPKVKAGVITDFKFNNAKYRTPPKT
VRSLERGQLFGLDAADEAITRSNLGPLLALGNRTGVILGTIPGERQNKNILRVRKLLVAEIVAKTPGVEK
AQAVADELLATIRETIPANNEDTTPGLLSNIIAGRIANHFGLNGANYVVDASCASSVIAMRNGARSLRFK
DLDYVLVGGVDANLYPAVLMAFKRLGLLSDDECNFFDSRAKGYVMGEGAAIHVLTTYKKARENNMPILAE
LNGITVKSSVPDHLLAPSENTFVRTINQCYQRTNIRKQEINHLDLFAFSNILGDMIERQVTEKCFTTPLY
CGNVKPQFGYFKAANPAVALAKLALMNNRRVVLPDFNFSPDHSTMAKSKTLKHCDGMITIKGDRPVRFAS
NVNGIGGNHCHTIITTLPASLVKMNSPASDSTAVTAAIDIQAHPPATAVSYSADKQGKKQRIVALVSGQG
SQRPGMMKALYEKNADIRRTMDQGEKIFLNERGYSLLEIMFGKDKRLNLTENTQPAVFLSSAALFHHLAA
QGFNPDLFIGHSVGEYTALYCSGMLDFDDAMRLIIKRSDLMGQASLKHPGKIMVVFKNERDTATLIRESF
LSQIYITNKNSENQTAVSGKADAIDAFCTFLAEKGVVHKRLDLSGAFHTPLFNEAARELREFLDTLVFNE
TRFDRIVSNVTARPYPENRKQVKDLLARQITSPVEFIGSIEEVYAAGKTHFIEIGPSRLLVNLLKNINIV
DYKTAVTIDARKGEIESFKECKNYLKSINSIFTRRHMAPQPKDQPEQTRSDNTQAPVAGESRTGLLHDSP
NGSDQIAMDLDFATFKLENKAMADKLFYEEYLRQQQEAAMDAVRRFNFITEPIVISGVSVGLPGKGKRVF
AKDNFDQILAGTNFIEPLDLEDQKRITDKNITRLFKQPDGNARFMEITRTEDVIHLAGQLGYFDLTDEYG
IKAQYDVSMSLAVAAGIEALKDAGIPLVMQYKKASTGTRMIPDGFALPKEMQEDTGIIITSLFPNSETLI
NEMEKYLYDKLYLKPYEAFENIYYYLMQEIKEITVKERLTDWFFKIKSNKRTDLGAYTFDRNFLANHCPL
GAAHLAQIIRAKGPNTLVSSACASTTQAMGIAEDWIRVGRCKRVLVVGGENATSKAQNQWVGSGFLALGA
ATVKKRVSEAAKPFDTDRNGTILGSGAVGILVERQSTVKARGMNGQAEILGTHMANSAFHTFNIDVPHMA
SEMQRFIHMVEQRHNLKTEEYADKMLFMSHETYTPARGGSADAEVTALNATFKEHTKKICISNTKGFTGH
TLGAAVEDVVLVKALQYRKAPPIANLKNIPDHFKELNFCRGNAIDAEYGLHLAAGFGSHFAFVFVRRIQE
NTFTNNPAYTAWLEKISESKGPELKIIDNTLCLVEGGTLPDLDGRKKATIKTGSPAQQDIRTETPDPLRQ
DRPMETTVLKESVQTAMPTATAASATGKTLETVKKIIAEQTGYTTDMLESDLDLEADLGIDTVKQVEIFA
KAASHFGLSVPEDLKLRELNTIEKLVTFLDAMAGSDDTPAEVSSKPSTAEVTTHPSETVSGTQATETLET
VKKIIAEQTGYTTDMLEPDLDLEADLGIDTVKQVEIFAKAASHFGLSVPEDLKLRELNTIAKLVTFLDAM
AGPDDTPPEGGNKPSNDQYKATPSEASPGSQATDTVETVKEIIAEQTGYSTDMLEPDLDLEADLGIDTVK
QVEIFAKAASHFGLDVPEDVKLRDLNTIAKLADHMAQRLNTITTAEKAPANQAPEKVTAPETSQTAATPA
LKTEDLPGGHAPLTPVKRLVVRTKETPKPRAGGNPFKGKTVVVTLDSHGFADSLIKAVAAKKGRVITLGP
NDGADIKVDLADLNQVQQAVEGLTKHHKSIHGVIHLAHLDDYFNKGEGHALVNDLETNRAVKSLFVIIKA
LFAPLDRQESLIASLGFNSVVFPYQRDCGPIHPGSAGISGLLKTVAKEMSHTRVKFVDFTADPHAATVEK
TIALFMDELCCQDNRCEVGFQGEKRHVLALDQQMAVKGASMIPKGGTLLVTGGARGITYEIMKQVVTIYG
TDLIILGSSDIYALDPSFMAEGLGEPEIMALVKPTMPKARPLEIRQRVDRIVKMREAAANLALLESLGAK
VTYHAVDVTDLDKVQRAIAAHERIDGVIHAAGVEMSQFIPKKTLTDFERVMDVKVKGMVNLLTAMADRDY
RFFCTFSSVTARFGNEGQADYTAANDFITKLALEQQQLHPERKFKVYSWTAWSGAGMATHPTVMKVLEER
GLQFLPLDQGIRAFMSDLHDTTDTEVVFSGLDYDFDRDGLLGDPLNPDTPFLDDMVSRDGTSLTFERTLD
LDRDLFLLNHAMGDVPVFLGATGIETLVEVATALSSAQGLTTTKMPELSNFKIPYGIKILKRRPKELLIS
AAATQNDRFDCTITSQFKNPGGVAMGAPTRHYEGTLRFLNPPVEKERIDLPEFCPVTFDGELEEIVYHPN
RLFMDGLFNTIVDVNSFDGTTLVTTVKDSSVQPFFKDITEPKLITPVVLIDAMFQTGGLLEFFTSSQTVL
PYAIGRMTVHGKVEKGKPYFCITTKSHSDKETNTYQLQLVDDRGNLFVEVVDFQMVRLNKLAEEDRIAHR
ITFGKTVSA
>gi|90408112|ref|ZP_01216282.1| omega-3 polyunsaturated fatty acid synthase PfaA [Psychromonas sp. CNPT3]
MQTNFNWSNNMSTKKDSNITDAAQDKKLNSRLQECPIAIVGMASVFAETKNLDQFWDNIVNSVNGIKDIP
EDRWAVDDYYSSDKSAEDKTYCKRGGFLPGIDFDPMEFGLPPNILELTDISQLMSLVVARDVLADAGISD
EKAYDRDKIGITLGVGGGQKQSSQLTARLQTPILDKVLKASGVNAPDREMILSKFKKAYIPWQENSFPGM
LGNVIAGRIANRFDFGGMNCVVDAACAGSLAAIKMAVSELLEYRSDMMISGGVCCDNSPFMYLSFSKTPA
FTEGDDIRPFDKDSSGMMIGEGVGMIALKRLEDAERDGDKIYSVIKGIGSSSDGRFKSIYAPRPSGQVKA
LQRAYNDAGADAMTCGLIEAHGTGTKAGDSAEFSALKMMFSQSDGGSQHIALGTIKSQIGHTKAAAGTAG
IIKASLALHHKVLPATINVDLPNPNLEIEKSAFYINNETRPWMPRADGIKRLAGVSSFGFGGTNFHFVLE
EYKAHHDRKYRLNHVPQSILISATDKNALLVSLSAYVQALNVESDLQAYAFNVLLTENPVKAVPKNEARC
GFVAKDATQALAALNLIIIELKKADVLEFRKESGLYYRHCGLDVQGNVVALFSGQGSQYINMGRDLTCNF
PSMLASSAKMDTSFTDAGVAQLSKTLFPIPVFSAQARQVQEETLRLTQNAQPAIGTFSMGLFNILKQAGL
KIDFAAGHSFGELTALWAAGVIEDDDYMLLARSRGAAMATPDDEDFDAGTMLAVMGDAAKVAQSIESIKG
VSIANYNSKQQVVIAGATADIALAFTQLQSEGYKVVKLPVSAAFHTDLVKHAQKPFAKVIDSVKFHAPNI
PVFSNASAQAHPTKGAEIKRALKKHILESVHFKEEIENLYAAGGRIFIEFGPKNVLSRLVANILEDQNDV
QCIALNSNPKKSSDIQLRLAAVELAVLGLELNDIDPYSAVSRPLIAPKKSPLMMKLTGASYVSPKTKKAF
SDALNDDWTLSSMQPQIIEKEVIKEVIIEKIVEVEKIVYVERGELPAGQLAPCSADIGSAIERSVQQFVA
HQTQLLNVHEAYMQGPKDYAKTFQNVLASQAGQSELPESLDKTLGLYHQFQLETLRVHESYLNNQTANMS
QMLSRACETPRVMPSSASSAPLAAKLVEPHIASTVVMQEKMPVPVTPVAMPSVVAPAPVQAPIQTPIQAP
IIENSINISTIEQVMLSVVADKTGYPVEMLEMHMDMEADLGIDSIKRVEILGAVQDEITNLPELDAMALA
ELRTLGEIVSYMQAQAPSAEMPASANTATIAPVVSASFDLKSIEQVMLSVVADKTGYPVEMLEMHMDMEA
DLGIDSIKRVEILGAVQDEITNLPELDAMALAELRTLGEIVSYMQAQAPSVEMPASTSTSTPAATPVATA
SVDLKSFDLKSIEQVMLSVVADKTGYPVEMLEMHMDMEADLGIDSIKRVEILGAVQDEITNLPELDAMAL
AELRTLGEIVSYMQAQAPSTENAEMPASTSTPAATPVVTASVDLKSFDLKSIEQVMLSVVADKTGYPVEM
LEMHMDMEADLGIDSIKRVEILGAVQDEITNLPELDAMALAELRTLGEIVSYMQAQAPSASAENTEMSAS
TSTPAVTVSFDLKSIEKVMLSVVADKTGYPVEMLEMHMDMEADLGIDSIKRVEILGAVQDEITNLPELDA
MALAELRTLGEIVSYMQAQAPSTENAEMSASTSTPAATASFDLKSIEKVMLSVVADKTGYPAEMLEMHMD
