IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Multiple sequence alignements"

Thread subject: MSA

[ Return to forums ]
MSA
SAS
28 Apr 2011 8:40
Non evaluated contribution
CLUSTAL 2.1 multiple sequence alignment


gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        MRHIVYRYTYNSITSQIQKFKSTSYRFAQPCNNHFPITTTYMSCKSNTRL 50
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        --------------------------------------------------
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      --------------------------------------------------
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        ESPISLDKTVNGSASYRHRHTYNTRSTINLPDKQPLLSTYRHSLTNEHIV 100
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        --------------------------------------------------
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      --------------------------------------------------
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        EQPRSRDFLSMRYRAPSPSAPETPTLSSKMRSAYSPKPSIYSPIQDHKHP 150
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        --------------------------------------------------
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      --------------------------------------------------
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        HSESTSVRACPAPKSRKESAEKSNNDISFTISRGVLSRVQKKSGRVSVES 200
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        --------------------------------------------------
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      --------------------------------------------------
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        ----------------------------------MTFSGFDSFENNVHVF 16
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        RISRFDLLDSSAEDAGRLRRSTLAACTSDRLFPNIDLDVKQSRRSTLSVY 250
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        --------------------------------------------------
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         ------------------------------MPLCNHINHVRIFPLLLLLT 20
gi|302835189|ref|XP_002949156.      --------------------------------------------------
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        -------------------------------------MLDFISSKTLFLC 13
gi|52843148|ref|YP_096947.1|        -------------------------------------MLDFISSKTLFLC 13
gi|296108634|ref|YP_003620335.      -------------------------------------MLDFISSKMLFLC 13
gi|148361295|ref|YP_001252502.      -------------------------------------MLDFISSKMLFLC 13
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      -------------------------------------MNQIIP---YFIC 10
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        EQQATKCSK-YNPNDADWQQLLQLSTTVRKELSQLLHEPNGVQTLKDSNA 65
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        DTPRLDTVEGARSHLCSERYRKAVGGNKVATPAVVPAPEHSFSPLDGVLK 300
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        ---------------------------------MINVALVYSGKGFLKDL 17
gi|146184601|ref|XP_001029718.      ---------------------------MDDEALVSMIGQQKLKGLFDFFQ 23
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         TMMNAWRCVLHGMMPVGRLHRPAHVGTQVRGLVRRRLVRALHGGGAAHID 70
gi|302835189|ref|XP_002949156.      --------------------------------------------------
gi|255086839|ref|XP_002509386.      --------------------------MPALATAVVALAPRAPRGSRPPRT 24
                                                                                      

gi|54295793|ref|YP_128208.1|        LILFLILFWLCFDKARKELRINRWQKKLNLKHHAQIFHLLYG---DVNGF 60
gi|52843148|ref|YP_096947.1|        LILFLILFWLCFDKARKELRINRWQKKLNLKHHAQIFHLLYG---DVNGF 60
gi|296108634|ref|YP_003620335.      LILFLILFWLCFGKARKELRINRWQKKLNLKHHAQIFHLLYG---DVNGF 60
gi|148361295|ref|YP_001252502.      LILFLILFWLCFGKARKELRINRWQKKLNLKHHAQIFHLLYG---DVNGF 60
