IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Homolog hunting: BLAST"

Thread subject: BLAST!

[ Return to forums ]
BLAST!
Rabail
28 Apr 2011 15:17
Non evaluated contribution
Comments:
25 best hits have been selected over ncbi protein Blast that presented a good coverage and a closer to 0 e-value.Their identities range from 32% to a highest of 38%.The hits had a matching description of the conserved domains being arginyl-tRNA synthetase and arginine--tRNA ligase indicating that the proteins belong to a common superfamily.

The sequences are:

>gi|257066823|ref|YP_003153079.1| arginyl-tRNA synthetase [Anaerococcus prevotii DSM 20548]
MTDFKEIIAKQLEKMDLGLSFEEIYKLIEIPPQDNMGDYSFPCFSLAKTLRKNPAIIAEDLAKGFDLDGF
EKIENLNAYLNFYVDRKVFEEEILKEILEKKEKYGSSDKGNGKNIVIDFSSVNIAKPFHIGHIRSTVIGD
ALRNIHDFLGYNTIASNYIGDYGTQFGTMIAAYKLWGDEEKLKENPIKELLALYVRYNSEAANDEKMMDE
ARAEFMNLENGEEEATRLWKHFKEISFNEFDRVYKMLDIDFDNYNGESYHSEFIPDVLEELKEKNLLVES
DGAYIVDLSEFDLPPAIIIKSNGSSAYITRDIATAINRKKVYDFDKNLYVVATQQNLHFQQLFAILKLMG
YDFYDDCKHIPFGMVSLKDQTLSTRKGQVVFLEDVLNKAIDKTKEIMENRDSKIENVGEVAEIVGIGAVK
FQELYNNRIKDYVFDWDEVLNFDGETGPYVQYTYARAKSVLRKADFKENTEISFDNITSDEEFALVKALG
NFKDVVAKAAEKYEPSLITRHLTEIAKNFNKFYNACQINVEDEKIKEERLALSYATSIVIKTGLGLLGIK
TVEQM

>gi|168214506|ref|ZP_02640131.1| arginyl-tRNA synthetase [Clostridium perfringens CPE str. F4969]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGPYLNFFVDKVAFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDQEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDTVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFEGETGPYVQYSYARAKSILRKAEEQNITAEPDFTKLTSKEEFELAKTLDG
LQKAVVLGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|227501367|ref|ZP_03931416.1| arginine--tRNA ligase [Anaerococcus tetradius ATCC 35098]
MTDFKENIAKELEKKDIGLTFDEIYKLIEIPPQDNMGDYSFPCFSLARTMRKNPAIIAEELASSLDLKAF
EKIENLNAYVNFYVDRKMFEEETLNEIIEKKEKYASSDIGKGKNIVVEFSSVNIAKPFHIGHIRSTVIGD
ALRNIHKFLGYNTIASNYIGDYGTQFGTMIKAYKLWGDDDKLRKSPIKELLNLYVRYNTEAENDEKMKED
ARLEFKNLEDGQEEAVRLWSWFKEISFKEFDRVYKMLDIDFDNYNGEAYHSEFIPKVIEELKEKDLLVES
DGALIVDLSEFDLPPSIVIKSNGSSAYITRDIATAINRKKVYDFDKNLYVVATQQNLHFDQLFAILKLMG
YDFYKDCKHVSFGMVSLKDQTLSTRKGQVVFLEDVLNKAIEKTKEVMESRHTEIEDIEETAKIVGIGAVK
FQELYNNRIKDYVFDWDEVLNFDGETGPYIQYTYARAKSVLRKAGFEKAEKMNFTKITSDEEFALVKSLA
NFKDIVIKACEKYEPSLITRHLTEIAKNFNKFYNTCQVNVEDKEVKEERLALTYASSLVIKIGLGLLGIK
TVEKM