MEADLGIDSIKRVEILGAVQDEITHLPELDAMALAELRTLGEIVNYMQEVAAPTDVLAIEKTLPLTTPVA
IAPKKFDIDFVPAPSRIVSLKYIDDAFNEATSVDGQHLLLVDDGEPNTSLLADKLAQQGWSITLLQAAWV
EADATRKFAENINIVTLSALSEPELQSILSVQKCWHSIVYLHPKMSVPSITYPERSKQGLQLAFLLAKLS
GLGKNAESNDVRSSFLVLTRQGGRFMLKDVPVDADMVQGGLCALVKTLHLEWPHVFCRAIDVASDWTPEK
VANCLFNEFNDKSVMPVEVGFDEKGRLTPSSELTDSYALTSGTHLNKDALFLVSGGAKGVTAQCAIRLAA
QYQCKFILLGRSEYDANEPLWAQGINDPVALKKAGMQILIERGVKATPMALNKLIKPLLSSREISETLQA
IQALGSLVEYVSADVTDSDAVENAVLPITQLWGDISGIIHGAGVLADKLIEQKTLKDFESVYSTKIQGLG
SLLNCCDLAKIKHLVLFSSAAGFYGNPGQSDYAIANDILNKTAYRFKSLYPKAQVLSFNWGPWDGGMVTP
ALKEMFKKRGVYIIPVASGAQLLVNELACIENRSPQILVGNDMAGAPKSDNAVKKPQVSHLVKPISVANN
PFLQDHKIAQNAVLPTVCAIAWMQEAVLSMHADYQYAGLQDYKLFKGIIFDGSQKEQYGIECKTLKAEQD
ELLVSVRISSKNEAGLSVAHYGATLHLTKNKKEQPVYSQDLPALTAQTHTLYDDGTLFHGPSLQGIKGVL
ACDEKGLLLSCLVASSVRQVQGDFDVEKSNIFANDLVYQALLVWVRKELGLGSLPTATQHWQVYAPAPLD
TPFYLLLSVQENKRNKKISADVLLMDAQKQVFASLKGVQVTANKSLNDLFKKVAP
>gi|298492366|ref|YP_003722543.1| polyketide-type polyunsaturated fatty acid synthase PfaA ['Nostoc azollae' 0708]
MSADSINTALAELESLVNSCEKDLIRFIGEKKMKSENQMSTHKINRQLQQNPIAIVGMASLLPQARSLRQ
YWANIVNKIDCIIDIPESHWSVKDYYDPNPRTPEDKTYCKRGGFIPEVDFNPMEFGIPPSTLEVTDVSQL
LSLVVAKEAMEDAGYGEAREFSRDYVGVILGVAQAKQLGIPLSARLEYPIWEKVLKSSGLSDEDTQKIVG
KIKSAYIKWDENAFPGMLANVVAGRIANRLNFGGTNCVVDAACASSFGALKMAISELVEHRSDMMLTGGV
DTDNSIMAYISFSKTPAVTPSDNVKPFDAKSDGMMLGEGIGMIVLKRLEDAERDGDKIYAVIKGIGTSSD
GRYKSIYAPRKEGQVKALERAYNDAGFSPATVGLMEAHGTGTMAGDPTEFGSLRDFFTQYDNKKQHIALG
SVKSQIGHTKAAAGAASLIKTALALHHKILPPTINITEPNPRLDIQNSPFYLNTETRPWIRAEGQAPRRA
GVSSFGFGGTNYHVVLEEYEAEQQQAYRLHNAPSEVLLFGSTPAELITKLEATFNNLQSNEGERHYSQLV
QESKSVAIPQAAARIGFVAENLQETCKLLKVSIDLLKNKQSAVSWEHPQGIYYRASGMELVGKIVALFSG
QGSQYLEMGREAVMNFPPLRRLYSQMDGLLIKDNLQPISEIVFPHPTFEEPEKNAQIAALQRTEYAQPAI
GVFSAGLYSIFQQAGFKSDFAAGHSFGELTALWAAGVLTEEDYLFLVKSRGQAMAAPKDPDHDAGSMLAV
KEDINKVEAVLRNFPQVAIANFNSPTQVVLAGPTGEIKKIQQKFQELGYGAVLLPVSAAFHTPLIAFAQK
SFAIATKSVAFQNPKVPVFSNVTGKEYPQELSGIQRVLEGHLSSSVLFKQEIENIYAAGGYCFVEFGPKG
ILANLVKDTLGDRPHLTVSLNPSTQKNSDRSLREAAVQLRVIGMALSNLDPYQLPPVISATPTKKALNVK
LKGVNYISEKTRSAFTEALQDGYKIKGVQESGNLEVKNSVIPTTRVTPSTNGHNGNGHKKTPVITSPQQP
QMNPANFSNQVTKELLPTARYAIAERLGGKMETSDQNNNFQQVLESLENLLNQFQHNQGDNLQIHSIYLN
HQMEYAKTFFQLMQQQNTLFINRNSSETAYIKQVVMESFERSMMQFHNQQAETLRIHEQYLREQVEYTKN
FFQLIQQEYSLLIDGTEITQPVIPPQFTETHTNSLRELMPPNPEPTITETVVPPTDKIVETQPVIEPVIQ
TIAPVIEALPLSKIAEPLIEIPTRVVEKQPEPVAPVALIPEPTTSGVNIRELGKNLLNITSEKTGYPIEM
LEFDMDMEADLGIDSIKRVEILGGLQELYPDLPKPNLEELAEKRTIGQVVEYIQKQVIGESVQVTEKKAE
EGAEQLPLRSSQSLVPSPQPPEDSNKYADLAQTLLNITSEKTGYPVEMLELDMDMEADLGIDSIKRVEIL
GGMQEAYPNLPKPNIEELGDLQTIGQIVNYLQKLVGGEKKKLDFDQITADSHVPEVVNLTPPPVVDPNLP
RRPVKLKTLPRPDFWECKPPEGHIGLITDDGSLTTTKLTHALIKQGWKVVVLSFPQSLIPEQLRLPADVT
RITLANMSEEHLQLLLQSITAKHGKIGAFIHLHPQFTTSYPEAEKAIVKQVFLMAKHLKQSLNTAANLEG
RVSFCTVARLDGAFGLDYTENFGVIGAGLFGLTKSLRWEWPQVFLRAIDLSPTLDPHQSAEYIVAELHDS
NRYISEVGYNSKGRVTLIAAAE
>gi|119774252|ref|YP_926992.1| erythronolide synthase [Shewanella amazonensis SB2B]
MSESKTQDAQDLRLNKRLKDTPIAIVGMASLFANSRYLNDFWDLICDKIDAITEVPADRWQIDDYFDADK
RSPDKSYCKRGGFIPQVDFNPMEFGLPPNILELTDSAQLLSLIVAKEVLEDAGVSENSAHDRDKIGITLG
IGGGQKISQSLNARLQYPVLKKVFRESGISDADSEMLIRKFQDQYIHWEENSFPGSLGNVIAGRIANRFD
LGGMNCVVDAACAGSLAAIRMALTELTEGRADMMLTGGACTDNSAYMYMSFSKTPAFTVDEQIKPFDADS
KGMMIGEGIGMVALKRLEDAERDGDKIYAVIKGVGASSDGKFKSIYAPRPEGQAKALRRAYDDAGFPAHT
LGLMEAHGTGTAAGDVAEFSGLSLVMGESSDETQHIALGSIKSQVGHTKSTAGTAGLIKAALALHHKVLP
PTINVNKPNPKLNIEASPFYLSTETRPWLPRPDGTPRRAAVSSFGFGGTNFHLVMEEYQRDHGRTPYRLR
STQVPLLFAAPSREALSNDLKALCERLSNTEETFETLTAPFTLKGEPPKAEWPRLGIVAANAKALKACLE
DAIEKLATSSDDWHTQDMSFRAQAMAKNTRVAALFAGQGSQYLGMGGELAMLYPEMRAEFIAADEVFHQR
GYPGRHGTGELSSHVFPIPKFDSDARKQDEEALTNTRIAQSAIGVVSMGQFEILKAAGLTPDAVAGHSFG
ELSALRAAGVIDQASYYRLAFARGDAMASVPKGKDAGTMAAVILPDASHRSTLDTLLTQHESVVIANHNS
PTQLVLAGPTDAVKQLVQALADKGIRAIALPVSGAFHTPLVGHAHAPFAKAIDKESFSDAHAVLYANASG
DKRPTDGKSLKQSLKAQMLEQVQFESQIESLYRDGVRVFIEFGPKNTLSRLVDAILGERAKACLILSLDA
QAVGSQGRADSKLKLAAVELATAGFAITNPDPYREQLSHKAMPKSPLTVKLSASNYLSPATAARMQASLK
DGQISKQTQIVEKIVEKTQYVPKAAPAQPAPAVQTTAASEQTSPAPTAGAGTNVGTGTLEALFAAQQQLA
ALHQQFLTIPAQYGEGVQALMQKQLELASAGLPVPAATERALELFHQHQADTLKIHSDFMRAQVLGSEQM
LSALSGQTLVSQAPQTAAAVVAAPVAAASQVMAAPVVKAPEAPVTAPVAAQVAAPMPAPAMVIPAAASVA
ALPIQDIMLQVVAAKTGYPTEMLDLSMDMEADLGIDSIKRVEILGTVQDELPTLPELDAATLAECRTLED
IVAYMHKVAGTSPVTAATSHSQAVPTPVSASADITAVMLKVVADKTGYPTEMLDLAMDMEADLGIDSIKR
VEILGTVQDELPMLPELDAATLAECRTLEDIVAYMHSMTGAAVSQAPVSQTAAPASHQAAHSSSDITPVM
LKVVADKTGYPAEMLDLAMDMEADLGIDSIKRVEILGTVQDELPTLPELDAATLAECRTLADIVAYMHSM
TGAAVSQAAVSQVAAQGATQSTQNSSDITAVMLNVVADKTGYPAEMLELAMDMEADLGIDSIKRVEILGT
VQDALPGLPEIDPSTLAECRTLGDIIACYGTDGAQDATDNGKAEAQQTEADADTGIEVEVDIAVSALAAA