gi|307611842|emb|CBX01555.1|        ------------------MRINRWQKKLNLKHHAQIFHLLYG---DVNGF 29
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      SFFVLLAALLHLHHKKKYFQIKRWQNSLQLQEHAQIFHQLYK---TSNGF 57
gi|270158338|ref|ZP_06186995.1      -----------MHHKKKYFQIKRWQNSLQLQEHAQIFHQLYK---TSNGF 36
gi|325192064|emb|CCA26528.1|        LNKIKNLIPVVAKAEIETMKIEDFALTIVYEQPFRVFSQVYHGFGSEYGK 115
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      ---------------------MTARFEVPFSARRIAAR--------AAAA 21
gi|37521220|ref|NP_924597.1|        ----------------MDSPAHAYRFLMSGGNRSMQLRSKVALLGAVAAL 34
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        TKQTPQKHAILKTPSGRMSLENLLTPQVCHAAAVPALLASLYREQEHDDR 350
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        ILRRDEGLLKTFAGFGSNPNFLEDLHGLIDHESKRLYESLFVGLSLAEGK 67
gi|146184601|ref|XP_001029718.      DLMKTKKPSTREQQEVRMPLVSTVKPHDLMNNKIKQKYAIFQRLTHSQKL 73
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         RRQQVSQRRRWWWLACVLGGGVATTTAAAAAVANAEGERPLVANEASLYK 120
gi|302835189|ref|XP_002949156.      ------------MHKDAAAFAENLDAHGEASLMSQVFDALYDDAEEVFMS 38
gi|255086839|ref|XP_002509386.      TKTITSRDGVRCEVSQLAEPPAQLRFSMDADAARAVIEPAFDEDARQRCM 74
                                                                                      

gi|54295793|ref|YP_128208.1|        IISQQARKNR---------------------DAIEYVYGEIEFLPFTALL 89
gi|52843148|ref|YP_096947.1|        MISQQARKNR---------------------DAIEYVYGEIEFLPFTALL 89
gi|296108634|ref|YP_003620335.      MISQQARKNR---------------------DAIEYVYGEIEFLPFTALL 89
gi|148361295|ref|YP_001252502.      MISQQARKNR---------------------DAIEYVYGEIEFLPFTALL 89
gi|307611842|emb|CBX01555.1|        IISQQARKNR---------------------DAIEYVYGEIEFLPFTALL 58
gi|54298958|ref|YP_125327.1|        MISQQARKNR---------------------DAIEYVYGEIEFLPFTALL 29
gi|289163420|ref|YP_003453558.      ILSQTARRKR---------------------DAMEYSYGEIEFFSFIALL 86
gi|270158338|ref|ZP_06186995.1      ILSQTARRKR---------------------DAMEYSYGEIEFFSFIALL 65
gi|325192064|emb|CCA26528.1|        ELSIQAREAANITEASYVGIALLQGYKNTRQFCISQIYGEIDFFPFADVL 165
gi|227827841|ref|YP_002829621.      -----------------------------MSYVPHVPYVPTPEKVVRRML 21
gi|15897476|ref|NP_342081.1|        -----------------------------MSYVPHVPYVPTPEKVVRRML 21
gi|15921717|ref|NP_377386.1|        --------------------------MSKVSYIPHVPYVPTPEKVVRRML 24
gi|296243046|ref|YP_003650533.      -------------------------------MPPYVPYVPSPYPVVREML 19
gi|218884617|ref|YP_002428999.      -------------------------------MY-FVPFVPTPYPVVREML 18
gi|126465775|ref|YP_001040884.      -------------------------------MPYHVPYVPTPIPVARMML 19
gi|153005769|ref|YP_001380094.      ATLAVALAGQARAQLAPPPGAAVE---EAPSRIPDVVYVPTPERVVATML 68
gi|37521220|ref|NP_924597.1|        AALGTASTVSLAQTAAPEAGTQVKTEVKSPKRDPDVVYVPTPQEVVDQML 84
gi|302349255|ref|YP_003816893.      ----------------------------MAFGGPSVPFVPTRPEVLDLVF 22
gi|325181626|emb|CCA16076.1|        DLYKVSSHLAREMTQDSQCSAYVNRLNSNEFVRLLTYGEVSCSSVSETII 400
gi|301122091|ref|XP_002908772.      -MYSITRETVLTETSECAQSQEVKELSLEEFRRLMTYGEVSVESIASTVL 49
gi|298711273|emb|CBJ26518.1|        SLSKAERRRK------------------GLMDDRALIYGEVDFASFATIL 99
gi|146184601|ref|XP_001029718.      SQAREASKKER---------------NSKELNYNSFVYGEISFPSFAHIF 108
Translation                         -MRNYIKRPN---------------------SFPGDAYGEVTEKGVSQML 28
gi|326437882|gb|EGD83452.1|         LLHAIYNDLDADYGIAGFAALSDQEEDDIDESGGHSAYGEILPQGVTAVM 170
gi|302835189|ref|XP_002949156.      KGGYVIPKRE---------------AALVEATGGSPTYGEITGEGVTQFL 73
gi|255086839|ref|XP_002509386.      SGDFTPALSAEDIAAAR--------AMSPGQTEFALTYGELTYEGCTRLG 116
                                                                                    .

