IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Multiple sequence alignements"

Thread subject: clustalw2

[ Return to forums ]
clustalw2
HiraEjaz
28 Apr 2011 8:18
Non evaluated contribution
CLUSTAL 2.1 multiple sequence alignment


gi|88698633|gb|EAQ95758.1|          ---MRKHCQKSRSVLSLSVAAAVASLSAATSTSVFAQ------------- 34
gi|85710286|ref|ZP_01041351.1|      ----MRPLKISGQALLLAAASTMPFTAYAQSTPDGDE------------- 33
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      ------MRTAKLWLLGSAATFLMAGPVLAQSADPQTP------------- 31
gi|94495576|ref|ZP_01302156.1|      --MHRTAVAARRLLAASALSTLIVAPAFAQDAAP---------------- 32
gi|83858794|ref|ZP_00952316.1|      MTEFTKSRGLRALALAGASLSALIAAPAFAQSAEDET------------- 37
gi|289669422|ref|ZP_06490497.1      --------------------------------------------------
gi|289663198|ref|ZP_06484779.1      -MSSRTSQRIRRHRLSSALFGVLAVSAGHAAAQSENG------------- 36
gi|294625102|ref|ZP_06703748.1      -MSSRTSQRIRRHRLSTALFGVLAA--GNAAAQSENG------------- 34
gi|294664562|ref|ZP_06729905.1      -MSSRTSQRIRRHRLSTALFGVLAA--GNAAAQSENG------------- 34
gi|21243469|ref|NP_643051.1|        -MSSRTSQRIRRHRLSTALFGVLAASAGTAAAQSDNG------------- 36
gi|325928875|ref|ZP_08190038.1      -MSSRTSQRTRRHRLSTALFGVLAASAGNAAAQSENG------------- 36
gi|78048450|ref|YP_364625.1|        -MSSRTSQRTRRHRLSTALFGVLAASAGNAAAQSENG------------- 36
gi|325923376|ref|ZP_08185046.1      --------------MSTALFAVLAASAGQAAAQSENG------------- 23
gi|21232003|ref|NP_637920.1|        -MSSRSLHRTRRHRLSAALLAVLVAPAGHALAQSENG------------- 36
gi|66767870|ref|YP_242632.1|        -MSSRSLHRTRRHRLSAALLAVLVAPAGHALAQSENG------------- 36
gi|188990985|ref|YP_001902995.      -MSSRSLHRTRRHRLSAALLAVLVAPAGHALAQSENG------------- 36
gi|325916913|ref|ZP_08179158.1      --------------MSAALLVALVAPAGHVVAQSENG------------- 23
gi|85712231|ref|ZP_01043282.1|      MNEQSLLARSIRTILMAGVSSAFIAAPALAQDAQQDDQDVVVSASGQEVV 50
gi|119468736|ref|ZP_01611788.1      MKHYSLISNSIKCALLT--AAATASSTVLAQDEQ---------------- 32
gi|113968469|ref|YP_732262.1|       MAIESYLTKAVRVALVASTASIMFGASAYAAEDAPG-------------- 36
gi|295690838|ref|YP_003594531.      -MSYRHILFSGAAALACALATASTAQTTAPAPEQ---------------- 33
gi|117921501|ref|YP_870693.1|       -MKKKLLTLAIQASMFGIAPSVAWAADSIEVSAVNESANRVEVE-----V 44
gi|170726613|ref|YP_001760639.      -MNKKLITIAIQTAIMGGALSLAPQVYAADDTEIAKPKLEATAD-----E 44
gi|83858580|ref|ZP_00952102.1|      ----MSYKNLKTWALASSLLAGLGAVSAPALAQEEGA------------- 33
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          -QGEDIQLEEVVVTGSRIAGDPNAIASQPVTSVNAEDIAISGEFNITDVI 83
gi|85710286|ref|ZP_01041351.1|      -AG-DGEENRIVVTGSRIAVDPNIGSPAPVISVDAEALTQAGTPDVVDVL 81
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      -PQEADQVDEIVVTGSRLSSGSVLQAPQPVQVVTAEVIAAKGTVAISDLL 80
gi|94495576|ref|ZP_01302156.1|      ----ADAGDTIVVTGSRIQR-SDYNLANPLVTVTAEALEQAGNIQLVDTL 77
gi|83858794|ref|ZP_00952316.1|      -ADEAQSRDTIVITGSRIQSDGTLEAPSPVVAVGGDDIRTSGQIDITALL 86
gi|289669422|ref|ZP_06490497.1      --------------------------------------------------
gi|289663198|ref|ZP_06484779.1      VAPDTTDLDKVTVTGSRIAR-TGFVAPSPVTAISAEEIRATGATTISDLM 85
gi|294625102|ref|ZP_06703748.1      VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAISAEEIRATGATTISDLM 83
gi|294664562|ref|ZP_06729905.1      VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAISAEEIRATGATTISDLM 83
gi|21243469|ref|NP_643051.1|        VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAISAEEIRATGATTISDLM 85
gi|325928875|ref|ZP_08190038.1      VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAISAEEIRATGATTISDLM 85
gi|78048450|ref|YP_364625.1|        VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAISAEEIRATGATTISDLM 85
gi|325923376|ref|ZP_08185046.1      VAPGTTDLDKVTVTGSRIAR-TGFVTPSPVTAISAEEIRATGATTISDLM 72
gi|21232003|ref|NP_637920.1|        VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAITAEEIRATGATTISDLM 85
gi|66767870|ref|YP_242632.1|        VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAITAEEIRATGATTISDLM 85
gi|188990985|ref|YP_001902995.      VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAITAEEIRATGATTISDLM 85
gi|325916913|ref|ZP_08179158.1      VAPDTTDLDKVTVTGSRIAR-TGFVTPSPVTAITAEEIRATGATTISDLM 72
gi|85712231|ref|ZP_01043282.1|      QSENAQVEERIQVTGSRIGR-IGAEAPSPVTVISGDDLVETGAMNIGEVL 99
gi|119468736|ref|ZP_01611788.1      ---VAKKIERVEVTGSRILR-EGAIAPAPVTVISGDQLVNSGAVNIGEAL 78
gi|113968469|ref|YP_732262.1|       -ANKKEEVERIAVTGSRIIR-EGAIAPTPVTVITGEELLSTGVTNIGEAL 84
gi|295690838|ref|YP_003594531.      ---DAATVEQVVVTGSRIRT-PNLQSNVPVTSISAAQVQNTGIVSVGDIL 79
gi|117921501|ref|YP_870693.1|       ADKQ-ESIEKVTVTGSRIKR-DSFSLSTPLQGLDAKDIADSGIGSLADIL 92
gi|170726613|ref|YP_001760639.      QGKEPEIQEKITVTGSRLRR-DSFSITTPLAVLGRDDIEDTGLGSLAEIL 93
gi|83858580|ref|ZP_00952102.1|      ----DAQQDIIQVTGTRIQR-GNMTEATPVNTFNSEQFELSGAVNTAELL 78
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          NDIPALFSSNTSENSLDGNQGAEVADGTNTLNLRGLGAARTLVLVDGRRH 133
gi|85710286|ref|ZP_01041351.1|      RDIPALSTSTTAEGSIDG--VFAEAVGQSILNLRGLGANRTLVLVNGRRH 129
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      DTLPALISSTSS---------AQANGGAATLNLRSLGGNRTLVLVNGRRH 121