QDIVASESATASAFESDNATAAAAAATLPTPTPQQVLDTMLTVVAEKTGYPVEMLDLAMDMEADLGIDSI
KRVEILGTVQERLPGLAEVDAATLAECRTLGQIVESFSLPNQYVGTDASTDTELAPHTGVALKKLQAADR
LEAPSATGLFAAKGRVIILDDGHNAGVLAGRLDAKGHAVTVIRCDSLGHQSVLDASIDARTLSQGGDMDT
EIQSLIKALEPVSAFIHLQPVMAADDGAADVKATARFSDEAFSQVSLAFLFAKHLAADFAAEGAHRRAFI
TAARMDGKLGLSGADVELNQAALFGLTKTLAQEWPHTHCRALDVAAQLDATSLADAVIDALYGADDLLEW
GIAADGRFAALATDAQQISAKTALNSTDKILVTGGAKGVTLDCALALAARTHAHFILAGRSKALSLNEFP
VWAKGVAATELKQAAIQELLAGGKRPTPKEVDALIAPLASALEIQQALQAFSDLGASAEYLSMDVSSAES
IAKALGPIQAIAPVTGLIHGAGVLADKFIQDKTLDELKRVAGTKVDGLKGLLANLDGLKLVALFSSAAGF
YGNKGQSDYAMANEILNKAAHRLAHAKPDCRVVAFDWGPWDGGMVTDSLKKMFQERGVYVIPRPLGAALF
AEAVLGRAESQILVGSSMQGNADQAGANLKKPEGHSGITLGRTLYRPHLALLEDHQIGGNAVLPTVCALE
WMQDAATRHFGGQWQPHDYRLLKGVVFDSDEKALTMQLNVTDAGLSALISCDGRPQYEARLQPPSPLSLP
SEAMAADIRQSADKAVVTGKQLYQDGALFHGPALQMIGDVSWFDDGGLGCTVMLPAASVEPGQAAIIQQD
ALLQALLVWARLKYDAASLPASLTRAVQHLELSPGEQGQLRLWVKSHSSRQLCADVALYNAQGQLASAME
GVKVTISKSLNQAFLSAKGQEI
>gi|119511078|ref|ZP_01630197.1| heterocyst glycolipid synthase [Nodularia spumigena CCY9414]
MSAYSIDTALAELESLINSVEKTLIRSIEDKKFSKETPMSVNKINRKLAQNPIAIVGMASLLPQARNLRE
YWQNIVNKIDCITDVPATHWSVEDYYDPNPRTPEDKTYCKRGGFIPEVDFNPMEFGIPPSILEVTDISQL
LGLVIAKEAMEDAGYGESREFSREKIGVILGVAMAKQLGMPLSARLEYPVWEKALKSSGISDEDTQKIIE
KIKSAYIKWDENAFPGMLANVVAGRIANRLNFGGTNCVVDAACASSFGALKMAISELVEHRADMMLTGGV
DTDNTIMAYISFSKTPAVSPSENAKPFDAKSDGMLLGEGVCMYVLKRLEDAERDNDKIYAVIKGIGTSSD
GRYKSIYAPRKEGQVRALERAYDDAGFSPATVGLMEAHGTGTMAGDPIEFGSLRDYFSQHDSQKQHIALG
SVKSQIGHTKAAAGAASLIKTALALHHKVLPATINITEPNPKLDIKNSSFYLNTQTRPWIRAEGEAPRRA
GVSSFGFGGTNYHVVLEEYETEENLPYRLHGTAREVLLFANNPGQLLSKCEETLNKLHSADGERHFAALI
KECQSVEIPQVAARVGFVAENLQEACKLMQVSIDWLKHKASVTSWEHPQGIYYRSSGMELGGKVVSLFSG
QGSQYLEMGRELVMNFPTMRRLHGCMDSLLLKDNLQPISEIVFPHPVFDEAEKNAQIATLQRTEYAQPAI
GVFSAGLYSILQQAGFKSDFVAGHSFGELTALWAAGVLSEADYLFLVKSRGQAMAAPEDPDHDAGSMLAV
KEDMSKVALVLRNYPQVTIANFNSPTQIVLAGPTAEVAKVRQALQEQGCTAVVLPVSAAFHTPLIAFAQK
SFAIATKSVKFNQPQIPVFTNVTGKNYPQEPQAIQKILETHLATSVMFKQEIENIYAAGGYCFVEFGPRR
ILTNLVKDILGDRPHLTISLNPSTQKNSDRSLREAAVQLRVVGLTLKNLDPYQIEPVLPPVEKKKALNVR
LNGINYVSEKTKNAFPEALRNGHQVSLPVTSAPEFSEVVATPAVKENSTNGRVTHPTDSLPEFSHKSTNT
TPQAQMNPVILPTATAQETKMQPTPEKPVNYQRALESLEYLLTQFQQNQTENLQVHGTYLQHQTEYTKAF
FQLMQQQNAVFANSQSNDEAAQLQLFVKKSVERGMMQFHSQQGETLRIHEQYLVEQLEYAKKFFQLIQQE
YSQIISSQVTTQPKETPAPAPVVETVPAPVAVAVTPAPVVETVLEPVAVTPAPVVETVPAPVSAPNIDLS
ELGNNLLAITSDKTGYPVEMLETDMDMEADLGIDSIKRVEILGALQDMYPDLPKPNLEELSEKRTIGEVV
EYLQFQVSGSAVVTTPEVVLQSNQSPLSLIPIGDNEIPIPVETTSPVVSTPLPTELETEPEIAATDNYAD
LGETLLSITSDKTGYPVEMLEMDMDMEADLGIDSIKRVEILGAMQDKYPNLPQPNIEELGDLRTIGQIVD
YLQKLAGGEKKKPQWSFSYQPVQVIDGVTRRPAKLQFLPPPDSLDFALPEGHVSVITDDGSLTTSQLAQT
LSDRGGKVVVLSFPPSIVPQQSPLPTGVNRVVLADMTEELLQHKLSAIATHFGNIGAFIHIHPVFPGNQT
PAYLPQEKEIVKHVFFIAKHLKQTLNEVARYERSCFLTVNRLDGAFGLEHNINFGAIGAGLFGLTKTLKW
EWPKVFTRAIDLSPSINPQQSAEYIIAEMHDPNNYISEVAYGSQGRVTLVGSFEN
>gi|256004745|ref|ZP_05429721.1| Beta-ketoacyl synthase [Clostridium thermocellum DSM 2360]
MKNYFYPEERIAIVGMGALLPDANNVDSFWNNILSKKVSIKELPESILNPDIYYDRDAFGKINKNDKTYT
RMVAKVDVDDYPSLTRKFKIPPAVAEHMDPNQHVAIYCVDQALQSLANSNINRERTAVIMNIGAPGIRYN
NIIRRTYYAKIEHYLRNNPKLNESLKKEELDEVLNGLSDMALAGTIPITEDSAPGMLQSITASRISNLFD
FYGPAYTIDAACASSLAAVICGITGLLRKDYDVLITGGVDVTLDESPFVVFSAINALSPTGSYPFDSRAN
GFVIGLGGGVLILKRLEDALRDNDRIYALISGFGQGSDGKGKYIAAPNEEGQVRVLKSTLEMMGYPADTI
EYIEAHGTGTSVGDVVEIKALKKAFDAMGVTKKNFCGISSVKSNIGHLRYAAGSPGLIKAAMAIYNKILP
PTANIEKINPKLEIEDSPFYILTEKKPWRENPSHPRRANVSAYGFGGADYCLALEEFRPEFIRKTYAFSK
PYEDAKNADNAQNALSVTQEVVMFSGSSIEEINEAYGLFVGENSENTDFGQAVFYNNSSVSAKKEYRLAI
CASSMDELKEKYGIFEQFVKEGKTENLQALNVKGIYFGKGEAVAPDKVAWMFPGQASQYPNMLKDIYESY
PQVAALYMQADAYWKSKYGDKISSFVFGDDEEHLQTVLKDTKNTHPAMFLSNIAMFRLLSESGVRADYMI
GHSLGEVTALYASGMLDLKSALRLIGERGFAFDGIPKEDRGMMMSIKADKPKVEELIKESGLKVYVANLN
SPEQTVIGGREEQIERMAQILEQNKITYTKLNVSHAFHTELVANAAERYYEKIKDLSFDVPKAHVMACHK
VDFYPGDRENMALLPSMLKEQVVSSVNFTESVLKLYEKGVRVFVEAGPSSVLTNLVKNILQGKDVKVIAS
NNKRKNAVDAYKQALAELFACGVDVTVLPSQKAPGHSENTVRVAEKAVEESSGFKAEIKIPVQANAEPSK
PSGKESLVYSGVSAGLPGTFKKAFSDDNFDLLFEGKNLIERLTDDEAGSILDLNITRLLKTEAETTFKQL
TSINEVIQLAGKLGKIDMLADYQIDEKALRQMTMTVCAGVAAGYEALKDAGIPLIRERIKTSGGSYLPGR
LVLPEHMQDDTGVIFANGFFPIETWVDEVSKYIASKFARKTRNDLIDFYESVISKVSDYSVKKYLTDWFN
LHYSRLMYNSGEEEIYKFNHEFLYSFSLQANNRLAQFIGAMGPNLFLNAACSSTITAVTVAEGLIRAGHA
RRMIVIGADNVTSKSILPWSAASFLSTGVLTTSSDLFEAAVPFDRRRSGMILGAGAVGLVIEKESDVAER
GMNGICRILGTHAFNTAGHPARIDSNRFAVEFDKFMTRMEQEYGFARKDIAKRTVYYSHETFSPRKGGCA
CAEKTALESTFGDNFRDVKVINTKGMTGHTLGASIEEAVAAKALQYQKIPPVVNFKEPDPDLEGLNLSSG
GSYSFDYVIRMVAGYGSQGNYHLLQKIAEGDRRILDEEAYQRWLDRITGSKGAKLAKCGRILVAEGAQKE
IQAREIEAPTGEVPFSSGTAAVLDRKPDYAASFATPDSTHIDKNKIADNAIVDEILDIYSEITGYPKEML