>gi|110798607|ref|YP_696348.1| arginyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGSYLNFFVDKVAFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDQEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDTVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFDGETGPYVQYSYARAKSILRKAEEQNITAEPDFTKLTSKEEFELAKTLEG
LQKAVILGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|168211451|ref|ZP_02637076.1| arginyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGPYLNFFVDKVVFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDAEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDTVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFDGETGPYVQYSYARAKSILRKAEEQNITAEPDFTKLTSKEEFELAKTLEG
LQKAVILGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|168207505|ref|ZP_02633510.1| arginyl-tRNA synthetase [Clostridium perfringens E str. JGS1987]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGPYLNFFVDKVAFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDQEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDTVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFDGETGPYVQYSYARAKSILRKAEEQNITAEPDFTKLTSKEEFELAKTLEG
LQKAVILGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|169342733|ref|ZP_02863774.1| arginyl-tRNA synthetase [Clostridium perfringens C str. JGS1495]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGPYLNFFVDKVAFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDQEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDTVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFDGETGPYIQYSYARAKSILRKAEEQNITAEPDFTKLTSKEEFELAKTLEG
LQKAVILGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|18310643|ref|NP_562577.1| arginyl-tRNA synthetase [Clostridium perfringens str. 13]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGPYLNFFVDKVAFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDQEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDKVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFDGETGPYVQYSYARAKSILRKAEEQKITAEPDFTKLTSKEEFELAKTLEG
LQKAVILGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|110803183|ref|YP_698948.1| arginyl-tRNA synthetase [Clostridium perfringens SM101]
MDYKKLVAERIKEHVDLELENIEKLIEIPPKPEMGDFAFPCFQLAKVMRKAPNMIAAELAEKINKEGFER
VECLGPYLNFFVDKVAFSKNIISKVLEEGDKYGSSKIGEGKNVVVEYSSPNIAKPFHVGHLFTTAIGHSL
YRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEEAPINELLRIYVKFHDEAENNPELEDEGR
MYFKKLEDGDQEAVALWERFKDLSLKEFNKIYDMLGVDFDSWAGESFYNDKMDKVVEELEKANILTESNG
AKVVMLDEYNMPPCIVVKSDGASIYATRDLAAASYRHKTYNFDKCIYVVGKDQILHFNQVFKTLELAGNE
WAKNCVHIPFGLVKFADRKLSTRKGNVVLLEDLLNEAIDKTRETIEEKNPQLENKEEVAKKIGIGAILFT
YLKNSRERDIVFDWKEMLSFDGETGPYVQYSYARAKSILRKAEEQEITAEPDFTKLTSKEEFELAKTLEG
LQKAVILGIDKLEPSVVTRYSIEVAKAFNKFYNNHTVLNVEDEGLKAARLELIKATAQVIKNALFLIGID
VVEKM

>gi|325479660|gb|EGC82752.1| arginine--tRNA ligase [Anaerococcus prevotii ACS-065-V-Col13]
MTDFKEIIAKEIENKDIGLSFEEIYKLIEIPPQDNMGDFSFPCFTLAKTMRKNPAIIAKDLAETLEIEGI
SKVESLNAYLNFFLDRDKFETGILNEILEKKEDYGKSNIGEGKTRVLDFSSVNIAKPFHIGHIRSTVIGD
ALRNIQEFLGYETVASNYIGDYGTQFGTMIAAYKLWGDDDKLRENPIKELLNLYVRYNDEASKDEKMMEN
ARKEFKNLESGEEEAVRLWSWFKEISFSEFDRVYKLLDIDFDNYNGESYHSEFIPAVIEELKEKNLLVES
EGAYIIDLSDYDLPPSIIIKSNGSSAYITRDIATAINRKKVYDFDENLYVVATQQNLHFQQLKAILEKMG
YDFYKDCIHIPFGMVSLKDQTLSTRKGQVVFLEDVLNKAIDKTREIMEDRDSQIEDVEETSRIVGIGAVK
FQELYNNRIKDYVFDWDEVLNFDGETGPYVQYTYARAKSVLRKADFSETKTKDFTKISSDEEFALVKSLA
NFKDVVIKACEKYEPSLITRHTTEIAKNFNKFYNACQINVDDERLKEERLALTYATSIVIKTALGLLGIK
TVEQM