gi|94495576|ref|ZP_01302156.1|      AQNPALINSLNGARTSGSN-ADFGAVGVQLLDLRGLGENRTLVLVNGRRH 126
gi|83858794|ref|ZP_00952316.1|      RESPQLQASLPGTFSAFNG----TPLGASLLNLRNLGTTRTLVIENGRRH 132
gi|289669422|ref|ZP_06490497.1      --------SYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 38
gi|289663198|ref|ZP_06484779.1      ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|294625102|ref|ZP_06703748.1      ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 129
gi|294664562|ref|ZP_06729905.1      ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 129
gi|21243469|ref|NP_643051.1|        ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|325928875|ref|ZP_08190038.1      ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|78048450|ref|YP_364625.1|        ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|325923376|ref|ZP_08185046.1      ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 118
gi|21232003|ref|NP_637920.1|        ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|66767870|ref|YP_242632.1|        ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|188990985|ref|YP_001902995.      ARMPALAPSYTLGNSTR----FIGTAGLGLLDLRGMGVDRTLVLVNGRRH 131
gi|325916913|ref|ZP_08179158.1      ARMPALAPTYTLGNSTR----FIGTAGLGLLDLRGMGTDRTLVLVNGRRH 118
gi|85712231|ref|ZP_01043282.1|      SRLPALATTFTLANSGR----FIGTAGISTLNLRNMGTDRTLVLVNGKRH 145
gi|119468736|ref|ZP_01611788.1      NNLPALGSTYSMANSGR----FIGTAGLNILDLRNMGTDRTLVLVNGKRH 124
gi|113968469|ref|YP_732262.1|       NQLPALGSTYSLANSGR----FIGTSGLNLLDLRNMGTDRTLVLVDGRRH 130
gi|295690838|ref|YP_003594531.      NELPSIRSTFSSSNSTR----FIGTAGLNFLDLRGLGTTRTLVLVNGRRH 125
gi|117921501|ref|YP_870693.1|       VDQIPALSEGVSSTNSQS---SVQNTGLSTIDLRDLGTDRTLTLIDGRRV 139
gi|170726613|ref|YP_001760639.      VEELPQISEGSSNSNSQS---SVQNTGLSTIDLRELGTNRTLTLIDGRRV 140
gi|83858580|ref|ZP_00952102.1|      RTLPAVGVSSLTSTNSN---FTVASSGVNTIELRNLTEDRTLVLMNGRRF 125
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          VAGAAGTQAVDVGSLPMKLIERVEVLTGGASAVYGADAVTGVVNFILKD- 182
gi|85710286|ref|ZP_01041351.1|      VSGVAGEQAVDINSIPTALIERVETLTGGASSIYGADAVTGVVNFVLRD- 178
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      VSGVPGSSAVDIASIPSGLIDRVDVLTGGASAVYGSDAVTGVVNFIIKD- 170
gi|94495576|ref|ZP_01302156.1|      VASLAGSAAVDISTIPNDLVEAVDVLTGGASAIYGADGVSGVVNFRLKR- 175
gi|83858794|ref|ZP_00952316.1|      VAGIEGTSSVDVNTISTALLSRVEVLTGGASAVYGADAVTGVVNFIMRDG 182
gi|289669422|ref|ZP_06490497.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 87
gi|289663198|ref|ZP_06484779.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|294625102|ref|ZP_06703748.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 178
gi|294664562|ref|ZP_06729905.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 178
gi|21243469|ref|NP_643051.1|        VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|325928875|ref|ZP_08190038.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|78048450|ref|YP_364625.1|        VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|325923376|ref|ZP_08185046.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 167
gi|21232003|ref|NP_637920.1|        VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|66767870|ref|YP_242632.1|        VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|188990985|ref|YP_001902995.      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 180
gi|325916913|ref|ZP_08179158.1      VGSSPGSTAVDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKK- 167
gi|85712231|ref|ZP_01043282.1|      VASAPGSSSVDTNTIPSAWIDRVEIITGGASAVYGADAVTGVVNFILKK- 194
gi|119468736|ref|ZP_01611788.1      VSSSAGSQSVDTNTIPSVWIERVEIITGGASAVYGADAVTGVVNFILKD- 173
gi|113968469|ref|YP_732262.1|       VASSSGTSSVDINTIPSTWVEKVEVITGGASAIYGADAVTGVVNFILKK- 179
gi|295690838|ref|YP_003594531.      VSSSEGSNEVDTNTIPTDLIDRIDVVTGGNSAIYGSDAIGGVVNFVLKR- 174
gi|117921501|ref|YP_870693.1|       VSNSYSGNYVSLSTIPAAMVDKVEIITGGASAVYGSDAIAGVVNIITQQ- 188
gi|170726613|ref|YP_001760639.      VSNSYSGNYVSLSTIPSGMVERVEVITGGASAAYGSDAIAGVVNIITQQ- 189
gi|83858580|ref|ZP_00952102.1|      VAGLPGTNNVDFNSIPTELIDRVDVVTGGASAVYGSDALAGVVNVILKD- 174
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          -DYEGFEIDLQTGMSSEADAGQSAISALWGKNFSNG-RGNVAVTLDYRTD 230
gi|85710286|ref|ZP_01041351.1|      -DFEGLQANVQSGISDQGDSWRINGDVTWGVNFDDG-RGNFVISGEYAYG 226
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      -DFEGSQFTMQAGLSGEGDGNEMYGSFLFGTNFGEGDRGNITVSVEGYDR 219
gi|94495576|ref|ZP_01302156.1|      -DFDGFKASGQVGISSRGDAGQRYGSLTYGRNFSDG-RGNIALSYEFREQ 223
gi|83858794|ref|ZP_00952316.1|      ASFDGMEVRTQAGISSESDAEEYFISLANGFESADG-RADIVFAAEYQST 231
gi|289669422|ref|ZP_06490497.1      -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 135
gi|289663198|ref|ZP_06484779.1      -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 228
gi|294625102|ref|ZP_06703748.1      -SFIGFETRAQTGLADEGNYSRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 226
gi|294664562|ref|ZP_06729905.1      -SFTGFETRAQTGLADEGNYSRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 226
