IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Homolog hunting: BLAST"

Thread subject: BLAST Results

[ Return to forums ]
BLAST Results
SAS
28 Apr 2011 8:26
Non evaluated contribution
FASTA Sequence :


>gi|326437882|gb|EGD83452.1| hypothetical protein PTSG_04059 [Salpingoeca sp. ATCC 50818]
MPLCNHINHVRIFPLLLLLTTMMNAWRCVLHGMMPVGRLHRPAHVGTQVRGLVRRRLVRALHGGGAAHID
RRQQVSQRRRWWWLACVLGGGVATTTAAAAAVANAEGERPLVANEASLYKLLHAIYNDLDADYGIAGFAA
LSDQEEDDIDESGGHSAYGEILPQGVTAVMQAIQPHPGFVFYDLGSGLGKMAMQVFLQFQAGKACGVELA
QTRHEAAQKALARLTKMLGTDPVNLQFVHGDIMKADVRDADVVYLASLCFEEPFLTALASRLVGDAPRMS
VLISIQPISEAASDFHAQFKLETVLNVPMSWGNADVHVYRRPLSMIPEFAM

>gi|15921717|ref|NP_377386.1| hypothetical protein ST1428 [Sulfolobus tokodaii str. 7]
MSKVSYIPHVPYVPTPEKVVRRMLEIANAGPEDIVYDLGCGDGRIIITAAKDFNVKKAVGIEINDERIKE
ALENIKRNGVENKAIVIKGNFFEIDLSEATIVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEMRGWVP
KEVIKVEDKGMTHQVYLYVIGEHK

>gi|153005769|ref|YP_001380094.1| putative RNA methylase [Anaeromyxobacter sp. Fw109-5]
MTARFEVPFSARRIAARAAAAATLAVALAGQARAQLAPPPGAAVEEAPSRIPDVVYVPTPERVVATMLDL
AKVGPRDVVYDLGCGDGRIVVEAAKRGARKAIGVDIDPERIAEAREKVRAAGVGDRVEIREGDLFEMDFS
DATVVTLYLLPDLNLRLRPKLLALPPGTRIVSHAFDMGDWAPQEVRQVDGKTVYFWTVPARPKAQARTAK

>gi|298711273|emb|CBJ26518.1| conserved unknown protein [Ectocarpus siliculosus]
MINVALVYSGKGFLKDLILRRDEGLLKTFAGFGSNPNFLEDLHGLIDHESKRLYESLFVGLSLAEGKSLS
KAERRRKGLMDDRALIYGEVDFASFATILREIGALTESKTGEIFYDLGSGTGKALYVARLTQDFTHCVGI
EILQPLHTAAQLVTNRFNAHVKRLLDRRCPQNASVFAGSFLEYDWSDGDCVFANSTCFPEDLMDALARQA
EELKPGSIVVTFTKGLDSTAFEVLSKRRFEMSWGPATVFIHRRRLDGEPAPGSNRDGRNHLHRLIAAGEA
DTISTTSGSNGSNTSVLKSNNSGKFRRGTSIGDTMPASGSADRAESTLPAASGRDRYENEAVRSAGGTRG
AAAEGHTEGRRGTLAEGLEEVDGGEDDDVEDEEETEEEETEEEQQGQRGDSEDSSEETGLLFDTEQLQGS
KGGEDGGVAPPPVPERLVGFGELLRQAEHAQAQVGALVGALVV

>gi|37521220|ref|NP_924597.1| hypothetical protein gll1651 [Gloeobacter violaceus PCC 7421]
MDSPAHAYRFLMSGGNRSMQLRSKVALLGAVAALAALGTASTVSLAQTAAPEAGTQVKTEVKSPKRDPDV
VYVPTPQEVVDQMLTVAKVGKDDVIYDLGSGDGRIVVTAAKQYGARGIGIDINPARIVEANENARKAGVT
NQVRFLEQDLFETDLSEATVVTLYLLPDLNVKLRPRLFSQLKPGTRVVSHAFDMGSWKPDRVLKVKDSTV
YYWVIPEKVPENLR