gi|54295793|ref|YP_128208.1|        SMVNID------HNTVFYDLGSGTGKAVVACAMVYPVHKSIGIELFPNLH 133
gi|52843148|ref|YP_096947.1|        SMVNID------HNTVFYDLGSGTGKAVVACAMVYPVHKSVGIELFPNLH 133
gi|296108634|ref|YP_003620335.      SMVNID------HNTVFYDLGSGTGKAVVACAMVYPVHKSIGIELFPNLH 133
gi|148361295|ref|YP_001252502.      SMVNID------HNTVFYDLGSGTGKAVVACAMVYPVHKSIGVELFPNLH 133
gi|307611842|emb|CBX01555.1|        SMVNID------HNTIFYDLGSGTGKAVVACAMVYPVHKSIGIELFPNLH 102
gi|54298958|ref|YP_125327.1|        SMANID------HNTVFYDLGSGTGKAVVACAMVYPVHKSIGVELFPNLH 73
gi|289163420|ref|YP_003453558.      SLINPN------ENTVFYDLGSGTGKAVIACGMVFPVQKSIGIELFPELY 130
gi|270158338|ref|ZP_06186995.1      SLINPN------ENTVFYDLGSGTGKAVIACGMVFPVQKSIGIELFPELY 109
gi|325192064|emb|CCA26528.1|        QWVIQQGT-LLENEAVFYDLGSGTGKAVLAASLLYNFNKVIGIEALESLN 214
gi|227827841|ref|YP_002829621.      EIAKVS------QDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERI 65
gi|15897476|ref|NP_342081.1|        EIAKAS------QDDIVYDLGCGDGRIIITAVKDFNVKKAIGVEINDERI 65
gi|15921717|ref|NP_377386.1|        EIANAG------PEDIVYDLGCGDGRIIITAAKDFNVKKAVGIEINDERI 68
gi|296243046|ref|YP_003650533.      KLSNAG------PDDVLYDLGCGDGRILITAVKEFNVKKAVGIEKDLERV 63
gi|218884617|ref|YP_002428999.      KLAGAG------KDDILYDLGCGDGRILVVAVKEFNVKKAVGIERDSERV 62
gi|126465775|ref|YP_001040884.      KLAGAG------PDDIVYDLGCGDGRILIVAVKEFNVKKAVGIDKDPERI 63
gi|153005769|ref|YP_001380094.      DLAKVG------PRDVVYDLGCGDGRIVVEAAKRG-ARKAIGVDIDPERI 111
gi|37521220|ref|NP_924597.1|        TVAKVG------KDDVIYDLGSGDGRIVVTAAKQY-GARGIGIDINPARI 127
gi|302349255|ref|YP_003816893.      QALDLK------EGDVLYDLGCGDGRIVIEAAKRYPIKKAVGVELRDELY 66
gi|325181626|emb|CCA16076.1|        PFLDLR------EDDVFYDLGCGTGKIVVQVAIETACLVSKGIELMKNRV 444
gi|301122091|ref|XP_002908772.      PLFNLD------ADDVFFDLGCGTGKILVQAALQTPCKRAIGIELMQNRV 93
gi|298711273|emb|CBJ26518.1|        REIGALTE-S-KTGEIFYDLGSGTGKALYVARLTQDFTHCVGIEILQPLH 147
gi|146184601|ref|XP_001029718.      TLIKEQYGGLQNEGGIFYDLGSGVGKGVLAASLLHQFDRCTGIELLESLH 158
Translation                         EYFSEYFD---NPDGVFYDLGSGNGKLCVQVAKETNFSKVIGIELHKERH 75
gi|326437882|gb|EGD83452.1|         QAIQPH------PGFVFYDLGSGLGKMAMQVFLQFQAGKACGVELAQTRH 214
gi|302835189|ref|XP_002949156.      RRVPLR------PDDVLVDLGSGLGRLVLQVACSARLRRCVGIELSASRH 117
gi|255086839|ref|XP_002509386.      EILAMG------PDDVFYDLGSGLGRATIQAHLQWGVKRAVGVELSAERS 160
                                                   :. ***.* *:               *::      

gi|54295793|ref|YP_128208.1|        QCACERLQKLAAMEG----------------------------------- 148
gi|52843148|ref|YP_096947.1|        QCACERLQKLAAMEG----------------------------------- 148
gi|296108634|ref|YP_003620335.      QCACERLQKLAAMEG----------------------------------- 148
gi|148361295|ref|YP_001252502.      QCACERLQKLAAMEG----------------------------------- 148
gi|307611842|emb|CBX01555.1|        QCACERLQKLAAMEG----------------------------------- 117
gi|54298958|ref|YP_125327.1|        QCACERLQKLAAMEG----------------------------------- 88
gi|289163420|ref|YP_003453558.      LHSCQQVEQLAAIKQ----------------------------------- 145
gi|270158338|ref|ZP_06186995.1      LHSCQQVEQLAAIKQ----------------------------------- 124
gi|325192064|emb|CCA26528.1|        TFAKKRAAKLKDLAK----------------------------------- 229