>gi|120437133|ref|YP_862819.1| arginyl-tRNA synthetase [Gramella forsetii KT0803]
MSAVYNTMPLEIFYFIFAHLNYWKYAKKHRKMNIEQILASKVNEAVKKHYEVEPENIEFQPTRKDFEGDI
TLVVFPMLKQLRTSPAQLAEKIGKYLEDEVEEVASFNVIQGFLNIVISDQYYINFFNDVKDREDFGILLP
QSDASGIMVEYSSPNTNKPLHLGHIRNNLLGYSVSEILKAAGNEVYKVQVINDRGIHICKSMVAWQKFGN
EETPQSTGLKGDKLVGNYYVKFDQEYKKEIAQLKEEGKSEEEAKAQAPIFVEAQEMLRKWEANDLEVVKL
WSTMNQWVYDGFEKTYDALGVDFDKNYYESETYILGKDNIQKGLEDGVFYKKDDGSVWIDLSDEGLDEKI
VLRSDGTAVYMTQDIGTAIQRFADFDINQMVYTVGNEQEYHFKVLFLILKKLGYDWADALYHLSYGMVDL
PSGKMKSREGTVVDADDLIREMAETAKNISEELGKLDGYSETEKEELYRIIGLGALKYYILKVDPKKRIL
FNPEESVDFQGNTGPFIQYTYARIQSILRKAEFDTSAELSKEFSFHEKEKELIKQVQLFPETIALAAENH
SPALIANYTYELVKSFNSFYQNVQILGIDDEAEKVFRVQLSGLVANVIKSGFKLLGIEVPERM

>gi|220931665|ref|YP_002508573.1| arginyl-tRNA synthetase [Halothermothrix orenii H 168]
MIDFKEKLVDLISQEINDLNVEEIEHLIEIPPQPEMGDYALPCFKFAGIFKKAPNIIAEEIASKIEGNSY
FSKVVNTGPYVNFFINKEIFAETVLEEILQKGKYYGARNIGKGKNVIVEFSSPNIAKPFHIGHIRTTVIG
HALRNIYNFLGYNAIAINHLGDYGTQFGKLIVALNKWGDKDKIKSNPIPEFLKLYIKFHEEAEKNPELEE
KARSWFNRLENKDEEAMDLWKWIRNMSLKEFKRVYDMLGIDFDSYAGESFYSDMMPDVIEEMEEKGLLQE
SQGAKIVDLEEYNMPPAMIEKSDGSTLYITRDIAAAIYRKKTYNFYKNIYVVGSQQKLHFDQWFKIIELM
GHEWARDCIHVPFGMVSLEDGTMSTRKGRVVFLEDVLNKAIEKTKETIEDKNPDLENKEEVAKIVGIGAV
IFQELYNSRIKDYVFSWDRTLSFEGETGPYVQYTYVRTKSVLNKSNYKFKKLDDYSLLTDEDAFNVIKLI
SQFPDTIIKASERYEPSIITRHITELAKAFNKYYHDNQILVDDQKVREARLFLVYAVNTVLKTGLSLLGI
KTPEKM

>gi|307244036|ref|ZP_07526155.1| arginine--tRNA ligase [Peptostreptococcus stomatis DSM 17678]
MTIDKYIGGRLMADFKKLISEIIKSEIEDLTLEEITALIEVPPNKEMGDYAFPCFKLAKIFRKAPNAIAE
DLAGKIQPTDDINKIVNLGGYVNFFVNKESLAKKVINQVLSEKENYGKSEFGKGKTVVVEFSSPNIAKPF
HIGHVRTTVIGNALSKIYQSQGYHVEKLNHLGDYGTQFGKLIVAYKLWGDKQAVEKDPIKELLKLYIRFH
DEAEAKPEMEDEAREWFTKLENGDQEAKDLWQWFRDESLKEFSRVYDLLDIDFDSYVGESFYSDKMPAVI
EELKEKNLLVESDGAMIVDLEDSKLPPALIQKRDGSTLYLTRDLASAFYRKKIYNFDKSIYVVGAQQELH
FKQCFEIIKRMGYDWYKDMVHVQFGMVALEEGTMSTRKGRVVFLEDVLNQAIDRTRQIIEEKNPDAENIY
EVAKAVGVGAVVFQELSNSRIKDYTFSWDRTLSFEGETGPYVQYTHARCCAVLRKADQPISADINYEALS
DQDAADVLSVLETFNKSIMTAMKKNEPHIVTRFVLDLAQAFNKFYHNSPILVEDDDLRAARLALVEATRQ
TIENALKILGMKAPQKM