>gi|227827841|ref|YP_002829621.1| ribosomal protein L11 methyltransferase [Sulfolobus islandicus M.14.25]
MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALA
NIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEV
IKVEDGNMNHTVYLYVIGEHK
>gi|298711273|emb|CBJ26518.1| conserved unknown protein [Ectocarpus siliculosus]
MINVALVYSGKGFLKDLILRRDEGLLKTFAGFGSNPNFLEDLHGLIDHESKRLYESLFVGLSLAEGKSLS
KAERRRKGLMDDRALIYGEVDFASFATILREIGALTESKTGEIFYDLGSGTGKALYVARLTQDFTHCVGI
EILQPLHTAAQLVTNRFNAHVKRLLDRRCPQNASVFAGSFLEYDWSDGDCVFANSTCFPEDLMDALARQA
EELKPGSIVVTFTKGLDSTAFEVLSKRRFEMSWGPATVFIHRRRLDGEPAPGSNRDGRNHLHRLIAAGEA
DTISTTSGSNGSNTSVLKSNNSGKFRRGTSIGDTMPASGSADRAESTLPAASGRDRYENEAVRSAGGTRG
AAAEGHTEGRRGTLAEGLEEVDGGEDDDVEDEEETEEEETEEEQQGQRGDSEDSSEETGLLFDTEQLQGS
KGGEDGGVAPPPVPERLVGFGELLRQAEHAQAQVGALVGALVV


>gi|54295793|ref|YP_128208.1| hypothetical protein lpl2883 [Legionella pneumophila str. Lens]
MLDFISSKTLFLCLILFLILFWLCFDKARKELRINRWQKKLNLKHHAQIFHLLYGDVNGFIISQQARKNR
DAIEYVYGEIEFLPFTALLSMVNIDHNTVFYDLGSGTGKAVVACAMVYPVHKSIGIELFPNLHQCACERL
QKLAAMEGYTESSKKVSFILGDFLTVDLSEATLIFINSSTLFGATWEALNTRLNSLPQLSTVITTSKTLS
SSRFKLVTRAKIQMSWGVVFAFIHKKEN

>gi|15897476|ref|NP_342081.1| ribosomal protein L11 methyltransferase, putative [Sulfolobus solfataricus P2]
MSYVPHVPYVPTPEKVVRRMLEIAKASQDDIVYDLGCGDGRIIITAVKDFNVKKAIGVEINDERIREALA
NIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEV
VKVEDGNMNHTVYLYVIGEHK

>gi|325192064|emb|CCA26528.1| conserved hypothetical protein [Albugo laibachii Nc14]
MTFSGFDSFENNVHVFEQQATKCSKYNPNDADWQQLLQLSTTVRKELSQLLHEPNGVQTLKDSNALNKIK
NLIPVVAKAEIETMKIEDFALTIVYEQPFRVFSQVYHGFGSEYGKELSIQAREAANITEASYVGIALLQG
YKNTRQFCISQIYGEIDFFPFADVLQWVIQQGTLLENEAVFYDLGSGTGKAVLAASLLYNFNKVIGIEAL
ESLNTFAKKRAAKLKDLAKSHCIVSSIEFWHGSFLETDWTDGTVVFCHGTCFSDSEWTSISLAAEKLKQG
SYVITASQILKSALFEVIKSERIKASWGMANIYIHRRRKIGRWASKILRGGRASRLDWQPETKAAFPV

>gi|296108634|ref|YP_003620335.1| hypothetical protein lpa_04331 [Legionella pneumophila 2300/99 Alcoy]
MLDFISSKMLFLCLILFLILFWLCFGKARKELRINRWQKKLNLKHHAQIFHLLYGDVNGFMISQQARKNR
DAIEYVYGEIEFLPFTALLSMVNIDHNTVFYDLGSGTGKAVVACAMVYPVHKSIGIELFPNLHQCACERL
QKLAAMEGYTQSSKKISFILGDFLTVDLSEATLIFINSSTLFGATWEALNTRLNSLPQLSTVITTSKTLS
SSRFKLVTRAKIQMSWGVVFAFIHKKEN

>gi|307611842|emb|CBX01555.1| hypothetical protein LPW_32421 [Legionella pneumophila 130b]
MRINRWQKKLNLKHHAQIFHLLYGDVNGFIISQQARKNRDAIEYVYGEIEFLPFTALLSMVNIDHNTIFY
DLGSGTGKAVVACAMVYPVHKSIGIELFPNLHQCACERLQKLAAMEGYTESSKKVSFILGDFLTVDLSEA
TLIFINSSTLFGATWEALNTRLNSLPQLSTVITTSKTLSSSRFKLVTRAKIQMSWGVVFAFIHKKEN

>gi|52843148|ref|YP_096947.1| hypothetical protein lpg2954 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MLDFISSKTLFLCLILFLILFWLCFDKARKELRINRWQKKLNLKHHAQIFHLLYGDVNGFMISQQARKNR
DAIEYVYGEIEFLPFTALLSMVNIDHNTVFYDLGSGTGKAVVACAMVYPVHKSVGIELFPNLHQCACERL
QKLAAMEGYTESSKKVSFILGDFLTVDLSEATLIFINSSTLFGATWEALNTRLNSLPQLSTVITTSKTLS
SSRFKLVTRAKIQMSWGVVFAFIHKKEN