gi|227827841|ref|YP_002829621.      REALANIEKNG--------------------------------------- 76
gi|15897476|ref|NP_342081.1|        REALANIEKNG--------------------------------------- 76
gi|15921717|ref|NP_377386.1|        KEALENIKRNG--------------------------------------- 79
gi|296243046|ref|YP_003650533.      KEASLKIKEAN--------------------------------------- 74
gi|218884617|ref|YP_002428999.      KEAVRRINEEG--------------------------------------- 73
gi|126465775|ref|YP_001040884.      REARKNAEKNG--------------------------------------- 74
gi|153005769|ref|YP_001380094.      AEAREKVRAAG--------------------------------------- 122
gi|37521220|ref|NP_924597.1|        VEANENARKAG--------------------------------------- 138
gi|302349255|ref|YP_003816893.      KEASERVKREG--------------------------------------- 77
gi|325181626|emb|CCA16076.1|        LEGKRALQRLNTNCS----------------------------------- 459
gi|301122091|ref|XP_002908772.      QEGQRALNRLKERDI----------------------------------- 108
gi|298711273|emb|CBJ26518.1|        TAAQLVTNRFNAHVKRLL-------------------------------- 165
gi|146184601|ref|XP_001029718.      NMGLQLKNSILEQSEQIVQEVIEID------------------------- 183
Translation                         LKAEKLLKKSD--------------------------------------- 86
gi|326437882|gb|EGD83452.1|         EAAQKALARLTKMLG----------------------------------- 229
gi|302835189|ref|XP_002949156.      EEACWVAAQLAHLNDEHNGRDGHGTGPWITGPSTSDGEVARTFMLRPHGP 167
gi|255086839|ref|XP_002509386.      AQARRAVERLEQNGQ----------------------------------- 175
                                      .                                              

gi|54295793|ref|YP_128208.1|        -----------------------------YTESSKKVSFILGDFLTVD-- 167
gi|52843148|ref|YP_096947.1|        -----------------------------YTESSKKVSFILGDFLTVD-- 167
gi|296108634|ref|YP_003620335.      -----------------------------YTQSSKKISFILGDFLTVD-- 167
gi|148361295|ref|YP_001252502.      -----------------------------YTESSKKISFILGDFLTVD-- 167
gi|307611842|emb|CBX01555.1|        -----------------------------YTESSKKVSFILGDFLTVD-- 136
gi|54298958|ref|YP_125327.1|        -----------------------------YTESSKKISFILGDFLTVD-- 107
gi|289163420|ref|YP_003453558.      -----------------------------YESQAKRIEFRLGDFIEAD-- 164
gi|270158338|ref|ZP_06186995.1      -----------------------------YESQAKRIEFRLGDFIEAD-- 143
gi|325192064|emb|CCA26528.1|        -----------------------------SHCIVSSIEFWHGSFLETD-- 248
gi|227827841|ref|YP_002829621.      --------------------------------VTGRASIVKGNFFEVD-- 92
gi|15897476|ref|NP_342081.1|        --------------------------------VTGRASIVKGNFFEVD-- 92
gi|15921717|ref|NP_377386.1|        --------------------------------VENKAIVIKGNFFEID-- 95
gi|296243046|ref|YP_003650533.      --------------------------------ISDRAFIIHGDFFEVS-- 90
gi|218884617|ref|YP_002428999.      --------------------------------ISDKAIVIQGDFFETD-- 89
gi|126465775|ref|YP_001040884.      --------------------------------VSNRIVLINDDFFNVD-- 90
gi|153005769|ref|YP_001380094.      --------------------------------VGDRVEIREGDLFEMD-- 138
gi|37521220|ref|NP_924597.1|        --------------------------------VTNQVRFLEQDLFETD-- 154
gi|302349255|ref|YP_003816893.      --------------------------------LDGKVEIVHGDFFRVP-- 93