>gi|325849255|ref|ZP_08170691.1| arginine--tRNA ligase [Anaerococcus hydrogenalis ACS-025-V-Sch4]
MEDLKGLIAKKLEEKELGLDFQEIYDLIEIPPQDDMGDFSFPCFILAKKLRKNPAIIAKELKEDLEKEDS
PYFSKVDSLNAYLNFYIDRKYLQGQVLREIIKEKENYGRSDMGKGKNIVLDFSSVNIAKPFHIGHIRSTV
IGDAIRNIHDFLGYNTIASNYIGDYGTQFGIMIAAYKLWGDDDKLNQNPIKELLNLYVRYNEQASSDQDM
MNEARDEFRRLEEGEEEAVRLWSWFKEISFKEFDRVYKLLDINFDNYHGEAYQSKYIPDVLDQLKEKNLL
TESDGAQIIDLSKYDLPPAIIIKSNGSSAYITRDIATAINRKKTYDFSENLYVVATQQNLHFQQLWAILE
LMGYDFYKDCKHIPFGMVSLKDQTLSTRKGQVVFLEDVLNKAIDKTKEIMKDRDSALENLDETAQIVGIG
AVKFQELYNNRIKDYVFDWDNLLNFEGETGPYVQYSYARAKSVLKKGQIDNFDKVEFDLLNTDEEFNLIK
SLAEFKESIVRAKEKYEPSIISRKVMDIAKNFNKFYNTSKIMVDDEKLKEQRLALAYATSIVIKNGLKLL
GIKTVDQM

>gi|153954173|ref|YP_001394938.1| arginyl-tRNA synthetase [Clostridium kluyveri DSM 555]
MDFKKLAAEEIKKNIDLELNFIEGLIEVPPKPEMGDYAFPCFQLAKVLKKAPNIISKELKDKLHSKYFEK
IENLGPYVNFFVDKKIFTEYTLKEILLKGDSYGSSDMGEGKNVVVEYSSPNIAKPFHVGHLFSTSIGNAL
YKMINFQGYNCTRINHLGDWGTQFGKLIAAYNRWCNAEELNRDPIKELLRIYVKFHEEAEKDPSLNEEGR
MYFKKLEDGSEEEIKLWKKFKDLSLREFKKVYDLLKVDFDSYAGESFYTDKMDAVVEEIDKKGLLVESNG
AKVVLLDEYNIPPCIVKKSDGTTIYATRDLAAAIYRKKTYDFYKSIYVVGLDQSLHFKQVFTTLKLMGKD
WADSCKHVGFGLVRFANKKLSTRKGDVIFLEELLNKSVERTLEIINEKNPKLENKEEAAKKIGIGAVIFT
YLKNNREKDIVFDWNEMLSFEGETGPYVQYSYARGKSILRKSEEASYDENQIDYSKLGSKEEFELVKILE
NFNKSIINAINRLEPFIVTRYVIDVAKAFNKFYNAHSIMNAADENIKKARLYLVKCTCQVLKNGLNLMGI
EVVEKM

>gi|212550359|ref|YP_002308676.1| arginyl-tRNA synthetase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
MNIQELIQKDLKRLYAREIPESSIQLQKTKKEFEGNLTLIIFPLLKISKKDIEQTAMEIGEYLLKNQSII
IGYNAIKGFLNLTLSSTYWINSLNTIHRTKNYGMKKITNNSPLIMIEYSSPNTNKPLHLGHIRNILLGYS
ISEILKATGNQIVKTNIVNDRGIHICKSMLAWKKWGNGETPNSSGKKGDHLIGEYYVKFNQEYKKEILTM
EASGLTPKEAEEKSLLMFEAREMLRKWETGDPETIHLWKITNNWVHIGFKETYKTLGVDFDKIYYESQTY
LEGKKKILEGFEKGIFYKKEDGSIWANLASNGLGEKLLLRSDGTSVYITQDIGTAKLRFDDYSINKMIYI
AGNEQNYHFQALSLLLDKLGFEFSKNLIHFSYGMVELPEGKMKSREGTVVDADDLIEEMIQTAKEISNKL
GKLGKCTDKETNEVYKIISMGALKYFILKVDPRKNMTFNPKESIDFNGNTGPFIQYTYARIKSILKKSNI
KIQCIKSISTNIFLNEKEKNIIQLLSDFPTIVQEAADNFDPSIIANYTFCIAKEYNQFYHNYSILKEENE
DIQKFRLILSYNTSKIIKMSFKLLGINVPERM