gi|21243469|ref|NP_643051.1|        -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 228
gi|325928875|ref|ZP_08190038.1      -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 228
gi|78048450|ref|YP_364625.1|        -SFTGFETRAQTGLADEGNYNRSFASFSVGTDFAGG-RGNIAVSGEYSKQ 228
gi|325923376|ref|ZP_08185046.1      -NFTGFETRAQTGLANEGNYNRSFASFSAGTDFAEG-RGNIAVSGEYSKQ 215
gi|21232003|ref|NP_637920.1|        -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 228
gi|66767870|ref|YP_242632.1|        -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 228
gi|188990985|ref|YP_001902995.      -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGG-RGNIAVSGEYSKQ 228
gi|325916913|ref|ZP_08179158.1      -SFTGFETRAQTGLADEGNYNRSFASFSAGTDFAQG-RGNIAISGEYSKQ 215
gi|85712231|ref|ZP_01043282.1|      -NVEGLDVTATRGYAENSDYSNEKYTFSYGTAFAGG-KGNIAVSAEYNAQ 242
gi|119468736|ref|ZP_01611788.1      -NIEGLDVSLTRGFADLNSYNNKKATFSYGSNFNDD-RGNAAFAVEYSGQ 221
gi|113968469|ref|YP_732262.1|       -HVTGLDVSTTLGTAEDSNFTKKRFSVSYGTDFDNG-RGNIAGAFEYSGQ 227
gi|295690838|ref|YP_003594531.      -NFEGLQLRAQDGISSRGDGNAWFVSGTAGRNFAED-RGNVALSVEYAKQ 222
gi|117921501|ref|YP_870693.1|       -NKTGFEINARGGETTEGGGRETTVDVGYGTDFNGD-KGYIFASATYDKQ 236
gi|170726613|ref|YP_001760639.      -DKEGFSFKARGGESTEGGAKEFTLDLDYGTEFADD-RGYLFFSSTYDKQ 237
gi|83858580|ref|ZP_00952102.1|      -DFEGVVASTQAGISDEGDDETYRASLTMGSMFDQG-RGNAVVSTTWSRE 222
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          EGLKAGERGRDGLLTGTGRDWVNPDLRFQQGDITG-DTPNFQQFFNYQNT 279
gi|85710286|ref|ZP_01041351.1|      EELQFGDRAFS-RNNGIFDDQANPALRFQTGELNATDTPNFIANG----- 270
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      QAVFYGDRDFT-RDNFLADNYPNPDLFFQIGDPIPAGQT----------- 257
gi|94495576|ref|ZP_01302156.1|      DRLSSFNRARTGNPLDTYGIVRNP-------------------------- 247
gi|83858794|ref|ZP_00952316.1|      ESIEAGDRDFGGTGLFS--------------------------------- 248
gi|289669422|ref|ZP_06490497.1      DRFGRGNRAIGREYLVSVPNPAFDSTRPPSESN----------------- 168
gi|289663198|ref|ZP_06484779.1      DRFGRGNRAIGREYLVSVPNPAFDSTRPPSESN----------------- 261
gi|294625102|ref|ZP_06703748.1      DRFGRGNRAIGREYLVSVPNPAFDPTLPPSERN----------------- 259
gi|294664562|ref|ZP_06729905.1      DRFGRGNRAIGREYLVSVPNPAFDPTLPPSERN----------------- 259
gi|21243469|ref|NP_643051.1|        DRFGRGNRAIGREYLVSVPNPAFDPTLPPSERN----------------- 261
gi|325928875|ref|ZP_08190038.1      DRFGRGNRAIGREYLVSVPNPGFDPTRPPSESN----------------- 261
gi|78048450|ref|YP_364625.1|        DRFGRGNRAIGREYLVSVPNPGFDPTRPPSESN----------------- 261
gi|325923376|ref|ZP_08185046.1      DRLGRGNRAIGREYLVSVQNPNFDPTRPPSESN----------------- 248
gi|21232003|ref|NP_637920.1|        DRFGRGNRAIGREYLVTVPNPAYDPTRPPSERN----------------- 261
gi|66767870|ref|YP_242632.1|        DRFGRGNRAIGREYLVTVPNPAYDPTRPPSERN----------------- 261
gi|188990985|ref|YP_001902995.      DRFGRGNRAIGREYLVTVPNPAYDPTRPPSERN----------------- 261
gi|325916913|ref|ZP_08179158.1      DRFGRGNRAIGREYLVSVQNPGFDPSRPPSESN----------------- 248
gi|85712231|ref|ZP_01043282.1|      DSLNALDNPWTATSTASMRYEALYGPRTEDQLDDP--------------- 277
gi|119468736|ref|ZP_01611788.1      DSLNALDHPWTSTSFSSLPNQAQ----TDENKNSA--------------- 252
gi|113968469|ref|YP_732262.1|       NQLKAFDRDQTATSFASITNSNR----PNGDENDP--------------- 258
gi|295690838|ref|YP_003594531.      EDIYFSDRRQFRERGGFVIVDSDPAGSPNGSDG----------------- 255
gi|117921501|ref|YP_870693.1|       HGLFATDRERALYESSFAYDAKQMCNAMNTVDGDQ--------------- 271
gi|170726613|ref|YP_001760639.      YGLSYWDRDRAQQQESWRYNTAEMCNAMYSEDNTSSKGT----------- 276
gi|83858580|ref|ZP_00952102.1|      NGVYARDREGLDRDGLSRAYFDPTVENWQEDVIP---------------- 256
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          GLTDFGLPIPTQEDFIADYQAEFGVAPSITAAEEALFAQAGSAPQRAVEL 329
gi|85710286|ref|ZP_01041351.1|      --SVIGGLIPTSAD---------GFTP--TAAEQALIARSVNAPRRFIAF 307
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      --RALGRTILVGGN------------PRFAGTDPALVARARAARAQTFIN 293
gi|94495576|ref|ZP_01302156.1|      ----------------------------------LDFPDDPNIPDRVPTN 263
gi|83858794|ref|ZP_00952316.1|      ------------------------------LVPNGPATGIDPRFSNVWLP 268
gi|289669422|ref|ZP_06490497.1      -------------------------------------------PQNVLSG 175
gi|289663198|ref|ZP_06484779.1      -------------------------------------------PQNVLSG 268
gi|294625102|ref|ZP_06703748.1      -------------------------------------------PQNVLSG 266
gi|294664562|ref|ZP_06729905.1      -------------------------------------------PQNVLSG 266
gi|21243469|ref|NP_643051.1|        -------------------------------------------PQNVLSG 268
gi|325928875|ref|ZP_08190038.1      -------------------------------------------PQNVLSG 268
gi|78048450|ref|YP_364625.1|        -------------------------------------------PQNVLSG 268
gi|325923376|ref|ZP_08185046.1      -------------------------------------------PQNVLSG 255
gi|21232003|ref|NP_637920.1|        -------------------------------------------PQNVLSG 268
gi|66767870|ref|YP_242632.1|        -------------------------------------------PQNVLSG 268
gi|188990985|ref|YP_001902995.      -------------------------------------------PQNVLSG 268