DLNMEIEADLGIDTVKQATILSMISEKFNIPQEDSVKLSNYPTIGHVVNMVQSKYAKEDNISKGSTVPYA
KSDVFPGNINVAGSEAGNVQEEVLKVISEITKYPVEMLDMNMEMEADLGIDTVKQATIFSILGEKFNLGD
KNANISQYKTIGSIVDLVSQSAGKGLKETADLGGETYSSNVVNNIVNFEKPADQPQSGIQAGKFGSKNAK
GLSGNNEKNIEEEVLEIISTITKYPAEMLEKDMEMEADLGIDTVKQATIFSLLSEKFDVGKNEKINISEY
KTIGSIIELVKGSFKKEEPSFEDAKGEVAAVESIDDEDVNIQKDLCLQIPVFVEKEAKGEDFDLKDKKIW
VMGDNDGQVRKVAQYFAELSAGVEEFVFEYKGDAAKLEKDVAEFINKNHKADAIVDCTHLRTDVDFEKLT
EEEQEKMLFLSSEARFIFYKTLAQKVSMPEIRIVCAISMDGCHGYSPKEQIVADPFYSALSGLYKGLGKE
WGKSTVRIVDLGPDKGRILENEDLSILAKELKNKCDDYEIGYHDGKRGVIKLKNLDRGSFKQMNIPENAH
FVITGGGSGITSEITKGLSRKFKGKYTIIGRTELPDDSELIPDDETSANDIKLEIQKRLERTNKKVTPVM
VQKEYDKLIKSNSIKKLLESIKEDGNSATYLACDVRNYEELKKALDKAVQENGPVHVLIHGAGVERSRLL
SQKEREEFNDVFSVKAKGLCNLYRILDKKALKIAMAFSSISGRFGNGAQIDYCAANSFLSGFMAMLATKY
KDIYSLSLAWSGWKDLGMAWRNEFVKTNSEEMGLHLIEPERGTNEFINILTGNIDSKEVVISRGLGVLDD
NMVVGESLDDKPMIDWITKKNGRIEKVFKVVSVKRDAIFDHHRLGTVPLAPAVSFMELAAEAFSMISGEK
TQFCFRNMNMDKPLKLFHEEPREVIALLDQKEGTDGVDVKLYTYLNSRFGISKLIGLNSMNVSGKLGEYR
HLLDLMKIESEPMEQDFTGKALKDLLKRNPNSINLGTLFIDAIKENHIFRRNQNGAVFSMLLPEEELINE
KYHLDKLLINPAFADSVFQICGVHSLYNSVDVYLPWQIEEFGVVKAPKERIRYKAYCALKHEDDEVKVYD
VIMLDENNEVCYYAKSVKMRLIHS
>gi|125972659|ref|YP_001036569.1| beta-ketoacyl synthase [Clostridium thermocellum ATCC 27405]
MKNYFYPEERIAIVGMGALLPDANNVDSFWNNILSKKVSIKELPESILNPDIYYDRDAFGKINKNDKTYT
RMVAKVDVDDYPSLTRKFKIPPAVAEHMDPNQHVAIYCVDQALQSLANSNINRERTAVIMNIGAPGIRYN
NIIRRTYYAKIEHYLRNNPKLNESLKKEELDEVLNGLSDMALAGTIPITEDSAPGMLQSITASRISNLFD
FYGPAYTIDAACASSLAAVICGITGLLRKDYDVLITGGVDVTLDESPFVVFSAINALSPTGSYPFDSRAN
GFVIGLGGGVLILKRLEDALRDNDRIYALISGFGQGSDGKGKYIAAPNEEGQVRVLKSTLEMMGYPADTI
EYIEAHGTGTSVGDVVEIKALKKAFDAMGVTKKNFCGISSVKSNIGHLRYAAGSPGLIKAAMAIYNKILP
PTANIEKINPKLEIEDSPFYILTEKKPWRENPSHPRRANVSAYGFGGADYCLALEEFRPEFIRKTYAFSK
PYEDAKNADNAQNALSVTQEVVMFSGSSIEEINEAYGLFVGENSENTDFGQAVFYNNSSVSAKKEYRLAI
CASSMDELKEKYGIFEQFVKEGKTENLQALNVKGIYFGKGEAVAPDKVAWMFPGQASQYPNMLKDIYESY
PQVAALYMQADAYWKSKYGDKISSFVFGDDEEHLQTVLKDTKNTHPAMFLSNIAMFRLLSESGVRADYMI
GHSLGEVTALYASGMLDLKSALRLIGERGFAFDGIPKEDRGMMMSIKADKPKVEELIKESGLKVYVANLN
SPEQTVIGGREEQIERMAQILEQNKITYTKLNVSHAFHTELVANAAERYYEKIKDLSFDVPKAHVMACYK
VDFYPGDRENMALLPSMLKEQVVSSVNFTESVLKLYEKGVRVFVEAGPSSVLTNLVKNILQGKDVKVIAS
NNKRKNAVDAYKQALAELFACGVDVTVLPSQKAPGHSENTVRVAEKAVEESSGFKAEIKIPVQANAEPSK
PSGKESLVYSGVSAGLPGTFKKAFSDDNFDLLFEGKNLIERLTDDEAGSILDLNITRLLKTEAETTFKQL
TSINEVIQLAGKLGKIDMLADYQIDEKALRQMTMTVCAGVAAGYEALKDAGIPLIRERIKTSGGSYLPGR
LVLPEHMQDDTGVIFANGFFPIETWVDEVSKYIASKFARKTRNDLIDFYESVISKVSDYSVKKYLTDWFN
LHYSRLMYNSGEEEIYKFNHEFLYSFSLQANNRLAQFIGAMGPNLFLNAACSSTITAVTVAEGLIRAGHA
RRMIVIGADNVTSKSILPWSAASFLSTGVLTTSSDLFEAAVPFDRRRSGMILGAGAVGLVIEKESDVAER
GMNGICRILGTHAFNTAGHPARIDSNRFAVEFDKFMTRMEQEYGFARKDIAKRTVYYSHETFSPRKGGCA
CAEKTALESTFGDNFRDVKVINTKGMTGHTLGASIEEAVAAKALQYQKIPPVVNFKEPDPDLEGLNLSSG
GSYSFDYVIRMVAGYGSQGNYHLLQKIAEGDRRILDEEAYQRWLDRITGSKGAKLAKCGRILVAEGAQKE
IQAREIEAPTGEVPFSSGTAAVLDRKPDYAASFATPDSTHIDKNKIADNAIVDEILDIYSKITGYPKEML
DLNMEIEADLGIDTVKQATILSMISEKFNIPQEDSVKLSNYPTIGHVVNMVQSKYAKEDNISKGSTVPYA
KSDVFPGNINVAGSEAGNVQEEVLKVISEITKYPVEMLDMNMEMEADLGIDTVKQATIFSILGEKFNLGD
KNANISQYKTIGSIVDLVSQSAGKGLKETADLGGETYSSNVVNNIVNFEKPADQPQSGIQAGKFGSKNAK
GLSGNNEKNIEEEVLEIISTITKYPAEMLEKDMEMEADLGIDTVKQATIFSLLSEKFDVGKNEKINISEY
KTIGSIIELVKGSFKKEEPSFEDAKGEVAAVESIDDEDVNIQKDLCLQIPVFVEKEAKGEDFDLKDKKIW
VMGDNDGQVRKVAQYFAELSAGVEEFVFEYKGDAAKLEKDVAEFINKNHKADAIVDCTHLRTDVDFEKLT
EEEQEKMLFLSSEARFIFYKTLAQKVSMPEIRIVCAISMDGCHGYSPKEQIVADPFYSALSGLYKGLGKE
WGKSTVRIVDLGPDKGRILENEDLSILAKELKNKCDDYEIGYHDGKRGVIKLKNLDRGSFKQMNIPENAH
FVITGGGSGITSEITKGLSRKFKGKYTIIGRTELPDDSELIPDDETSANDIKLEIQKRLERTNKKVTPVM
VQKEYDKLIKSNSIKKLLESIKEDGNSATYLACDVRNYEELKKALDKAVQENGPVHVLIHGAGVERSRLL
SQKEREEFNDVFSVKAKGLCNLYRILDKKALKIAMAFSSISGRFGNGAQIDYCAANSFLSGFMAMLATKY
KDIYSLSLAWSGWKDLGMAWRNEFVKTNSEEMGLHLIEPERGTNEFINILTGNIDSKEVVISRGLGVLDD
NMVVGESLDDKPMIDWITKKNGRIEKVFKVVSVKRDAIFDHHRLGTVPLAPAVSFMELAAEAFSMISGEK
TQFCFRNMNMDKPLKLFHEEPREVIALLDQKEGTDGVDVKLYTYLNSRFGISKLIGLNSMNVSGKLGEYR
HLLDLMKIESEPMEQDFTGKALKDLLKRNPNSINLGTLFIDAIKENHIFRRNQNGAVFSMLLPEEELINE
KYHLDKLLINPAFADSVFQICGVHSLYNSVDVYLPWQIEEFGVVKAPKERIRYKAYCALKHEDDEVKVYD
VIMLDENNEVCYYAKSVKMRLIHS
>gi|125972659|ref|YP_001036569.1| beta-ketoacyl synthase [Clostridium thermocellum ATCC 27405]
MKNYFYPEERIAIVGMGALLPDANNVDSFWNNILSKKVSIKELPESILNPDIYYDRDAFGKINKNDKTYT
RMVAKVDVDDYPSLTRKFKIPPAVAEHMDPNQHVAIYCVDQALQSLANSNINRERTAVIMNIGAPGIRYN
NIIRRTYYAKIEHYLRNNPKLNESLKKEELDEVLNGLSDMALAGTIPITEDSAPGMLQSITASRISNLFD
FYGPAYTIDAACASSLAAVICGITGLLRKDYDVLITGGVDVTLDESPFVVFSAINALSPTGSYPFDSRAN
GFVIGLGGGVLILKRLEDALRDNDRIYALISGFGQGSDGKGKYIAAPNEEGQVRVLKSTLEMMGYPADTI
EYIEAHGTGTSVGDVVEIKALKKAFDAMGVTKKNFCGISSVKSNIGHLRYAAGSPGLIKAAMAIYNKILP