gi|325181626|emb|CCA16076.1|        -----------------------------QYIVGRAIEIVHGDICLPPSI 480
gi|301122091|ref|XP_002908772.      -----------------------------AVLEDKEIEIFRGDIFVPPEE 129
gi|298711273|emb|CBJ26518.1|        -----------------------------DRRCPQNASVFAGSFLEYD-- 184
gi|146184601|ref|XP_001029718.      ---------------------------KYDGFCLPEINFVKDDFLTYD-- 204
Translation                         ---------------------------------VDNVSFIEGSFLNHD-- 101
gi|326437882|gb|EGD83452.1|         -------------------------------TDPVNLQFVHGDIMKAD-- 246
gi|302835189|ref|XP_002949156.      GTAPESSLVAMAEEDWMFQGGSHGGGQRGGGLLLSPVELRCEDLMAAD-- 215
gi|255086839|ref|XP_002509386.      ------------------------------LDHSRRLDLVCANLLEGS-- 193
                                                                          .   .:      

gi|54295793|ref|YP_128208.1|        --LSEATLIFINSSTLFGATWEALNTRLN-SLPQLSTVITTSKTL----- 209
gi|52843148|ref|YP_096947.1|        --LSEATLIFINSSTLFGATWEALNTRLN-SLPQLSTVITTSKTL----- 209
gi|296108634|ref|YP_003620335.      --LSEATLIFINSSTLFGATWEALNTRLN-SLPQLSTVITTSKTL----- 209
gi|148361295|ref|YP_001252502.      --LSEATLIFINSSTLFGATWEALNTRLN-SLPQLSTVITTSKTL----- 209
gi|307611842|emb|CBX01555.1|        --LSEATLIFINSSTLFGATWEALNTRLN-SLPQLSTVITTSKTL----- 178
gi|54298958|ref|YP_125327.1|        --LSEATLIFINSSTLFGATWEALNTRLN-SLPQLSTVITTSKTL----- 149
gi|289163420|ref|YP_003453558.      --LNDATLIFINSTAFFGPTWEKLCFKID-RLPHLNSIITTSKPL----- 206
gi|270158338|ref|ZP_06186995.1      --LNDATLIFINSTAFFGPTWEKLCFKID-RLPHLNSIITTSKPL----- 185
gi|325192064|emb|CCA26528.1|        --WTDGTVVFCHGTCFSDSEWTSISLAAE-KLKQGSYVITASQIL----- 290
gi|227827841|ref|YP_002829621.      --ISEATVVTMF-LLTNVNEMLKPKLEKE-LKPGTRVVSHEFEIR----- 133
gi|15897476|ref|NP_342081.1|        --ISEATVVTMF-LLTNVNEMLKPKLEKE-LKPGTRVVSHEFEIR----- 133
gi|15921717|ref|NP_377386.1|        --LSEATIVTMF-LLTNVNEMLKPKLEKE-LKPGTRVVSHEFEMR----- 136
gi|296243046|ref|YP_003650533.      --IEEATIVTLF-LLTSVNEALKPKFEKE-LRDGARIVSHEFRIP----- 131
gi|218884617|ref|YP_002428999.      --ISEATIVTLF-LLTSVNEVLRPKFDKE-LRDGTRIVSHEFRIP----- 130
gi|126465775|ref|YP_001040884.      --ISEATIVTMF-LLTIVNEALKPKLEKE-LIDGARIVSHEFRIP----- 131
gi|153005769|ref|YP_001380094.      --FSDATVVTLY-LLPDLNLRLRPKLLA--LPPGTRIVSHAFDMG----- 178
gi|37521220|ref|NP_924597.1|        --LSEATVVTLY-LLPDLNVKLRPRLFSQ-LKPGTRVVSHAFDMG----- 195
gi|302349255|ref|YP_003816893.      --IGEATVVYMY-LLTSVNEALKPKLKQE-LKPGTRVVTLDFQIP----- 134
gi|325181626|emb|CCA16076.1|        APITDASVVFINNVMFGPDLMLKILGVLA-KIPNLRRVITLRRIC----- 524
gi|301122091|ref|XP_002908772.      ARLMDATVVFINNVMFGPQLMLKVLQLLK-EMPKLRCVMTLRKIC----- 173
gi|298711273|emb|CBJ26518.1|        --WSDGDCVFANSTCFPEDLMDALARQAE-ELKPGSIVVTFTKGL----- 226
gi|146184601|ref|XP_001029718.      --WSDATLVFAASTCYEPFLMQKLFERSK-LLKRGSFFITLTKKLP---- 247
Translation                         --LSDATIIFASNEAMPR---AVTHAICD-NAPKGCLIILGREPNL---- 141
gi|326437882|gb|EGD83452.1|         --VRDADVVYLASLCFEEPFLTALASRLVGDAPRMSVLISIQPISEAA-- 292
gi|302835189|ref|XP_002949156.      --LADGSVFFLCSTAFSSAACRAIAERLY-CHPRFRVLVTSRALPFPSPL 262
gi|255086839|ref|XP_002509386.      --YREATAVYLCCCCWDSTFVAQALEVLEKRAVNLRQIVTIEPLDRKFG- 240
                                        :.  .                            .            