gi|325916913|ref|ZP_08179158.1      -------------------------------------------PQTVLSG 255
gi|85712231|ref|ZP_01043282.1|      -----------------------------------------AYPDNIVVP 286
gi|119468736|ref|ZP_01611788.1      -----------------------------------------DFPDDILTP 261
gi|113968469|ref|YP_732262.1|       -----------------------------------------AYPDKILTP 267
gi|295690838|ref|YP_003594531.      ------------------------------------------IPDRIFVS 263
gi|117921501|ref|YP_870693.1|       -----------------------------------------CMRDITRDD 280
gi|170726613|ref|YP_001760639.      -----------------------------------------CMRDMTQAD 285
gi|83858580|ref|ZP_00952102.1|      ------------------------------------------YYSSYSER 264
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          GRSFPFTSGYGYI---IPGNPYTFEGFDPDVPIDLDNNGRNDCQDSFTGY 376
gi|85710286|ref|ZP_01041351.1|      DPRFSLSSAGGIV---APGDIGLSDGPD------INGNGTPDCLESAVGF 348
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      RPTFDVSSTSGLIGFDLDGSGFSTPARFFSTTQDLDGDGINDCQESRAGR 343
gi|94495576|ref|ZP_01302156.1|      NLRYADSSLGGAID--------------------VDFDGIPDYTGEGKVY 293
gi|83858794|ref|ZP_00952316.1|      NYRLPISSHYGIIALGDGGASAFVEAVSSGGVPGCDTLGLAGIPTCQIVD 318
gi|289669422|ref|ZP_06490497.1      PGGNHSTSYGGTFNLGTFD------------------FGNPASYGNRYLF 207
gi|289663198|ref|ZP_06484779.1      PGGNHSTSYGGTFNLGTFD------------------FGNPASYGNRYLF 300
gi|294625102|ref|ZP_06703748.1      PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 298
gi|294664562|ref|ZP_06729905.1      PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 298
gi|21243469|ref|NP_643051.1|        PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 300
gi|325928875|ref|ZP_08190038.1      PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 300
gi|78048450|ref|YP_364625.1|        PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYVF 300
gi|325923376|ref|ZP_08185046.1      PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 287
gi|21232003|ref|NP_637920.1|        PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 300
gi|66767870|ref|YP_242632.1|        PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 300
gi|188990985|ref|YP_001902995.      PGGNHSTSYGGTFNLGTFD------------------FRNPASYGNRYLF 300
gi|325916913|ref|ZP_08179158.1      PGGNHSTSYGGTFNLGTFD------------------FRNPATYGNRYLF 287
gi|85712231|ref|ZP_01043282.1|      NAGYYAISNQGTV-------------------------WDPFTGGILGTF 311
gi|119468736|ref|ZP_01611788.1      NAGYYAINDSGVY-------------------------ALEDPTKLINSF 286
gi|113968469|ref|YP_732262.1|       NAGHYRISNAGTF-------------------------NLNG----WKTF 288
gi|295690838|ref|YP_003594531.      DIHSLLLSEGGTFQPSCTAG--------------NPLTCRPDGRARLFRF 299
gi|117921501|ref|YP_870693.1|       WRERSNDIVGGRFKSNS------------------------WWYDGT--- 303
gi|170726613|ref|YP_001760639.      WRNLSDSIAGGVFDEKSSY-----------------KPDSGFWYDEN--- 315
gi|83858580|ref|ZP_00952102.1|      GRILIPGLSAGGTPTNAAN------------------LVFDETTGQVRPF 296
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          NSVFGAASFGVVGGCWNVD-QNGGYAPVQDGRVAGNFQGFGGDSLNTIQQ 425
gi|85710286|ref|ZP_01041351.1|      NSTFNAGAFGLAGGCAVIN-NDGSLSVYQDGLITGLFNQFGGDGIPNNFD 397
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      E----------GYGCYVVDPVTGRVRPFVDGIYAGGINQSGGDGAGQTFN 383
gi|94495576|ref|ZP_01302156.1|      DR--------------------GTLLPSSGGLTQ------GGDSTP-LAG 316
gi|83858794|ref|ZP_00952316.1|      ET--------------------GTLRPYNPGDIFIDGFNASGGDGVFAEP 348
gi|289669422|ref|ZP_06490497.1      ND------------------DGSFRRNRYNG--TVASNTSCVDCDFVDLN 237
gi|289663198|ref|ZP_06484779.1      ND------------------DGSFRRNRYNG--TVASNTSCVDCDFVDLN 330
gi|294625102|ref|ZP_06703748.1      ND------------------DGSFRRNRYNG--TVVSNTSCVDCDFVDLN 328
gi|294664562|ref|ZP_06729905.1      ND------------------DGSFRRNRYNG--TVVSNTSCVDCDFVDLN 328
gi|21243469|ref|NP_643051.1|        ND------------------DGSFRRNRYNG--TVVSNTSCVDCDFVDLN 330
gi|325928875|ref|ZP_08190038.1      ND------------------DGSFRRNRYDG--TVVSNTSCVDCDFVDLN 330
gi|78048450|ref|YP_364625.1|        ND------------------DGSFRRNRYDG--TVVSNTSCVDCDFVDLN 330
gi|325923376|ref|ZP_08185046.1      ND------------------DGSFRRNRYNG--TVVSNTSCVDCDFADLN 317
gi|21232003|ref|NP_637920.1|        NE------------------DGTFRRNRYDG--TVVSNTSCVDCDFADLN 330
gi|66767870|ref|YP_242632.1|        NE------------------DGTFRRNRYDG--TVVSNTSCVDCDFADLN 330
gi|188990985|ref|YP_001902995.      NE------------------DGTFRRNRYDG--TVVSNTSCVDCDFADLN 330
gi|325916913|ref|ZP_08179158.1      ND------------------DGTFRRNRYNG--TVVSNTSCVDCDFADLN 317
gi|85712231|ref|ZP_01043282.1|      NP------------------DGSYR-DTYIGDVNDTARLYCQDCDYINLR 342
gi|119468736|ref|ZP_01611788.1      NP------------------DSSAR-DLYIG--NNADPYSCANCDFFNLG 315
gi|113968469|ref|YP_732262.1|       NP------------------DGSIK-DVYIG--PNSDGGYCADCDYTNLN 317
gi|295690838|ref|YP_003594531.      QQ------------------DGTLREADYGQDFRPLAN-SSAGGDGSTLR 330
gi|117921501|ref|YP_870693.1|       ----------------------------------ELKTDFKEERDGYNGY 319
gi|170726613|ref|YP_001760639.      ----------------------------------GLRDDWHEEKYGRDFN 331