PTANIEKINPKLEIEDSPFYILTEKKPWRENPSHPRRANVSAYGFGGADYCLALEEFRPEFIRKTYAFSK
PYEDAKNADNAQNALSVTQEVVMFSGSSIEEINEAYGLFVGENSENTDFGQAVFYNNSSVSAKKEYRLAI
CASSMDELKEKYGIFEQFVKEGKTENLQALNVKGIYFGKGEAVAPDKVAWMFPGQASQYPNMLKDIYESY
PQVAALYMQADAYWKSKYGDKISSFVFGDDEEHLQTVLKDTKNTHPAMFLSNIAMFRLLSESGVRADYMI
GHSLGEVTALYASGMLDLKSALRLIGERGFAFDGIPKEDRGMMMSIKADKPKVEELIKESGLKVYVANLN
SPEQTVIGGREEQIERMAQILEQNKITYTKLNVSHAFHTELVANAAERYYEKIKDLSFDVPKAHVMACYK
VDFYPGDRENMALLPSMLKEQVVSSVNFTESVLKLYEKGVRVFVEAGPSSVLTNLVKNILQGKDVKVIAS
NNKRKNAVDAYKQALAELFACGVDVTVLPSQKAPGHSENTVRVAEKAVEESSGFKAEIKIPVQANAEPSK
PSGKESLVYSGVSAGLPGTFKKAFSDDNFDLLFEGKNLIERLTDDEAGSILDLNITRLLKTEAETTFKQL
TSINEVIQLAGKLGKIDMLADYQIDEKALRQMTMTVCAGVAAGYEALKDAGIPLIRERIKTSGGSYLPGR
LVLPEHMQDDTGVIFANGFFPIETWVDEVSKYIASKFARKTRNDLIDFYESVISKVSDYSVKKYLTDWFN
LHYSRLMYNSGEEEIYKFNHEFLYSFSLQANNRLAQFIGAMGPNLFLNAACSSTITAVTVAEGLIRAGHA
RRMIVIGADNVTSKSILPWSAASFLSTGVLTTSSDLFEAAVPFDRRRSGMILGAGAVGLVIEKESDVAER
GMNGICRILGTHAFNTAGHPARIDSNRFAVEFDKFMTRMEQEYGFARKDIAKRTVYYSHETFSPRKGGCA
CAEKTALESTFGDNFRDVKVINTKGMTGHTLGASIEEAVAAKALQYQKIPPVVNFKEPDPDLEGLNLSSG
GSYSFDYVIRMVAGYGSQGNYHLLQKIAEGDRRILDEEAYQRWLDRITGSKGAKLAKCGRILVAEGAQKE
IQAREIEAPTGEVPFSSGTAAVLDRKPDYAASFATPDSTHIDKNKIADNAIVDEILDIYSKITGYPKEML
DLNMEIEADLGIDTVKQATILSMISEKFNIPQEDSVKLSNYPTIGHVVNMVQSKYAKEDNISKGSTVPYA
KSDVFPGNINVAGSEAGNVQEEVLKVISEITKYPVEMLDMNMEMEADLGIDTVKQATIFSILGEKFNLGD
KNANISQYKTIGSIVDLVSQSAGKGLKETADLGGETYSSNVVNNIVNFEKPADQPQSGIQAGKFGSKNAK
GLSGNNEKNIEEEVLEIISTITKYPAEMLEKDMEMEADLGIDTVKQATIFSLLSEKFDVGKNEKINISEY
KTIGSIIELVKGSFKKEEPSFEDAKGEVAAVESIDDEDVNIQKDLCLQIPVFVEKEAKGEDFDLKDKKIW
VMGDNDGQVRKVAQYFAELSAGVEEFVFEYKGDAAKLEKDVAEFINKNHKADAIVDCTHLRTDVDFEKLT
EEEQEKMLFLSSEARFIFYKTLAQKVSMPEIRIVCAISMDGCHGYSPKEQIVADPFYSALSGLYKGLGKE
WGKSTVRIVDLGPDKGRILENEDLSILAKELKNKCDDYEIGYHDGKRGVIKLKNLDRGSFKQMNIPENAH
FVITGGGSGITSEITKGLSRKFKGKYTIIGRTELPDDSELIPDDETSANDIKLEIQKRLERTNKKVTPVM
VQKEYDKLIKSNSIKKLLESIKEDGNSATYLACDVRNYEELKKALDKAVQENGPVHVLIHGAGVERSRLL
SQKEREEFNDVFSVKAKGLCNLYRILDKKALKIAMAFSSISGRFGNGAQIDYCAANSFLSGFMAMLATKY
KDIYSLSLAWSGWKDLGMAWRNEFVKTNSEEMGLHLIEPERGTNEFINILTGNIDSKEVVISRGLGVLDD
NMVVGESLDDKPMIDWITKKNGRIEKVFKVVSVKRDAIFDHHRLGTVPLAPAVSFMELAAEAFSMISGEK
TQFCFRNMNMDKPLKLFHEEPREVIALLDQKEGTDGVDVKLYTYLNSRFGISKLIGLNSMNVSGKLGEYR
HLLDLMKIESEPMEQDFTGKALKDLLKRNPNSINLGTLFIDAIKENHIFRRNQNGAVFSMLLPEEELINE
KYHLDKLLINPAFADSVFQICGVHSLYNSVDVYLPWQIEEFGVVKAPKERIRYKAYCALKHEDDEVKVYD
VIMLDENNEVCYYAKSVKMRLIHS
>gi|111548647|dbj|BAA89382.2| unnamed protein product [Moritella marina]
MAKKNTTSIKHAKDVLSSDDQQLNSRLQECPIAIIGMASVFADAKNLDQFWDNIVDSVDAIIDVPSDRWN
IDDHYSADKKAADKTYCKRGGFIPELDFDPMEFGLPPNILELTDIAQLLSLIVARDVLSDAGIGSDYDHD
KIGITLGVGGGQKQISPLTSRLQGPVLEKVLKASGIDEDDRAMIIDKFKKAYIGWEENSFPGMLGNVIAG
RIANRFDFGGTNCVVDAACAGSLAAVKMAISDLLEYRSEVMISGGVCCDNSPFMYMSFSKTPAFTTNDDI
RPFDDDSKGMLVGEGIGMMAFKRLEDAERDGDKIYSVLKGIGTSSDGRFKSIYAPRPDGQAKALKRAYED
AGFAPETCGLIEGHGTGTKAGDAAEFAGLTKHFGAASDEKQYIALGSVKSQIGHTKSAAGSAGMIKAALA
LHHKILPATIHIDKPSEALDIKNSPLYLNSETRPWMPREDGIPRRAGISSFGFGGTNFHIILEEYRPGHD
SAYRLNSVSQTVLISANDQQGIVAELNNWRTKLAVDADHQGFVFNELVTTWPLKTPSVNQARLGFVARNA
NEAIAMIDTALKQFNANADKMTWSVPTGVYYRQAGIDATGKVVALFSGQGSQYVNMGRELTCNFPSMMHS
AAAMDKEFSAAGLGQLSAVTFPIPVYTDAERKLQEEQLRLTQHAQPAIGSLSVGLFKTFKQAGFKADFAA
GHSFGELTALWAADVLSESDYMMLARSRGQAMAAPEQQDFDAGKMAAVVGDPKQVAVIIDTLDDVSIANF
NSNNQVVIAGTTEQVAVAVTTLGNAGFKVVPLPVSAAFHTPLVRHAQKPFAKAVDSAKFKAPSIPVFANG
TGLVHSSKPNDIKKNLKNHMLESVHFNQEIDNIYADGGRVFIEFGPKNVLTKLVENILTEKSDVTAIAVN
ANPKQPADVQMRQAALQMAVLGVALDNIDPYDAVKRPLVAPKASPMLMKLSAASYVSPKTKKAFADALTD
GWTVKQAKAVPAVVSQPQVIEKIVEVEKIVERIVEVERIVEVEKIVYVNADGSLISQNNQDVNSAVVSNV
TNSSVTHSSDADLVASIERSVGQFVAHQQQLLNVHEQFMQGPQDYAKTVQNVLAAQTSNELPESLDRTLS
MYNEFQSETLRVHETYLNNQTSNMNTMLTGAEADVLATPITQVVNTAVATSHKVVAPVIANTVTNVVSSV
SNNAAVAVQTVALAPTQEIAPTVATTPAPALVAIVAEPVIVAHVATEVAPITPSVTPVVATQAAIDVATI
NKVMLEVVADKTGYPTDMLELSMDMEADLGIDSIKRVEILGAVQELIPDLPELNPEDLAELRTLGEIVDY
MNSKAQAVAPTTVPVTSAPVSPASAGIDLAHIQNVMLEVVADKTGYPTDMLELSMDMEADLGIDSIKRVE
ILGAVQEIITDLPELNPEDLVELRTLGEIVSYMQSKAPVAESAPVATAPVATSSAPSIDLNHIQTVMMDV
VADKTGYPTDMLELGMDMEADLGIDSIKRVEILGAVQEIITDLPELNPEDLAELRTLGEIVSYMQSKAPV
AESAPVATASVATSSAPSIDLNHIQTVMMEVVADKTGYPVDMLELAMDMEADLGIDSIKRVEILGAVQEI
ITDLPELNPEDLAELRTLGEIVSYMQSKAPVAEAPAVPVAVESAPTSVTSSAPSIDLDHIQNVMMDVVAD
KTGYPANMLELAMDMEADLGIDSIKRVEILGAVQEIITDLPELNPEDLAELRTLEEIVTYMQSKASGVTV
NVVASPENNAVSDAFMQSNVATITAAAEHKAEFKPAPSATVAISRLSSISKISQDCKGANALIVADGTDN
AVLLADHLLQTGWNVTALQPTWVAVTTTKAFNKSVNLVTLNGVDETEINNIITANAQLDAVIYLHASSEI
NAIEYPQASKQGLMLAFLLAKLSKVTQAAKVRGAFMIVTQQGGSLGFDDIDSATSHDVKTDLVQSGLNGL
VKTLSHEWDNVFCRAVDIASSLTAEQVASLVSDELLDANTVLTEVGYQQAGKGLERITLTGVATDSYALT
AGNNIDANSVFLVSGGAKGVTAHCVARIAKEYQSKFILLGRSTFSSDEPSWASGITDEAALKKAAMQSLI