>gi|300776117|ref|ZP_07085976.1| arginine--tRNA ligase [Chryseobacterium gleum ATCC 35910]
MNIKDIIEQKLSEVILNVYQLKDIKLEVQENKTEFEGDFTIVTFPLVKQLKKNPESIGVELGEALTEQTE
LFESFNVVKGFLNVKVKNQLFVDNFRSVSENFSTIEKKNATVMVEYSSPNTNKPLHLGHIRNNLLGFSVA
QILKEAGYDVIKTQIINDRGIHICKSMLAWEKFGNGETPETANTKGDKFVGNYYVEFDKNYKKEIAELVE
QGVGEEQAKKEAPVMKEAQKMLLDWENGDEKVRALWAEMNSWVYKGFNETYKRLGVDFDQVQYESNTYIL
GKDLIQEGLDKGVLYQKEDGSVWCDLTDEGLDQKLLLRSDGTSVYMTQDLGTAVERFKQNDIQKLIYTVG
NEQDYHFQVLFKILKKLGYEWADQLYHLSYGMVELPEGKMKSREGTVVDADDLMQEMYETAKSKAQELGK
LETLSEEEKEASYETVGLGALKYFMLKVDPKKKMLFNPAESIDFNGNTGPFIQYTYARIQSLLSKAGALQ
AETAEIELNQSEKELIMQLANFKTVVAKSAETLSPALVANYVYDLVKTYNSFYQNNPILNQEDEKIKQFR
LNISDITAKTIKKSLELLGIGTVNRM

>gi|28210674|ref|NP_781618.1| arginyl-tRNA synthetase [Clostridium tetani E88]
MNYKELISERLSSIIELPIEDIEKLIEIPPKPEMGDFAFPCFQLAKTFRKAPNMIAEELKDKFDKSNFEK
VENLGPYLNFFVDKSIFSKNVIEKILEEKDKYGASNEGKGRKALIEYSSPNIAKPFHVGHLFSTAIGNAL
YKIFTFEGYDCERLNHLGDWGTQFGKLIAAYKRWVDEEALEKEPIKELLRIYVKFHDEAEKDPALEEEGR
LHFKRLEDGEEEEVKLWKKFRELSLKEFEKVYHMLNVEFDSYAGESFYGDKMDAVVEEIDEKGLLVESNG
AKVVMLEDYNMPPCIIKKSDGATIYATRDLATAIYRKKTYDFYKSIYVVGLEQSLHFKQVFTTLKLMGHD
WADDCTHIGFGLVRFTDRKLSTRKGEVIFLEDLLKESVDKTLEIINEKNSELENKEETAKKIGIGAVIFT
YLKNNRERDIVFSWDEMLSFDGETGPYVQYSYARGKSILRKSGEIQGDVDYSKLNSKEEFELVKTLEGFN
KSILQAIEKLEPSIVTRYVIEVAKAFNKFYNHNSILNAEDEEIKKARIKLVESTCQVIKNALNLLGIEVV
EKM

>gi|255654755|ref|ZP_05400164.1| arginyl-tRNA synthetase [Clostridium difficile QCD-23m63]
MQDFKVAISNCLKEKIEDLSKEEIEALIEVPPNKDMGDYAFPCFKLAKVFRKAPNMIASELAESIEPSGE
ITKVIQLGGYVNFFVNKSQLAETVIKKVLDEKENYGHSDFGKDKTVIVEYSSPNIAKPFHIGHIRTTVIG
NALYKIYDSQGYKTIRINHLGDYGTQFGKLIVAFKKWGEKEVVESNPIPELLKLYVRFHDEAEQHPEMED
EARAWFAKLENGDEEAKELWQWFRDESLKEFNRVYKLLDIEFDSLAGESFYSDKMNRVIELLEEKHLLKE
SKGARIVDLEEYKMPPALITKNDGSTLYMTRDLAAAIYRKETYDFDKCIYVVGSQQNLHFQQWFKVIELM
GYDWAKDLIHVGFGMVALEEGTMSTRKGRVVFLEDALNQAIDKTKEIILAKNPNAKNVDEISKQVGVGAV
VFQELSNSRIKDYTFSWERTLSFDGETGPYVQYTHARCCAVLRKAEVEVTSDIDYSLLADEDSAEVLRVI
ESFNKNILLALKKNEPHIVTRFMLDLAQAFNKFYHDNPILVENLEIRKARLALVLATKQTLENSLRLLGM
HAPERM