gi|54295793|ref|YP_128208.1|        -----------SSSRFKLVTRAKIQMSWGVVFAFIHKKEN---------- 238
gi|52843148|ref|YP_096947.1|        -----------SSSRFKLVTRAKIQMSWGVVFAFIHKKEN---------- 238
gi|296108634|ref|YP_003620335.      -----------SSSRFKLVTRAKIQMSWGVVFAFIHKKEN---------- 238
gi|148361295|ref|YP_001252502.      -----------SSSRFKLVTRAKIQMSWGVVFAFIHKKEN---------- 238
gi|307611842|emb|CBX01555.1|        -----------SSSRFKLVTRAKIQMSWGVVFAFIHKKEN---------- 207
gi|54298958|ref|YP_125327.1|        -----------SSSRFKLVTRAKIQMSWGVVFAFIHKKEN---------- 178
gi|289163420|ref|YP_003453558.      -----------SCIHFKLLKHTKVKMSWGVVFAYIHARKNILD------- 238
gi|270158338|ref|ZP_06186995.1      -----------SCIHFKLLKHTKVKMSWGVVFAYIHARKNILD------- 217
gi|325192064|emb|CCA26528.1|        -----------KSALFEVIKSERIKASWGMANIYIHRRRKIGRWASKILR 329
gi|227827841|ref|YP_002829621.      -----------GWNPKEVIKVEDG-NMNHTVYLYVIGEHK---------- 161
gi|15897476|ref|NP_342081.1|        -----------GWNPKEVVKVEDG-NMNHTVYLYVIGEHK---------- 161
gi|15921717|ref|NP_377386.1|        -----------GWVPKEVIKVEDK-GMTHQVYLYVIGEHK---------- 164
gi|296243046|ref|YP_003650533.      -----------GWREERVVDVRDDNGLSHTIYLYVKGKHRF--------- 161
gi|218884617|ref|YP_002428999.      -----------GWKHEKMIEVRDDNGLTHVVYLYIKGRHL---------- 159
gi|126465775|ref|YP_001040884.      -----------GWKPFKVVDVKDNTGLTHTIYLYIKGKHK---------- 160
gi|153005769|ref|YP_001380094.      -----------DWAPQEVRQVDGKTVYFWTVPARPKAQARTAK------- 210
gi|37521220|ref|NP_924597.1|        -----------SWKPDRVLKVKDSTVYYWVIPEKVPENLR---------- 224
gi|302349255|ref|YP_003816893.      -----------GWKP--VKIIGDRGGWQRTLYVYVIGDSDS--------- 162
gi|325181626|emb|CCA16076.1|        -----------ERHRHEKCSRRGDYCVDYVHPPIQADIKVSWADRTSVYC 563
gi|301122091|ref|XP_002908772.      -----------ERHGHEKCSRAGNYCVEYVQPPVEQEIDVSWADKTSI-- 210
gi|298711273|emb|CBJ26518.1|        -----------DSTAFEVLSKRRFEMSWGPATVFIHRRRLDGEPAPGSNR 265
gi|146184601|ref|XP_001029718.      -----------QSDDWQLLISVNHKMSWGETTVHIYRKQKDAMS------ 280
Translation                         -----------KWRTANPDQKFKRSTAIDKTYTSTKGNFYTLKNK----- 175
gi|326437882|gb|EGD83452.1|         ---------SDFHAQFKLETVLNVPMSWGNADVHVYRRPLSMIPEFAM-- 331
gi|302835189|ref|XP_002949156.      TLGMPPVAHFPHRWHMAFTASSRATTVRVVRPSRARREQLSVTSMFTGIV 312
gi|255086839|ref|XP_002509386.      --------LRPAWLTLKQETRVGQTWAPEGYPCYVYEVTR---------- 272
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        GGRASRLDWQPETKAAFPV------------------------------- 348
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        YQRTSTANLPSENRLMRS-------------------------------- 581
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        DGRNHLHRLIAAGEADTISTTSGSNGSNTSVLKSNNSGKFRRGTSIGDTM 315
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      QGTANVTAIDSKEKFSCLDIRFPHGKVDGIKTGASVAVNGTCLTVTRIDG 362
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        --------------------------------------------------
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        PASGSADRAESTLPAASGRDRYENEAVRSAGGTRGAAAEGHTEGRRGTLA 365
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      DTLSFDIMMETLRATNLGGLKTGSVVNFERSARVGDEIGGHNVSGHVHCT 412
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        --------------------------------------------------
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        EGLEEVDGGEDDDVEDEEETEEEETEEEQQGQRGDSEDSSEETGLLFDTE 415
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      ATIAAVEQTENNRRLTFEVSNTGFMKYILPKGYIAVDGCSLTIGEVWDNK 462