TAGDKPTPVKIVQLIKPIQANREIAQTLSAITAAGGQAEYVSADVTNAASVQMAVAPAIAKFGAITGIIH
GAGVLADQFIEQKTLSDFESVYSTKIDGLLSLLSVTEASNIKQLVLFSSAAGFYGNPGQSDYSIANEILN
KTAYRFKSLHPQAQVLSFNWGPWDGGMVTPELKRMFDQRGVYIIPLDAGAQLLLNELAANDNRCPQILVG
NDLSKDASSDQKSDEKSTAVKKPQVSRLSDALVTKSIKATNSSSLSNKTSALSDSSAFQVNENHFLADHM
IKGNQVLPTVCAIAWMSDAAKATYSNRDCALKYVGFEDYKLFKGVVFDGNEAADYQIQLSPVTRASEQDS
EVRIAAKIFSLKSDGKPVFHYAATILLATQPLNAVKVELPTLTESVDSNNKVTDEAQALYSNGTLFHGES
LQGIKQILSCDDKGLLLACQITDVATAKQGSFPLADNNIFANDLVYQAMLVWVRKQFGLGSLPSVTTAWT
VYREVVVDEVFYLQLNVVEHDLLGSRGSKARCDIQLIAADMQLLAEVKSAQVSVSDILNDMS
>gi|157376334|ref|YP_001474934.1| erythronolide synthase [Shewanella sediminis HAW-EB3]
MSQTSKPSKKPLASDKKTVKVDKSSAKTAEPQQDSQADSRLNKRLKDMPIAIVGMASIFANSRYLNKFWD
LISEKIDAITELPSTHWQPEEYYDANKSTPDKSYCKRGGFLPGVDFNPMEFGLPPNILELTDSSQLLSLI
VAKEVLADAHLPEGYDRDKIGITLGVGGGQKISHSLTARLQYPVLKKVFANSGISDEDSAMLIKKFQDQY
VHWEENSFPGSLGNVISGRIANRFDFGGMNCVVDAACAGSLAAMRMALTELTEGRSEMMITGGVCTDNSP
SMYMSFSKTPAFTTNETIQPFDIDSKGMMIGEGIGMVALKRLEDAERDGDRIYSVIKGVGSSSDGKFKSI
YAPRPEGQAKALRRAYDDAGFEPHTLGLIEAHGTGTAAGDAAEFAGLCSVFADGNDTKQHIALGSVKSQI
GHTKSTAGTAGLIKAALALHHKVLPATINISQPSPKLEIEKSPFYLNTETRPWLPRVDGTPRRAGISSFG
FGGTNFHFVLEEYNKEHSRTDAEKAKYRQRQVAQSFLVSAASKDALITELNALATAAASSEFIIANAAKD
YSLRELDSKSARIGLVANTSEELATQIKQAIAKLTSSTDDAWQQPGGTSYRANAIEGKVAALFAGQGSQY
LNMGRDLACYYPEMRQQFVAADKVFAENDKTPLSQTLYPKPVFNRDDVKAQEAVLTNTANAQSAIGAISM
GQYELFTAAGFNADMVAGHSFGELSALCASGAISTEDYYKLAFARGDAMATKAPAKDGVEADAGAMFAII
TKDAKDLEAVEATIAKFDGVKVANYNAPTQSVIAGPTASTADAAKALSELGYKAINLPVSGAFHTELVGH
AQAPFAKAIDAAKFTKPSRALYSNATGELYDNTAAKIKASFKKHMLQSVRFTAELEAMYDAGARVFVEFG
PKNILQKLVQGTLADKAGPNKTGIVAISINPSPKGDSDLQLKQAAIQLAVAGIKLDNIDPYQADIAAPEK
KSPMSISLNAVNHISKATRAKMAKSLETGTVTSSTIVEEKVIEKVVEVEKVVEVEKIVEVEKVVERIVEV
PTVIESQVVSQNAPVLNKEPSAVLSNKPSAAVSNDALTNFFAAQQQAAELHQQFLEIPQQYGETFTTLMT
EQTKLAGNGIAIPESLQRSMEQFHQLQAQTLQSHTQFLEMQAGSNTAALSMLTGTPTQILSQPQAKTVKP
VAPVQTAIAQPAPVQVAAPAPVAQVQVAPVQVAKPVQTVSHQAAPAPVQVTPVAVAPAAQAETALSATLS
SETALSAQRVQATMLEVVAEKTGYPTEMLELEMDMEADLGIDSIKRVEILGTVQDELPGLPELSPEDLAE
CRTLGEIVSYMNSKLPNTSAAATPVATAASAETALSAQTALSAQRVQATMMSVVAEKTGYPTEMLELEMD
MEADLGIDSIKRVEILGTVQDELPGLPELSPEDLAECRTLGEIVAYMNSKLPSGSSTAQATSAAGSLPSQ
AAEGSLSTGLSAEKVQSTMMSVVAEKTGYPTEMLELEMDMEADLGIDSIKRVEILGTVQDELPGLPELNP
EDLAECRTLGEIVAYMNSKLPSGSSTAQATSAAGSLPSQAAEGSLSTGLSAEKVQSTMMSVVAEKTGYPT
EMLELSMDMEADLGIDSIKRVEILGTVQDELPGLPELNPEDLAECRTLGEIVTYMNSQLAEGSKLPAEGT
NTSAAAAPVATAASAETALSAQTALSSTLSAEKVQVTMMSVVADKTGYPTEMLELSMDMEADLGIDSIKR
VEILGTVQDELPGLPELNPEDLAECRTLGEIVSYMNSKLPATNSAAAAPNISAAEGSISATLSAEKVQGT
MMSVVAEKTGYPTEMLELSMDMEADLGIDSIKRVEILGTVQDELPGLPELNPEDLAECRTLGEIVSYMNS
KLTNAGAAAGAAVSGAVKSVADTITSSLELPPHSEVALKKLNAADQINDCFAADATLVITDDGHNAGVLA
EKLTKQGLKVAVVRLPKGAAQSPLSSDVASFQADNLDESGINGVIAQIEQQLGHIGGFIHLQPDADTSNV
SDAVNLSNDSFTHVSQAFLWAKLLQPKLTTASEKRRSFITVSRIDGGFGYLDTKQLQDAELNQAALAGLT
KTLSHEWPTVFCRALDIATNLDATHLADAVTNELFDSNAQLPEVGLSLDAKGNVSRTTLIAGEASSKHAA
SSLDSADKILVTGGAKGVTFECALAVAKRTKSHFILAGRSELLAIPTWAENKQISELKPAAIAHIISTGN
KPTPKQVESLVWTVKSSIEINTALEAFAQVGASAEYVSMDVTDTAAITAALKGRSHEITGLIHGAGVLAD
KHIQDKTVEELGRVYGTKVNGLKALLAALDSSKVKLLAMFSSAAGFYGNTGQSDYAMSNDILNKAALQFT
ARNPQAKVMSFNWGPWDGGMVTDALKKMFTDRGVYVIPLKAGAELFATQLLSETGVQLLIGTSMQGGDDN
SKNAEGSATGNASVKKLNAGEVHNALIPQGLATKGPLAPVSLIRALNPNAMVFIQDHRISGNPVLPTVCA
IQWMREAASEMLGTQVKVLDYKLLKGIIFDSSDVQEMTLELTPSGNDQMNALISSQGRPQYKATLVSAEG
DVDAASKSFTELGEAVTDAAELYSNGTLFHGPRLQGIKQVFKFDNKGLLASCQLPRVSDSDCGQFVATQH
IGGSQPFAEDLLLQAMLVWARLKYGAASLPSAIGEFISNKPLAFGDKAVLELEVIKTSARSLEANVALYH
ENGELSAMMKGAKVTISKNLNSAFLNESAKGEQA
>gi|149369398|ref|ZP_01889250.1| polyunsaturated fatty acid synthase PfaA [unidentified eubacterium SCB49]
MDKVNSSLKKTPVAIIGLSAMFADASNVDQFWNNIINQKDSIVDVPESRWKIEDYYDADPMVADKTYCKK
GGFIPDVDFNPMEFGLPPNILEVTDASQLLSLIAARDAFEDAGYGRESEKFTALLKEKTGVILGVGGGQK
LITPLTSRLQAPIWEAALKSSGISEADIPHIVEKMKKAYIGWNENSFPGMLGNVISGRITNRFDLGGINS
VVDAACAASLSAIKMAVSELIEGRCDMMLTGGVDTDNSPFMYMSFSKTPAFSRKGSIRPFDIDSDGMLIG
EGVGMLVLKRLEDAERDGDRIYGLLTGVGSSSDGRYKSVYAPRPQGQALAMQRAYDEAGYDASTVKLIEG
HGTATGAGDAAEFKSMSMVFGKNDATKNHIAIGSVKSQIGHTKAAAGAAGMIKAALALYHKVLPGTINVT
KPHDKFGIEKSPFYVNAETRPWFKNGVPRRAGLSAFGFGGVNVHFAMEEYEKKTPFTDRMHQSFHSIYIK
AANTTDLITSLKKTHTDLKSNEFETAYYNLKETSKQGTAKENEARVGFVAETLMDCISKIEISIKQLENN
KEAWSHPVGVYFRPNGIASTTKVASLFSGQGSQYANMAKEATSSFETIQQTIADFDAKKGYDLANKIYPK
PVFTDEDKAIQEQNIKNTEFAQPAIGAISLGYYNVFKNAGFVSDMVAGHSFGELTALCAAGVLNQNDYMT
LAIARGEAMGSKNASGDAGTMLAVKAAASEIEPLIAPIADVSIANINSSSQIVLGGTTEGIKKAKALLDT
KKMRSILLPVSAAFHTSCVGHAQKPFEKSIKTVQFSNPVIPVYSNSTGNAYPTDAATIKKILGQHILNSV
DFKSEIENMYAAGARVFVEFGPKSILTNLVKDILADKEHFVLATNAKATKNSDLQIREAAIQLQVLGCKI
DAIDCNARQEKAPLAAPKMAVKIAGNNYVSPATQKAYKDVLNDGFKVSGTTQQFTKTEEEIKEIEVVSEV