>gi|54298958|ref|YP_125327.1| hypothetical protein lpp3025 [Legionella pneumophila str. Paris]
MISQQARKNRDAIEYVYGEIEFLPFTALLSMANIDHNTVFYDLGSGTGKAVVACAMVYPVHKSIGVELFP
NLHQCACERLQKLAAMEGYTESSKKISFILGDFLTVDLSEATLIFINSSTLFGATWEALNTRLNSLPQLS
TVITTSKTLSSSRFKLVTRAKIQMSWGVVFAFIHKKEN

>gi|148361295|ref|YP_001252502.1| hypothetical protein LPC_3269 [Legionella pneumophila str. Corby]
MLDFISSKMLFLCLILFLILFWLCFGKARKELRINRWQKKLNLKHHAQIFHLLYGDVNGFMISQQARKNR
DAIEYVYGEIEFLPFTALLSMVNIDHNTVFYDLGSGTGKAVVACAMVYPVHKSIGVELFPNLHQCACERL
QKLAAMEGYTESSKKISFILGDFLTVDLSEATLIFINSSTLFGATWEALNTRLNSLPQLSTVITTSKTLS
SSRFKLVTRAKIQMSWGVVFAFIHKKEN

>gi|302835189|ref|XP_002949156.1| hypothetical protein VOLCADRAFT_120730 [Volvox carteri f. nagariensis]
MHKDAAAFAENLDAHGEASLMSQVFDALYDDAEEVFMSKGGYVIPKREAALVEATGGSPTYGEITGEGVT
QFLRRVPLRPDDVLVDLGSGLGRLVLQVACSARLRRCVGIELSASRHEEACWVAAQLAHLNDEHNGRDGH
GTGPWITGPSTSDGEVARTFMLRPHGPGTAPESSLVAMAEEDWMFQGGSHGGGQRGGGLLLSPVELRCED
LMAADLADGSVFFLCSTAFSSAACRAIAERLYCHPRFRVLVTSRALPFPSPLTLGMPPVAHFPHRWHMAF
TASSRATTVRVVRPSRARREQLSVTSMFTGIVQGTANVTAIDSKEKFSCLDIRFPHGKVDGIKTGASVAV
NGTCLTVTRIDGDTLSFDIMMETLRATNLGGLKTGSVVNFERSARVGDEIGGHNVSGHVHCTATIAAVEQ
TENNRRLTFEVSNTGFMKYILPKGYIAVDGCSLTIGEVWDNKFTVYLIPETIRVTVFGVKGVGDSVNIEI
ETQTQAIVDTTERVVAQYLERLKGQQQL

>gi|255086839|ref|XP_002509386.1| predicted protein [Micromonas sp. RCC299]
MPALATAVVALAPRAPRGSRPPRTTKTITSRDGVRCEVSQLAEPPAQLRFSMDADAARAVIEPAFDEDAR
QRCMSGDFTPALSAEDIAAARAMSPGQTEFALTYGELTYEGCTRLGEILAMGPDDVFYDLGSGLGRATIQ
AHLQWGVKRAVGVELSAERSAQARRAVERLEQNGQLDHSRRLDLVCANLLEGSYREATAVYLCCCCWDST
FVAQALEVLEKRAVNLRQIVTIEPLDRKFGLRPAWLTLKQETRVGQTWAPEGYPCYVYEVTR

>gi|325181626|emb|CCA16076.1| histone methyltransferase putative [Albugo laibachii Nc14]
MRHIVYRYTYNSITSQIQKFKSTSYRFAQPCNNHFPITTTYMSCKSNTRLESPISLDKTVNGSASYRHRH
TYNTRSTINLPDKQPLLSTYRHSLTNEHIVEQPRSRDFLSMRYRAPSPSAPETPTLSSKMRSAYSPKPSI
YSPIQDHKHPHSESTSVRACPAPKSRKESAEKSNNDISFTISRGVLSRVQKKSGRVSVESRISRFDLLDS
SAEDAGRLRRSTLAACTSDRLFPNIDLDVKQSRRSTLSVYDTPRLDTVEGARSHLCSERYRKAVGGNKVA
TPAVVPAPEHSFSPLDGVLKTKQTPQKHAILKTPSGRMSLENLLTPQVCHAAAVPALLASLYREQEHDDR
DLYKVSSHLAREMTQDSQCSAYVNRLNSNEFVRLLTYGEVSCSSVSETIIPFLDLREDDVFYDLGCGTGK
IVVQVAIETACLVSKGIELMKNRVLEGKRALQRLNTNCSQYIVGRAIEIVHGDICLPPSIAPITDASVVF
INNVMFGPDLMLKILGVLAKIPNLRRVITLRRICERHRHEKCSRRGDYCVDYVHPPIQADIKVSWADRTS
VYCYQRTSTANLPSENRLMRS