gi|83858580|ref|ZP_00952102.1|      TS----------------------------------ANPDGSALDGFNRQ 312
gi|85713344|ref|ZP_01044360.1|      --------------------------------------------------
                                                                                      

gi|88698633|gb|EAQ95758.1|          ADSYLITPEDKITFNMVGHFDINENMTAFGEFKYGWQENENQVRPQSFWD 475
gi|85710286|ref|ZP_01041351.1|      VNS-LIPETERWSVNANLTYEISNAATFFFEGKYVSNSAEFQAQPNTFYD 446
Translation                         -------------------------MSVYWETKYVYQQFETYQRYHNFTD 25
gi|302382112|ref|YP_003817935.      GTS-LVPDETQIAANVFLNYEVNSAFHPYAELKAVRTTSTTYNPYNTFDD 432
gi|94495576|ref|ZP_01302156.1|      YQGDLQAYNRVHNINLLSHYDFSDAVKFFFEAKYVKNKTKTLAQP-SFDF 365
gi|83858794|ref|ZP_00952316.1|      DDELLLPQTDRFLFQTAFSYELTENVEFFADAKYVFTETIESNQVNGFND 398
gi|289669422|ref|ZP_06490497.1      AVADLQPGFDRKSVNTMINFEISENHRLFFEGKYSETDSEFFGQPAFDSS 287
gi|289663198|ref|ZP_06484779.1      AVADLQPGFDRKSVNTMINFEISENHRLFFEGKYSETDSEFFGQPAFDSS 380
gi|294625102|ref|ZP_06703748.1      AVADLQPGFDRKSVNTMINFEISENHRVFFEGKYSETDSEFFGQPAFDSS 378
gi|294664562|ref|ZP_06729905.1      AVADLQPGFDRKSVNTMINFEISENHRVFFEGKYSETDSEFFGQPAFDSS 378
gi|21243469|ref|NP_643051.1|        AVADLQPGFDRKSVNTMINFEISENHRVFFEGKYSETDSEFFGQPAFDSS 380
gi|325928875|ref|ZP_08190038.1      AVADLQPGFDRKSVNTMINFEISENHRVFFEGKYSETDSEFFGQPAFDSS 380
gi|78048450|ref|YP_364625.1|        AVADLQPGFDRKSVNTMVNFEISENHRVFFEGKYSETDSEFFGQPAFDSS 380
gi|325923376|ref|ZP_08185046.1      AVADLQPGFDRKSVNTMINFEISENHRLFFEGKYSETDSEFFGQPAFDSS 367
gi|21232003|ref|NP_637920.1|        AVADLQPGFDRKSVNTMVNFELSENHRLFFEGKYSETDSEFFGQPAFDSS 380
gi|66767870|ref|YP_242632.1|        AVADLQPGFDRKSVNTMVNFELSENHRLFFEGKYSETDSEFFGQPAFDSS 380
gi|188990985|ref|YP_001902995.      AVADLQPGFDRKSVNTMVNFELSENHRLFFEGKYSETDSEFFGQPAFDSS 380
gi|325916913|ref|ZP_08179158.1      AVADLQPGFDRKSVNTMVNFELSENHRLFFEGKYSETDSEFFGQPAFDSS 367
gi|85712231|ref|ZP_01043282.1|      RYSEVQPEFSRVNYNLKGNYEFTQDVNMYWNAKYVKSEGQNIGQPFFRFF 392
gi|119468736|ref|ZP_01611788.1      QFEEIQPEFERYNVNFKVNYDVTDDLNVYFDAKYVNSQGESIGQPAFFFF 365
gi|113968469|ref|YP_732262.1|       QFVELQPEFDRYNFNVKGNYAISDDMNFYAEGKYVRSKSHDMFQPAFFFF 367
gi|295690838|ref|YP_003594531.      RYGQLQPQTERLAVNLIGHFDVNRAFRPYVEAKYVRNKVFQQSSPSFDQP 380
gi|117921501|ref|YP_870693.1|       TTGLLKVPEDTLAAAVKMNYDLSDDVRANVQVQFSRNNAFRRTDAEGQDY 369
gi|170726613|ref|YP_001760639.      QFVMLKVPDEAISAAIKVDFELTDDIQSYFQVQYSENRSINQKSPESEDE 381
gi|83858580|ref|ZP_00952102.1|      AYRAIAVPTERFTFSSLVNYEVNEKMNFFFEGTYASTETTSSLEPFALAS 362
gi|85713344|ref|ZP_01044360.1|      ----MEFFGEVGFVKDRSVSQIAESGAFFPQVDLSCDNPFLSPQQASVLC 46
                                                                  :                  

gi|88698633|gb|EAQ95758.1|          LLF-----------------------GAPDNPFL-PGFIQPVAQELG--- 498
gi|85710286|ref|ZP_01041351.1|      LLT-----------------------IRADNPFITPDLQQYVAPLFFGD- 472
Translation                         LLY-----------------------GAPDNPYLPAAFSDYLDNGGVSW- 51
gi|302382112|ref|YP_003817935.      SIP-----------------------IQLDNPFIPADIRRYINAEIAADP 459
gi|94495576|ref|ZP_01302156.1|      FTY-----------------------LSPDNAYLQDQFGALA-------- 384
gi|83858794|ref|ZP_00952316.1|      DIP-----------------------ISEDNPFIPAALRAQLATLRAEG- 424
gi|289669422|ref|ZP_06490497.1      LR------------------------VRRQNPYVSPELGALMDS------ 307
gi|289663198|ref|ZP_06484779.1      LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|294625102|ref|ZP_06703748.1      LR------------------------VRRQNPYVSPELGALMDS------ 398
gi|294664562|ref|ZP_06729905.1      LR------------------------VRRQNPYVSPELGALMDS------ 398
gi|21243469|ref|NP_643051.1|        LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|325928875|ref|ZP_08190038.1      LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|78048450|ref|YP_364625.1|        LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|325923376|ref|ZP_08185046.1      LR------------------------VRRQNPYVSPELGALMDS------ 387
gi|21232003|ref|NP_637920.1|        LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|66767870|ref|YP_242632.1|        LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|188990985|ref|YP_001902995.      LR------------------------VRRQNPYVSPELGALMDS------ 400
gi|325916913|ref|ZP_08179158.1      LR------------------------VRRQNPYVSPELGALMDS------ 387
gi|85712231|ref|ZP_01043282.1|      STGAAA-----DNYPY---------LFKRDNPFLPEALASQMDE------ 422
gi|119468736|ref|ZP_01611788.1      DS---------DNS------------IKLDNPYLDPSIKARMQE------ 388
gi|113968469|ref|YP_732262.1|       NP---------VNT------------ISIDNAFIQDDLRDLMTA------ 390
gi|295690838|ref|YP_003594531.      LLLN---------SGD---------QISLDNPFLSAETRAFIAARLP--- 409
gi|117921501|ref|YP_870693.1|       NDAELY-----IDPVTGLPGTIAAGSISPNNPYVPAEIAATAG------- 407
gi|170726613|ref|YP_001760639.      FDGIVV-----IDPVTGESSQIGAGRIPKNNPYMPQEIYDQASS------ 420
gi|83858580|ref|ZP_00952102.1|      DDVFGDNAAQFVDVDGDGVYDRSTNGISILNPYVPLAMRQAARDAADFDG 412
gi|85713344|ref|ZP_01044360.1|      GPG--------------------------GPATVSGDPNVWEG------- 63