INAIPTYTNEDNTDQETEEDMMVDVIKSAIDGIKENQSKTLDMFQSILMEQNKQTAQLLSLLSGNFSPDE
NLLEAPEAPLTIENAVPEAPAAKTVVTPTPAQPTAPVVAPVATPAAPVAGNSEMLDLMLSVVADKTGYPA
EMLELSMDMEADLGIDSIKRVEIFGAITEQSDKLTDINPNDLTELRTLQEIVDYISSKAGISATASAPTP
KVEETQKVETPVAAQEVKTAAPAAGNSEMLDLMLSVVADKTGYPAEMLELSMDMEADLGIDSIKRVEIFG
AITEQSDKLTDINPNDLTELRTLQEIVDYISSKAGISATASAPTPKVEETQKVETPVAAQEVKTATPAAG
NSEMLDLMLSVVADKTGYPAEMLELSMDMEADLGIDSIKRVEIFGAITEQSDKLTDINPNDLTELRTLQE
IVDYISSKAGISATKETVVSKPEATVTETVATDLFSAAVDDTVTISEENSEMLDLMLSVVADKTGYPAEM
LELNMDMEADLGIDSIKRVEIFGAITEQSDKLTDINPNDLTELRTLQEIVDYISSKAGISTKKKSLSLA
>gi|149675716|dbj|BAF64738.1| beta-ketoacyl synthase [Shewanella livingstonensis]
MSQSSNKDKRLNKRLKDMPVAIVGMASIFANSRYLNKFWDLISEKIDAIIDVPETHWNAEDYYNADKSMA
DKSYCKRGGFLPEVDFNPMEFGLPPNILELTDTSQLLSLVVAKEVLADAGIDAQYDTDRIGITLGVGGGQ
KINHSLSGRLQYPILKKVFKNSGLSDEDTEMLIKKFQDQYIHWEENSFPGSLGNVIAGRIANRFDLGGMN
CVVDAACAGSLAAMRMAITELVEGRSDMMITGGVCTDNSPSMYMSFSKTPAFTTNDTIQPFDIDSKGMMI
GEGIGMMALKRLDDAERDGDRIYAVIKGIGSSSDGKFKSIYAPRPEGQAKALRRAYDDAGFAPHTVGLIE
AHGTGTAAGDVAEFNGLKSVFADGNDSLQHIALGSVKSQVGHTKSTAGTAGVIKAALALHHKVLPPTINV
SKPNPKLNIQDSPFYLNTETRPWLPRVDNTPRRAGISAFGFGGTNFHIVLEEYRQEHVRGDKYRQRSVPQ
SLLIHAENKAALQAQLTALQSEIKAVDTTQQNRQEIVLADFGKRFALNTIAPNAARIGLVVASLADLTIQ
LTQALAQLSSNTADCWQLPSGTSYRAAALIHPEAASHKVAALFAGQGAQYLNMGADLACLYPEMRQQLMQ
ADKVFAQHKQTPLSQIMYPNPAFEAEDIAAQQAALTNTANAQSAIGAVSMGQYALLTQAGFKADMVAGHS
FGELSALCAAGVISQADYYQLAFARGQVMAATPKDQDAGVMFAIIVPAQSVDNGVEKLEQCISAFEGVKV
ANYNAPTQLVIAGPTASCTLAAQAITTELGFKAIALPVSGAFHTPLVAHAQQPFAAAINKIKFAKPKLIL
YANGTGKAHPNDPKAIQAAFSEHMLQSVRFSEQLNAMYDAGARVFVEFGPKNILQKLVEATLGNKAESVS
VVSLNPNPKGNSDTQLRQAACQLAVLGVALTEVDPYQAPIAELAKVSPMNVKLTASNYISPATQAKMQKS
LQTGTVTSQTVEVPVEKVVEKIVEKEVIKTEYIEVPATSAQAQASAVAAPLAATTPVAKAQQVSSSVPAS
ADSIGAFFAAQQQTAELHQQFLAIPQQYGDTFAHLMTAQAQMASSGLAIPESLQRSMEMFHQHQAQTLQS
HTQFLTQQAQANQAALAMLQGQTVTPSIQATVSVPAASVQPAFVQPNQVAQATTTPSPVVAPIAPAPVQT
AQAVQSQPTASQPVQAPVAQQVSSAAVTAPTVVLTQQQVLDTMLSVVADKTGYPTEMLELGMDMEADLGI
DSIKRVEILGTVQDELPGLPELSPEDLAECRTLGEIVSYMQTKLPAANSVAVASTGSTSANAAAPTSTGL
TAENVQLTMLAVVADKTGYPTEMLELGMDMEADLGIDSIKRVEILGTVQDELPGLPELSPEDLAECRTLG
EIVSYMQTKLPAASTVAPAPIASAAPATGLSAESVQRTMLAVVADKTGYPTEMLELGMDMEADLGIDSIK
RVEILGTVQDELPGLPELNPEDLAECRTLGEIVSYMQTKLPAVSTAAPVATVSAPATSGLSADTVLSTMM
SVVANKTGYPAEMLELSMDMEADLGIDSIKRVEILGTVQDELPGLPELNPEDLAECRTLGEIVSYMQTKL
PATNTEAPVSAPATPGLSADTVLSTMMSVVADKTGYPAEMLELSMDMEADLGIDSIKRVEILGTVQDELP
GLPELNPEDLAECRTLGEIVSYMQTQLPTTTTIAAVAPASTTNKVDVNTAALPPHSEVALKKLPAADKLA
ECFSTDSCIVITDDGHNAGLLAEKLNAKGLTVAVIRNPQTITVAHSPLSSDIKSYTLSSIDDAQIAQVIA
DIKADLGAEHAIAGFIHLQPQATANSSELMSCTVAAKAAVDNAFLWAKHLHAEFAKPTKASRLCYFTVSR
LDGGFGYLDNTQLATAELNQAALSGLSKTLSHEWPQVFCRALDIANNIDTTSFADAIVAELFDIDGANAS
ADRINEVGISNQGRVTLVAGNASEQFAPASLNRNDTILVTGGAKGVTFECALTLAKQCQSHFVLAGRSQH
FGKDLPAWAQGKKASELKAAAIAYIQSQGNKPTPKQIDALVWPISSSLEIDAALSAFSKVGASAQYVSMD
VSDATAVAASLKSLTNAKGDSLIINGVIHGAGVLADKHIQDKTLDELNRVYHTKVTGLASIINALDPQQI
KLIALFSSAAGFYGNTGQSDYAMSNEILNKTALKLAHTLPQAKVMSFNWGPWDGGMVSSALKKMFVERGV
YVIPLQAGAELFAHSLLSQQGAQLLIGSDMQGSSEQDNAIKKLNADALLIAKGSLTFATNTLVTKAFTAN
AVTTEAVTIESSATDIISQTVTRVLTPAEMLFVSDHCIAGNPVLPTVCAMQWMRDAAETLCHVPVSIAEY
KLLKGVIFDTNEPHLLQLELTQTDAGISALISSRLLNDPSAVMKPQYQAQLVINKAILATDVAKPTVSDS
SLAQWANMSPLYSGAELYQNGTLFHGPRLQGIKQVLAFDDAQLLCQVQLPSINASDCQGFIPSSALGGSQ
IFAEDLLLQAMLVWARLKYDAASLPSTTGECVTAWPFANGDKGYIQLDVVKHSGRMLVANVSLYHQDGRL
SCQMLNAKVTISKSLNGAFIPHQASAELSHKDTV
>gi|291442191|ref|ZP_06581581.1| multi-domain beta keto-acyl synthase [Streptomyces ghanaensis ATCC 14672]
MATPSVRSTGSAHPAPPTEWLRLLAEAQRQSAEAHATYQRVTAENHQLYLRTAHASMEALLGAAGVRLPA
VGVDDPQPWPVAEVAVGATGAQVVPSGQPVHAPVPSGTVPGSGQPFRSGSGGDRGEATSAVPAPPPQATA
VPSPVEAPAPGLVLLGPQPDALRPDGLPLDGLPLDAESIGALLLEVVAERTGYPADIINLDMELEADLGI
DSIKKVEVLSRVRQRVGELPAADLSELASLRTLREISVKVAQLAGQIDDAGDQASAGPSPVSPASLKPPG
TSAPGSPEDVDSEPAAGPEATDAPAAEVPTATNRPEPVRLAVRALPLAPAGLALAGLRDRELLVLDDSTR
VGHLLVEELAAHGVPARLVTGLPAEARSVILLDKGDDPPAAFAAVRGLADRLSSAGGLLVTVQDTGGDFG
LSGNGGRPVHGGLDALARTAAREWPLATVKAIDCARTGRSDKQVAAAIAAELTAGGPSITVGLPADGSRT
VPLACPVAPGPVEPRADADSVIVVTGGARGVTASAIRELAAAHRPRLVLLGRTALAEEPAGLAGATDEAG
LIRLLATGPRQAPPAELAAEARRMLAVREVRQTLRALENAGSPTRYLSVDTRDEVVLRDALAEVRRDWGP
ITGVVHGAGVIADRLIGAKTDEQFALVYSTKVDGLRALLAATADDPLSLLVAFTSASGVFGSPGQADYAM
ANTAVDHLLSAYAAAHPGCLTRSLAWGPWDGGMVTRTIAERFRAAGVELIEPAAGARAFVAELADPGGPT
RVLRAAGDVAPDVLAGQGPVAELTLARPQYALLDDHRIDGAPVVPVAVLVHWFTGLARSWRPDTGPLVLH
DLRVLRRIELQEPGERLVLRGRTRTDESARRGGLTVELGAVGAKYAGAVVADGPPPDPHRWRTPEGLEEV
PEPYDGPALFHGPVFQVLDQVRLGADGGVAALRPRDVEPWLAVPWTVDVAALDGALQLAVGWTLQAGVGA
ALPMSIRECRIHRAGTDWGAARVVVSARRTDGMSAECDAAVLSEDGTVLAELLRVELIRRPDLTEG