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        --------------------------------------------------
gi|52843148|ref|YP_096947.1|        --------------------------------------------------
gi|296108634|ref|YP_003620335.      --------------------------------------------------
gi|148361295|ref|YP_001252502.      --------------------------------------------------
gi|307611842|emb|CBX01555.1|        --------------------------------------------------
gi|54298958|ref|YP_125327.1|        --------------------------------------------------
gi|289163420|ref|YP_003453558.      --------------------------------------------------
gi|270158338|ref|ZP_06186995.1      --------------------------------------------------
gi|325192064|emb|CCA26528.1|        --------------------------------------------------
gi|227827841|ref|YP_002829621.      --------------------------------------------------
gi|15897476|ref|NP_342081.1|        --------------------------------------------------
gi|15921717|ref|NP_377386.1|        --------------------------------------------------
gi|296243046|ref|YP_003650533.      --------------------------------------------------
gi|218884617|ref|YP_002428999.      --------------------------------------------------
gi|126465775|ref|YP_001040884.      --------------------------------------------------
gi|153005769|ref|YP_001380094.      --------------------------------------------------
gi|37521220|ref|NP_924597.1|        --------------------------------------------------
gi|302349255|ref|YP_003816893.      --------------------------------------------------
gi|325181626|emb|CCA16076.1|        --------------------------------------------------
gi|301122091|ref|XP_002908772.      --------------------------------------------------
gi|298711273|emb|CBJ26518.1|        QLQGSKGGEDGGVAPPPVPERLVGFGELLRQAEHAQAQVGALVGALVV-- 463
gi|146184601|ref|XP_001029718.      --------------------------------------------------
Translation                         --------------------------------------------------
gi|326437882|gb|EGD83452.1|         --------------------------------------------------
gi|302835189|ref|XP_002949156.      FTVYLIPETIRVTVFGVKGVGDSVNIEIETQTQAIVDTTERVVAQYLERL 512
gi|255086839|ref|XP_002509386.      --------------------------------------------------
                                                                                      

gi|54295793|ref|YP_128208.1|        ------
gi|52843148|ref|YP_096947.1|        ------
gi|296108634|ref|YP_003620335.      ------
gi|148361295|ref|YP_001252502.      ------
gi|307611842|emb|CBX01555.1|        ------
gi|54298958|ref|YP_125327.1|        ------
gi|289163420|ref|YP_003453558.      ------
gi|270158338|ref|ZP_06186995.1      ------
gi|325192064|emb|CCA26528.1|        ------
gi|227827841|ref|YP_002829621.      ------
gi|15897476|ref|NP_342081.1|        ------
gi|15921717|ref|NP_377386.1|        ------
gi|296243046|ref|YP_003650533.      ------
gi|218884617|ref|YP_002428999.      ------
gi|126465775|ref|YP_001040884.      ------
gi|153005769|ref|YP_001380094.      ------
gi|37521220|ref|NP_924597.1|        ------
gi|302349255|ref|YP_003816893.      ------
gi|325181626|emb|CCA16076.1|        ------
gi|301122091|ref|XP_002908772.      ------
gi|298711273|emb|CBJ26518.1|        ------
gi|146184601|ref|XP_001029718.      ------
Translation                         ------
gi|326437882|gb|EGD83452.1|         ------
gi|302835189|ref|XP_002949156.      KGQQQL 518
gi|255086839|ref|XP_002509386.