>gi|289163420|ref|YP_003453558.1| Protein containing a histone methylation DOT1 motif [Legionella longbeachae NSW150]
MNQIIPYFICSFFVLLAALLHLHHKKKYFQIKRWQNSLQLQEHAQIFHQLYKTSNGFILSQTARRKRDAM
EYSYGEIEFFSFIALLSLINPNENTVFYDLGSGTGKAVIACGMVFPVQKSIGIELFPELYLHSCQQVEQL
AAIKQYESQAKRIEFRLGDFIEADLNDATLIFINSTAFFGPTWEKLCFKIDRLPHLNSIITTSKPLSCIH
FKLLKHTKVKMSWGVVFAYIHARKNILD

>gi|270158338|ref|ZP_06186995.1| conserved hypothetical protein [Legionella longbeachae D-4968]
MHHKKKYFQIKRWQNSLQLQEHAQIFHQLYKTSNGFILSQTARRKRDAMEYSYGEIEFFSFIALLSLINP
NENTVFYDLGSGTGKAVIACGMVFPVQKSIGIELFPELYLHSCQQVEQLAAIKQYESQAKRIEFRLGDFI
EADLNDATLIFINSTAFFGPTWEKLCFKIDRLPHLNSIITTSKPLSCIHFKLLKHTKVKMSWGVVFAYIH
ARKNILD
>gi|302349255|ref|YP_003816893.1| predicted rRNA methylase family protein [Acidilobus saccharovorans 345-15]
MAFGGPSVPFVPTRPEVLDLVFQALDLKEGDVLYDLGCGDGRIVIEAAKRYPIKKAVGVELRDELYKEAS
ERVKREGLDGKVEIVHGDFFRVPIGEATVVYMYLLTSVNEALKPKLKQELKPGTRVVTLDFQIPGWKPVK
IIGDRGGWQRTLYVYVIGDSDS

>gi|296243046|ref|YP_003650533.1| hypothetical protein Tagg_1320 [Thermosphaera aggregans DSM 11486]
MPPYVPYVPSPYPVVREMLKLSNAGPDDVLYDLGCGDGRILITAVKEFNVKKAVGIEKDLERVKEASLKI
KEANISDRAFIIHGDFFEVSIEEATIVTLFLLTSVNEALKPKFEKELRDGARIVSHEFRIPGWREERVVD
VRDDNGLSHTIYLYVKGKHRF

>gi|218884617|ref|YP_002428999.1| putative RNA methylase [Desulfurococcus kamchatkensis 1221n]
MYFVPFVPTPYPVVREMLKLAGAGKDDILYDLGCGDGRILVVAVKEFNVKKAVGIERDSERVKEAVRRIN
EEGISDKAIVIQGDFFETDISEATIVTLFLLTSVNEVLRPKFDKELRDGTRIVSHEFRIPGWKHEKMIEV
RDDNGLTHVVYLYIKGRHL

>gi|146184601|ref|XP_001029718.2| hypothetical protein TTHERM_01337340 [Tetrahymena thermophila]
MDDEALVSMIGQQKLKGLFDFFQDLMKTKKPSTREQQEVRMPLVSTVKPHDLMNNKIKQKYAIFQRLTHS
QKLSQAREASKKERNSKELNYNSFVYGEISFPSFAHIFTLIKEQYGGLQNEGGIFYDLGSGVGKGVLAAS
LLHQFDRCTGIELLESLHNMGLQLKNSILEQSEQIVQEVIEIDKYDGFCLPEINFVKDDFLTYDWSDATL
VFAASTCYEPFLMQKLFERSKLLKRGSFFITLTKKLPQSDDWQLLISVNHKMSWGETTVHIYRKQKDAMS

>gi|301122091|ref|XP_002908772.1| histone methyltransferase, putative [Phytophthora infestans T30-4]
MYSITRETVLTETSECAQSQEVKELSLEEFRRLMTYGEVSVESIASTVLPLFNLDADDVFFDLGCGTGKI
LVQAALQTPCKRAIGIELMQNRVQEGQRALNRLKERDIAVLEDKEIEIFRGDIFVPPEEARLMDATVVFI
NNVMFGPQLMLKVLQLLKEMPKLRCVMTLRKICERHGHEKCSRAGNYCVEYVQPPVEQEIDVSWADKTSI
YFYESLDFKLKQLTQELAKGGHRPMW