                                                                   . :                

gi|88698633|gb|EAQ95758.1|          -----------GVAITIDPIGLGPTQR-VTERETFRFVGGLEGTFSNG-W 535
gi|85710286|ref|ZP_01041351.1|      ------GVEE-GLYLTRDPADLGPNRN-RNEFETYRFVAGFRGDTSDY-F 513
Translation                         ------IYGEGGLMISRDSDDWGDNIS-TNSRSTLRGVFGITGNIGEN-F 93
gi|302382112|ref|YP_003817935.      S-----IAGVAKVLLGRDNIDLFDPRA-EEERSTYRAVIGARGELGWN-L 502
gi|94495576|ref|ZP_01302156.1|      ---------PDGALISRDNFDMGVRGE-ENERETMRFVGGFEGAISDH-A 423
gi|83858794|ref|ZP_00952316.1|      --------IDPVIAISRDVLDTTTRSNPVAERKTMRGVAGFRGFIPQLGF 466
gi|289669422|ref|ZP_06490497.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 348
gi|289663198|ref|ZP_06484779.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 441
gi|294625102|ref|ZP_06703748.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNVTDN-W 439
gi|294664562|ref|ZP_06729905.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNVTDN-W 439
gi|21243469|ref|NP_643051.1|        -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNVTDN-W 441
gi|325928875|ref|ZP_08190038.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNLTDN-W 441
gi|78048450|ref|YP_364625.1|        -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNLTDN-W 441
gi|325923376|ref|ZP_08185046.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 428
gi|21232003|ref|NP_637920.1|        -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 441
gi|66767870|ref|YP_242632.1|        -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 441
gi|188990985|ref|YP_001902995.      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 441
gi|325916913|ref|ZP_08179158.1      -------RGATQILMNRFNVDAGRRGE-NIERKTYRAVLGAEGNFTDN-W 428
gi|85712231|ref|ZP_01043282.1|      -------LGVPFLGLNRMYDDAGRRIE-ENTRETKRAVIGFDGMLNQD-W 463
gi|119468736|ref|ZP_01611788.1      -------EGVDSIMINRMMSDLGRRVE-NNTRETTRFVTGLQGTVFED-W 429
gi|113968469|ref|YP_732262.1|       -------NGKTSLTINRFTTDLGLRLE-DDTRETQRYVVGLEGNLLED-W 431
gi|295690838|ref|YP_003594531.      -------AGATTFRLNRNNLDLGVREE-SIRRETYRAVLGAEGDIGDA-W 450
gi|117921501|ref|YP_870693.1|       ----------KSITWDRRFQEVGPVES-DNERTTLRTWAGLQGNLFET-W 445
gi|170726613|ref|YP_001760639.      ----------KGVKWDRGFDEVGNIIN-DNTRKTIRSWAGLQGTIFDGNW 459
gi|83858580|ref|ZP_00952102.1|      DGIQDVADEDLVVGFVRRMTEVGQRAS-ANTRQTARIVFGLEGDLTDN-W 460
gi|85713344|ref|ZP_01044360.1|      ------------VYIGKRNVEGGPRQN-DIQHLSYRGVFGIRGYLNDT-W 99
                                                                     : *   *  *      

gi|88698633|gb|EAQ95758.1|          TYEVSANYGKFEQTIERSNEVIVDRFLAAIDAVTDPATGEAACRSSVDPN 585
gi|85710286|ref|ZP_01041351.1|      SYEVSANYGKFNQTTLDANRVIMDRFFAAIDVVTGPG-GSPICRSDIDPT 562
Translation                         IYDVSANFGTFERKMIDRDAMIADRFFG---------------------- 121
gi|302382112|ref|YP_003817935.      SYDLSLNYGRTEGEAR-SAVRLEDRYFAAIDAVTAPN-GQVVCRSTLDPT 550
gi|94495576|ref|ZP_01302156.1|      RYELSYTFGQTKSKVLLTDYRIGDRYWAAIDAVRDPATGQIVCRSTLDPT 473
gi|83858794|ref|ZP_00952316.1|      DWEMSYTYGRTDADIT-SRLRLEDRYFAAIDAVIDPSTGDIVCRSDIDPT 515
gi|289669422|ref|ZP_06490497.1      TYEVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 397
gi|289663198|ref|ZP_06484779.1      TYEVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 490
gi|294625102|ref|ZP_06703748.1      TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 488
gi|294664562|ref|ZP_06729905.1      TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 488
gi|21243469|ref|NP_643051.1|        TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GDIVCRTTLDPT 490
gi|325928875|ref|ZP_08190038.1      TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 490
gi|78048450|ref|YP_364625.1|        TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 490
gi|325923376|ref|ZP_08185046.1      TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 477
gi|21232003|ref|NP_637920.1|        TYDVSANYGKTTVDRQNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPN 490
gi|66767870|ref|YP_242632.1|        TYDVSANYGKTTVDRQNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPN 490
gi|188990985|ref|YP_001902995.      TYDVSANYGKTTVDRQNLNNRINERWQAGIDAARDAS-GNIVCRTTLDPT 490
gi|325916913|ref|ZP_08179158.1      TYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDAN-GNIVCRTTLDPN 477
gi|85712231|ref|ZP_01043282.1|      SYDVSLVWGKSDIERVNGANVILQNMEWALDAVEDET-GNIVCRS----- 507
gi|119468736|ref|ZP_01611788.1      ELDTSIVYGKTELERENGANMILANYFNALDAVEDAN-GNIVCRS----- 473
gi|113968469|ref|YP_732262.1|       SYDVFATYGQTDLERVNRNNLVYANYENALDSILVD--GVAVCRD----- 474
gi|295690838|ref|YP_003594531.      RYDVSATYGEFKKRTLSRNNRVEQRYAYALDAVRSPT-GQIVCRVTVDPT 499
gi|117921501|ref|YP_870693.1|       TWDASLGYGKFEQRQRRSNEISIRRLQYALDAEYADDGVTIQCAS----- 490
gi|170726613|ref|YP_001760639.      DWDLSVGYGKFTQEQTRYNELYIANLTHALNAEKLDDG-TIQCAD----- 503
gi|83858580|ref|ZP_00952102.1|      SYEVSANLGRTTQSQRSSGQVNVLNLRQALNATTLNG--EIVCAD----- 503
gi|85713344|ref|ZP_01044360.1|      SYDVSANFGNVTLSSTYLNDFSITNIGRALNVTTDPDTGEAVCTAALS-- 147
                                      :     *               .                        