>gi|164687639|ref|ZP_02211667.1| hypothetical protein CLOBAR_01281 [Clostridium bartlettii DSM 16795]
MQDFKIAIANCLKEKIEDLTLEEIVALIEVPPNKEMGDFAFPCFKLAKVFRKAPNMIAADLAENIEAKGA
ISKVMPLGGYVNFFVNKSQLAETVINDVLTKKEKYGHTDLGQDKAVVIDFSSPNIAKPFHIGHIRTTVIG
NALYKIYDSQGYNVVRVNHLGDYGTQFGKLIVAFKLWGSKEAVEANPIPELLKLYVKFHEEAEQKPEMED
EARAWFTKLENGDEEAKALWQWFRDESLKEFARVYDLLDIEFDSYAGESFYSDKMGVVIDQLKEKGLLVQ
SQGTNVVDLEQYNMPPALITKNDGSTLYMTRDLAAAIYRKNTYDFDKCIYVVGSQQSLHFQQLFKVLELM
GYEWSKDLIHVPFGMVALEEGTMSTRKGRVVFLEDVLKQAVEKTKEIVLSKNPNAKNVEQIAKQVGVGAV
VFQELSNSRIKDYTFSWSRTLSFEGETGPYVQYTHARCCAVLRKAEEEVTADINYDLLSEGDGAEVLKVI
GSFNKAILAAMRKNEPHIITRFVLDLAQAFNKFYHDNPILVDDVEVRKARLALVAATRQTIENALALLGM
HAPERM

>gi|126698290|ref|YP_001087187.1| arginyl-tRNA synthetase [Clostridium difficile 630]
MQDFKVAISNCLKEKIEDLSKEEIEALIEVPPNKDMGDYAFPCFKLAKVFRKAPNMIASELAESIEPSGE
ITKVIQLGGYVNFFVNKSQLAETVIKKVLDEKENYGHSDFGKDKTVIVEYSSPNIAKPFHIGHIRTTVIG
NALYKIYDSQGYKTIRINHLGDYGTQFGKLIVAFKKWGEKEVVESNPIPELLKLYVRFHDEAEQHPEMED
EARAWFNKLENGDEEAQELWQWFRNESLKEFNRVYKLLDIEFDSLAGESFYSDKMNRVIELLEEKNLLKE
SKGARIVDLEEYKMPPALITKNDGSTLYMTRDLAAAIYRKETYDFDKCIYVVGSQQNLHFQQWFKVIELM
GYDWAKDLIHVGFGMVALEEGTMSTRKGRVVFLEDALNQAIDKTKEIILAKNPNAKNVDEISKQVGVGAV
VFQELSNSRIKDYTFSWERTLSFDGETGPYVQYTHARCCAVLRKAEVEVTSDIDYSLLADEDSAEVLRVI
ESFNKNILLALKKNEPHIVTRFMLDLAQAFNKFYHDNPILVENLEIRKARLALVLATKQTLENSLKLLGM
HAPERM

>gi|42526483|ref|NP_971581.1| arginyl-tRNA synthetase [Treponema denticola ATCC 35405]
MEDIKTTWQKIIADTLNGIAPETCDKILPEQINIETPPNPEMGDVAFPLFTFAKSFKSSPAKIASDVCAR
LLENEDIKKYGMPKAIGPYLNVFLAKGDLASNVLDKVLKEKENYGKTSSLSGKRIMIEFSSPNTNKPLHL
GHLRNDALGESISRILKFCGADVFKVNIINDRGVHICKSMIAYQKFGEGKTPESENIKSDRFVGDMYVAF
HKYSQENPEKAEAEAKQMLLDWEAGENKELIGLWKKMNGWAIEGIKETYKRTGISFDKLYFESETYLKGK
DQILKGLEAGVFYKEEDGSVWVDLAPIKLDKKVLLRSDGTSLYMTQDIGTAISRHKDWPFNQMIYVVGNE
QEYHFKVLFYVLKQLGFEWADDLYHLSYGMVNLPEGKMKSREGTVVDADDLINSLQDEALKKIEENGREK
EVGDAAVAAENIAVGALHYFLLQVSPKKDMLFNPKESLSFTGNTGPYLQYMGARISSILRKAETAEGKEK
LKDGKLNASLLTNESEWELLKTLEDFPEQVERSALRKDPSALTAYLYELSKAFSRFYRDCPILSGEDADL
SYTRMELARATKIVLQNAMNLVLIPFMEVM