>gi|239933783|ref|ZP_04690736.1| beta keto-acyl synthase [Streptomyces ghanaensis ATCC 14672]
MRLLAEAQRQSAEAHATYQRVTAENHQLYLRTAHASMEALLGAAGVRLPAVGVDDPQPWPVAEVAVGATG
AQVVPSGQPVHAPVPSGTVPGSGQPFRSGSGGDRGEATSAVPAPPPQATAVPSPVEAPAPGLVLLGPQPD
ALRPDGLPLDGLPLDAESIGALLLEVVAERTGYPADIINLDMELEADLGIDSIKKVEVLSRVRQRVGELP
AADLSELASLRTLREISVKVAQLAGQIDDAGDQASAGPSPVSPASLKPPGTSAPGSPEDVDSEPAAGPEA
TDAPAAEVPTATNRPEPVRLAVRALPLAPAGLALAGLRDRELLVLDDSTRVGHLLVEELAAHGVPARLVT
GLPAEARSVILLDKGDDPPAAFAAVRGLADRLSSAGGLLVTVQDTGGDFGLSGNGGRPVHGGLDALARTA
AREWPLATVKAIDCARTGRSDKQVAAAIAAELTAGGPSITVGLPADGSRTVPLACPVAPGPVEPRADADS
VIVVTGGARGVTASAIRELAAAHRPRLVLLGRTALAEEPAGLAGATDEAGLIRLLATGPRQAPPAELAAE
ARRMLAVREVRQTLRALENAGSPTRYLSVDTRDEVVLRDALAEVRRDWGPITGVVHGAGVIADRLIGAKT
DEQFALVYSTKVDGLRALLAATADDPLSLLVAFTSASGVFGSPGQADYAMANTAVDHLLSAYAAAHPGCL
TRSLAWGPWDGGMVTRTIAERFRAAGVELIEPAAGARAFVAELADPGGPTRVLRAAGDVAPDVLAGQGPV
AELTLARPQYALLDDHRIDGAPVVPVAVLVHWFTGLARSWRPDTGPLVLHDLRVLRRIELQEPGERLVLR
GRTRTDESARRGGLTVELGAVGAKYAGAVVADGPPPDPHRWRTPEGLEEVPEPYDGPALFHGPVFQVLDQ
VRLGADGGVAALRPRDVEPWLAVPWTVDVAALDGALQLAVGWTLQAGVGAALPMSIRECRIHRAGTDWGA
ARVVVSARRTDGMSAECDAAVLSEDGTVLAELLRVELIRRPDLTEG
>gi|212636304|ref|YP_002312829.1| Omega-3 polyunsaturated fatty acid synthase PfaA [Shewanella piezotolerans WP3]
MSQTSKPQQSSASEQAQDSQADTRLNKRLKDMPVAIVGMASIFANSRYLNKFWDLISEKIDAITELPATH
WQKEDYFDANKSTPDKSYCKRGGFLPDVDFNPMEFGLPPNILELTDSSQLLSLIVAKEVLADANLPEVYD
RDKIGITLGVGGGQKISHSLTARLQYPVLKKVFANSGISDEDSEMLIKKFQDQYVHWEENSFPGSLGNVI
AGRIANRFDFGGMNCVVDAACAGSLAAMRMALSELVEGRSEMMITGGVCTDNSPSMYMSFSKTPAFTTNE
TIQPFDIDSKGMMIGEGIGMIALKRLEDAERDGDRIYSVIKGIGSSSDGKFKSIYAPRPEGQAKALNRAY
DDAGFAPHTLGLIEAHGTGTAAGDAAEFAGLCSVFSDGNDTKQHIALGSVKSQIGHTKSTAGTAGLIKAA
LALHHKVLPATINVSQPSPKLDIENSPFYLNTETRPWLPRVDGTPRRAGISSFGFGGTNFHFVLEEYKAE
HSREDSEKAKYRQRQVAQSFLVSATSKDALIKELNTLAAASSAAEFNLKDAAANYAVRELATDAPRIGLV
ANSAAELASFIKQALSKLTASDDTQWQLPGGISFRAAAIEGKVAALFAGQGSQYLNMGRDLACYYPEMRQ
QLVTADKVFAANDKTPLSQTLYPKPVFNKDDVKAQEAVLTNTANAQSAIGAISMGQYALFSAAGFNADMV
AGHSFGELSALCAAGVISTDDYYKLAFARGDAMATKAKTKDGHDADCGAMFAVIHKAEDLSTLESTIAKF
DGVKVANYNAPTQSVIAGPTASTTDAAKALSDLGYKAINLPVSGAFHTELVGHAQAPFAKAIDAAKFTKP
SRALYSNASGALYESTAAKVKASFKKHMLQSVRFTAQLEAMFDAGARVFVEFGPKNILQKLVQGTLASKL
DELSVISINPSPKGDSDLQLKQAALQLAVAGVQLDNIDPYQADIAAPAKRSPMSLTLNAANHISPATRAK
MAKSLATGTVKSATIIEEKIVEKVVEKVVEVEKIVEVPTIIEKEVEKIVEIAVPMSNEHVVPTAPVQNNT
AAPSVSVSTDALSQFFAAQQQAAELHQQFLSIPQQYGETFTTLMTEQTKLAGSGVALPESLQRSMEQFHQ
LQAQTVQSHTQFLEMQAGNNNAALNMLNGAATVLTAQPLHSAVQRPQQAVQQVAVSAPAMSAPVITTQAA
APVAPVVNNTPAPVQQAVATQIEAVTKAAEAAPVVAAPSSAPAVPVSNSAVAVLSAEKVQATMLEVVAEK
TGYPTEMLELEMDMEADLGIDSIKRVEILGTVQDELPGLPELSPEDLAECRTLGEIVSYMNSKLADGSKL
STTAAVGASSESAAPQVATAKTALSAQKVQGTMMSVVAEKTGYPTEMLELEMDMEADLGIDSIKRVEILG
TVQDELPGLPELSPEDLAECRTLGEIVSYMNSKLSTNDAAGASSESAAPQVATAKTALSAQKVQATMMSV
VAEKTGYPTEMLELEMDMEADLGIDSIKRVEILGTVQDELPGLPELNPEDLAECRTLGEIVSYMNSKLAD
GSKLSTNAAAGASSEDAAPQVATAKTALSAQKVQATMMSVVAEKTGYPTEMLELSMDMEADLGIDSIKRV
EILGTVQDELPGLPELNPEDLAECRTLGEIVSYMNSKLADGSKLSTNDAAGASSEDAAPQVATAKTALSA
QKVQATMMSVVAEKTGYPTEMLELSMDMEADLGIDSIKRVEILGTVQDELPGLPELNPEDLAECRTLGEI
VSYMNSKLATFEAAAPAATQVANGLSAEQVQGTMMSVVAEKTGYPTEMLELSMDMEADLGIDSIKRVEIL
GTVQDELPGLPELNPEDLAECRTLGEIVAYMNSKLTSVGSAATAVIADAVKSVAETVTSSLELPPHSEVA
LKKLSAADQIVDCFAADAAVVITDDGHNAGVLAEKLSKKALKVAVVRLPKGAAQSPLNSDVASFQAESLD
EAGINAVIAQIEQQLGEISGFIHLQPEADSNNVNDAINLSSESFTHVSQAFLWAKLLQPKLNVTSDKRRS
FISVSRIDGGFGYLDTKQLQNAELNQAALAGLTKTLSHEWPTVFCRALDIAPNLDATHLADAITGELFDN
VTNLPEVGIASDTNGNIERSTLVAGNARSKHATAQLNSADKILVTGGAKGVTFECALALAKRTQSHFILA
GRSELQAIPAWAADKQISELKPAAISHIVSTGSKPTPKQVEALVWTVKSSIEINTALAAFSEVGASAEYV
SMDVTDTAAITAALNGRSAEITGLIHGAGVLADKHIQDKTIAELGRVYGTKVNGLKALLAALEPSKVKLL
AMFSSAAGFYGNTGQSDYAMSNDILNKAALQFTARHPQAKVMSFNWGPWDGGMVTDALKKMFTERGVYVI
PLKAGAELFATQLLSETGAQLLIGTSMQGGTDTQEAASVKKLNAGEVQNASRPLAPVSLTRVLTPNALVF
IQDHRIGGNPVLPTVCAIQWMREAASEMLGTQVKVIDYKLLKGIVFDSSDAQEMTLELTPSGNEQMTALI
SCHGRPQYKATLARNDNADNTPSREFNSLGKAVTTAAELYSNGTLFHGPRLQGIQQVFKFDDAGLIAQCQ
LPQVSDTDCGQFVASQHLGGSQPFAEDLLLQAMLVWARLKYGSASLPSTIGEFISNKPLAFGDKAVLALE
VVKTSARSLEANVALYHENGELSAMMKAAKVTISKNLNSAFLTETAESDKDKTLSTGEQS

** the following sequences were obtained by running BLAST to identify putative sequence homologs of our ORF by using the BLAST services of the NCBI. Blastp approach was used (ORF protein sequence against protein database). using the blast results we created two groups: the study group (which contains up to 20 sequences, that represents homologs belonging to the same taxonomic group as our ORF) and the external group ( which contains around 5 sequences, that represent the closest homologs not belonging to the study group that will serve to root the phylogenetic tree).