gi|88698633|gb|EAQ95758.1|          APVVATPFD-IPVFDPGYYSFTPGDGQCVPLNIWAGQPGITDEAVDFVTR 634
gi|85710286|ref|ZP_01041351.1|      AP-ATTPFG-IPAGDPGFFTFNPGDGQCRPANVLGGVGAISQEAIDFITT 610
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      ALPSKGQLGPNPGGTIPFNTFTPGAGSACRPLNLFGLNQASQAALDFIAY 600
gi|94495576|ref|ZP_01302156.1|      GNINPDNYD------APATTFTPGAGSGCQPLNLLGNGSPSQAALDWVNA 517
gi|83858794|ref|ZP_00952316.1|      ANVPPSSPYPAQNAGFQITTFTPGDGQCVPIN-IMGANSISQEAADFIFQ 564
gi|289669422|ref|ZP_06490497.1      SVNPNT--G---------RVYSALARDGCVPFSVFGNGAVTPEAAAWFNT 436
gi|289663198|ref|ZP_06484779.1      SVNPNT--G---------RVYSALARDGCVPFSVFGNGAVTPEAAAWFNT 529
gi|294625102|ref|ZP_06703748.1      AVNPHT--G---------RVYSALAREGCVPFSVFGNGAVTPEAAAWFNT 527
gi|294664562|ref|ZP_06729905.1      AVNPHT--G---------RVYSALAREGCVPFSVFGNGAVTPEAAAWFNT 527
gi|21243469|ref|NP_643051.1|        AVNPHT--G---------RVYSALAREGCVPFSVFGNGAVTPEAAAWFNT 529
gi|325928875|ref|ZP_08190038.1      AVNPNT--G---------RVYSALAREGCVPFSVFGNGAVTPEAAAWFNT 529
gi|78048450|ref|YP_364625.1|        AVNPNT--G---------RVYSALAREGCVPFSVFGNGAVTPEAAAWFNT 529
gi|325923376|ref|ZP_08185046.1      AINPNT--N---------RVYSALAREGCVPFSVFGNGAVTPEAAAWFNT 516
gi|21232003|ref|NP_637920.1|        AINPNT--N---------RVYSALAREGCVPFSVFGNGAVSPEAAAWFNT 529
gi|66767870|ref|YP_242632.1|        AINPNT--N---------RVYSALAREGCVPFSVFGNGAVSPEAAAWFNT 529
gi|188990985|ref|YP_001902995.      AINPNT--N---------RVYSALAREGCVPFSVFGNGAVSPEAAAWFNT 529
gi|325916913|ref|ZP_08179158.1      AINPNT--N---------RVYSALAREGCVPFSIFGNGAVTPEAAAWFNT 516
gi|85712231|ref|ZP_01043282.1|      ---------------------EEARADGCVPFNPFGLGMASQASQDYVTT 536
gi|119468736|ref|ZP_01611788.1      ---------------------AEAQADGCVPVNIMGFGAPSQQAIDYINT 502
gi|113968469|ref|YP_732262.1|       ---------------------EAARAAGCVPVNIFGDGQASQGARDYINT 503
gi|295690838|ref|YP_003594531.      ARVPYAPDL---------ASYVAGDVAACVPLNPFGEGAPSEAAKAYVNT 540
gi|117921501|ref|YP_870693.1|       ---------------------EEARAEGCVPVNIFGEGSISKEGADYIRA 519
gi|170726613|ref|YP_001760639.      ---------------------ADARAAGCVPINLFGEGSITPEAADYIRA 532
gi|83858580|ref|ZP_00952102.1|      ---------------------EIARAQGCVPVNIFGKGSISPEAAAYINA 532
gi|85713344|ref|ZP_01044360.1|      -----------------------GVDPNCVPWNIFAPN-ITQDALDYLTL 173
                                                                                      

gi|88698633|gb|EAQ95758.1|          ATSEGATLEQTVFAAVVTGDS---ADWFELPAGAVSFAAGVEYRKEESET 681
gi|85710286|ref|ZP_01041351.1|      TVVNEFELEQLVFSAIFTGNT---GAFLELPGGPIGFAFGLEYREEESTS 657
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      TAVDLFTIEQTVVTGVLTGDS---APLFSLPGGPIGFVIGGEYRKEKSDF 647
gi|94495576|ref|ZP_01302156.1|      DIMNRAKIQQHVVSGSISGDF---GQFFELPGGPVGFALGAEYRKEKSSF 564
gi|83858794|ref|ZP_00952316.1|      PATAQNEIEQRDFLATLSGTS---EQFFSLPAGPIGFALGYEYRKEESAF 611
gi|289669422|ref|ZP_06490497.1      TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGIAGGVEYRKEQSEE 481
gi|289663198|ref|ZP_06484779.1      TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGIAGGVEYRKEQSEE 574
gi|294625102|ref|ZP_06703748.1      TARSQARIQQTVFSASVAN-----SNLLSLPAGDIGFAGGVEYRKEQSEE 572
gi|294664562|ref|ZP_06729905.1      TARSQARIQQTVFSASVAN-----SNLLSLPAGDIGFAGGVEYRKEQSEE 572
gi|21243469|ref|NP_643051.1|        TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGFAGGVEYRKEQSEE 574
gi|325928875|ref|ZP_08190038.1      TARSQAKIQQTVFSASVAN-----SNMLSLPAGDIGFAGGVEYRKEQSEE 574
gi|78048450|ref|YP_364625.1|        TARSQAKIQQTVFSASVAN-----SSLLSLPAGDIGFAGGVEYRKEQSEE 574
gi|325923376|ref|ZP_08185046.1      TARAQAKIQQTVFSASVAN-----SNLLSLPAGDIGFAGGVEYRKEQSEE 561
gi|21232003|ref|NP_637920.1|        TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGIAGGVEYRKEQSEE 574
gi|66767870|ref|YP_242632.1|        TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGIAGGVEYRKEQSEE 574
gi|188990985|ref|YP_001902995.      TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGIAGGVEYRKEQSEE 574
gi|325916913|ref|ZP_08179158.1      TARSQAKIQQTVFSASVAN-----SNLLSLPAGDIGVAGGVEYRKEQSEE 561
gi|85712231|ref|ZP_01043282.1|      TSVGTSEIEQTVFNATFSN-----SFLYELPAGHIGFAGGVEYRDESSVT 581
gi|119468736|ref|ZP_01611788.1      VSIGDSTIEQTVVSASLAN-----GAIYELPAGYVGIAFGAEYRKEESET 547
gi|113968469|ref|YP_732262.1|       TSTGSSVIKQTVLGGSVTN-----SALFDLPAGAVGFSAGVEYRKEESEV 548