>gi|325473427|gb|EGC76622.1| arginyl-tRNA synthetase [Treponema denticola F0402]
MEDIKTTWQKIIADSLNGIAPETCDKILPEQINIETPPNPEMGDVAFPLFTFAKSFKSSPAKIASDVCAR
LLENEDIKKYGMPKAIGPYLNVFLAKGDLASNVLDKVLKEKENYGKTSSLSGKRIMIEFSSPNTNKPLHL
GHLRNDALGESISRILKFCGADVFKVNIINDRGVHICKSMIAYQKFGEGKTPESENIKSDRFVGDMYVAF
HKYSQENPEKAEAEAKQMLLDWEAGENKELIGLWKKMNGWAIEGIKETYKRTGISFDKLYFESETYLKGK
DQILKGLEAGVFYKEEDGSVWVDLAPIKLDKKVLLRSDGTSLYMTQDIGTAISRHKDWPFNQMIYVVGNE
QEYHFKVLFYVLKQLGFEWADDLYHLSYGMVNLPEGKMKSREGTVVDADDLINSLQDEALKKIEENGREK
EVGDAAVAAENIAVGALHYFLLQVSPKKDMLFNPKESLSFTGNTGPYLQYMGARISSILRKAETAEGKEK
LKNGKLNASLLTNESEWALLKTLEDFPEQVERSALRKDPSALTAYLYELSKAFSRFYRDCPILSGENADL
SYTRMELARATKIVLQNAMNLVLIPFMEIM

>gi|298374553|ref|ZP_06984511.1| arginine--tRNA ligase [Bacteroides sp. 3_1_19]
MVIEQQITGAIIAGIKELYGADVTASQVQLQKTKKEFKGHLTLVVFPFLRMSKKSPEQTAQEIGEYLLRN
EPAVAEFNVIKGFLNLTVACSCWIDLLNSINEQPAYGIIPVTEQSPLVMIEYSSPNTNKPLHLGHVRNNL
LGYSLSKIMKANGNQIVKTNIVNDRGIHICKSMLAWQKWGNGATPESTGKKGDHLIGDFYVLFSNKLKEE
THALEAKGLTKEEAEAQSTLMAEAREMLRKWEAGDKEVRALWEMMNNWVYAGFNETYKMMGVDFDKIYYE
SQTYLEGKGKVMEGLEKGIFYRREDGSVWADLTKDGLDEKLLLRADGTSVYMTQDIGTAKLRFDDYPINK
MIYVVGNEQNYHFQVLSILLDKLGFEFGKGLVHFSYGMVELPEGKMKSREGTVVDADDLMAEMISTAREI
SQELGKLNEMTPEEAENIARIVGLGSLKYFILKVDPRKNMTFNPKESIDFNGNTGPFIQYTYARIRSVLR
KAAEQGITLPEQLPLTFAISEKEENLIQMIADYAEIVKEAGKLYSPACVANYIYDLVKEYNQFYHDFPIL
REENPELKNFRLVLSANVAKIVKSGMDLLGIEVPERM

>gi|300855348|ref|YP_003780332.1| arginyl-tRNA synthetase [Clostridium ljungdahlii DSM 13528]
MDYKEIIAERIKENVDLELDFIKGLIEIPPKPEMGDYAFPCFQLAKTLRKAPNMIAEELKSKLDKEYFEK
IENLGPYLNFFVDKAAFTKDTLEKVLKEGENYGKSELGKGKNVVVEFSSPNIAKPFHVGHLFSTSVGNAL
YKIISSQGYNCTRINHLGDWGTQFGKLISAYKRWCDEDSLHKDPIKELLRIYVKFHEEAEKDPSLDEEGR
MYFKKLEDGCEEEVALWKKFKDLSLREFKKIYDLLNVEFDSYAGESFYSDKMDAVVDEIDKTGILVDSNG
AKVVMLDDYNLPPCIVKKSDGATIYATRDLTAAIYRKKTYDFDKCIYVVGLDQSLYFRQIFATLKLMGKD
WVDSCVHVGFGLVRFADKKLSTRKGDVIFLEDLLNRAIERTLEIINEKNPELENKEEVAKKIGVGAVIFT
YLKNNRERDIVFDWNEMLSFEGETGPYVQYSYARGKSILRKAPAGISENVDYSKLSSKEEFELIKILHGF
NKAVLSAINKLEPFIVTRYVIDAAKAFNKFYNAHSIINAEDEGVKAARIQLVKASCQVIKNGLNLLGIDV
VEKM