gi|295690838|ref|YP_003594531.      TSRSDGKQTQAVFSGSISGDT---SPWFSLPAGPIGLAAGAEYRRETARE 587
gi|117921501|ref|YP_870693.1|       NPYINTDITQFNALGFISG------ELFELPAGGVQSAFGVEYRRDTQAV 563
gi|170726613|ref|YP_001760639.      TPTISTDVQQTTVLGYIAG------DLFEMPAGPVASAFGFEYRKDEQSV 576
gi|83858580|ref|ZP_00952102.1|      PSSRQAEITQQVYSGFLSGDL---GFASPFAEENVQVVVGAEYRSEESES 579
gi|85713344|ref|ZP_01044360.1|      PLYANGETNLREYTAYVIGNLGDYGIRSPYAVGGVELLLGATTRSEELVF 223
                                                                                      

gi|88698633|gb|EAQ95758.1|          SFDSYALGIIPAGAP-FPEGTQLSDVSDNSN-LLFRPALSNSNEVGDYDV 729
gi|85710286|ref|ZP_01041351.1|      EFDPLVRGVIPVTTPDATEGALLRDLGFSQNSLVFDPASVISNAGGQYDV 707
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      NGDDFVN-----------QGFNFESR-------------ITADVSGEFDV 673
gi|94495576|ref|ZP_01302156.1|      VPDDLLQ-----------QGALADFS-------------LQLPERGSFDV 590
gi|83858794|ref|ZP_00952316.1|      TPDAYSAAG-------LTFGTINSNGG------------PTNASSGLIEV 642
gi|289669422|ref|ZP_06490497.1      VTDPLAASG----------VTFLNAIP--------------NSGG-EYNV 506
gi|289663198|ref|ZP_06484779.1      VTDPLAASG----------VTFLNAIP--------------NSGG-EYNV 599
gi|294625102|ref|ZP_06703748.1      VTDPLAASG----------ATFLNAIP--------------NSGG-DYSV 597
gi|294664562|ref|ZP_06729905.1      VTDPLAASG----------ATFLNAIP--------------NSGG-DYSV 597
gi|21243469|ref|NP_643051.1|        VTDPLAASG----------ATFLNAIP--------------NSGG-DYSV 599
gi|325928875|ref|ZP_08190038.1      VTDPLAASG----------ATFLNAIP--------------NSGG-DYSV 599
gi|78048450|ref|YP_364625.1|        VTDPLAASG----------ATFLNAIP--------------NSGG-DYSV 599
gi|325923376|ref|ZP_08185046.1      ITDPLAASG----------VTFLNAIP--------------NNGG-EYTV 586
gi|21232003|ref|NP_637920.1|        ITDPLAASG----------VTFLNAIP--------------NSGG-EYTV 599
gi|66767870|ref|YP_242632.1|        ITDPLAASG----------VTFLNAIP--------------NSGG-EYTV 599
gi|188990985|ref|YP_001902995.      ITDPLAASG----------VTFLNAIP--------------NSGG-EYTV 599
gi|325916913|ref|ZP_08179158.1      ITDPLAASG----------VTFLNAIP--------------NSGG-EYTV 586
gi|85712231|ref|ZP_01043282.1|      VEDPFAKTG----------ATFFNALG--------------ETDG-QYDV 606
gi|119468736|ref|ZP_01611788.1      NEPDNAEG------------TFFNALG--------------EDKG-SFNV 570
gi|113968469|ref|YP_732262.1|       FEPDNAEG------------TFFNVLG--------------EDKG-DFDV 571
gi|295690838|ref|YP_003594531.      EYDELVRRG----------GTFLNAIP--------------IFDPPAFSV 613
gi|117921501|ref|YP_870693.1|       DTDKAMRGD----------AITFNDVP---------------PFEGDVTV 588
gi|170726613|ref|YP_001760639.      DTNVPLGG------------VSFNYVP---------------TFSGDVSV 599
gi|83858580|ref|ZP_00952102.1|      VPDALSQSG-----------LNGGNVS--------------PAVYGDFQV 604
gi|85713344|ref|ZP_01044360.1|      QPDSGFTSG---------DGAGQGGPT--------------IGVSGSLSV 250
                                                                                      

gi|88698633|gb|EAQ95758.1|          TDVFFEVNVPLLSGTPFAESLVFDAAVRASDYS--TIGEAYTWKTGLSWT 777
gi|85710286|ref|ZP_01041351.1|      YDIFTEVRLPFLANVPGAELLELSGSARFSSYS--TVGDTFTWNVSGLYA 755
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      QEIFAELRVPLLADMPFFDELTVTGAVRAGEYS--TVGSTTTYKYDAVWA 721
gi|94495576|ref|ZP_01302156.1|      KEVFGELSVPVLKEVPFAYNLSFGAALRLSDYS--TIGKTTTWKVDGTYA 638
gi|83858794|ref|ZP_00952316.1|      SEFFGELQVPIISDVPFIQDFELNGAYRYSDYD--TFGETDTWSVGARWT 690
gi|289669422|ref|ZP_06490497.1      REAFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNIGLDWT 554
gi|289663198|ref|ZP_06484779.1      REAFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNIGLDWT 647
gi|294625102|ref|ZP_06703748.1      KEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNIGLDWT 645
gi|294664562|ref|ZP_06729905.1      KEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNIGLDWT 645
gi|21243469|ref|NP_643051.1|        KEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNIGLDWT 647
gi|325928875|ref|ZP_08190038.1      KEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNIGLDWT 647
gi|78048450|ref|YP_364625.1|        KEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS--SIGSTKTWNVGLDWT 647
gi|325923376|ref|ZP_08185046.1      KEIFVESTIPLLAGLPGVDRLALDVAGRYSDYD--SIGSTKTWNVGLDWT 634
gi|21232003|ref|NP_637920.1|        REVFVESTIPLLAGLPGVDRLALDLAGRYSDYS--SIGSTKTWNIGLDWT 647
gi|66767870|ref|YP_242632.1|        REVFVESTIPLLAGLPGVDRLALDLAGRYSDYS--SIGSTKTWNIGLDWT 647
gi|188990985|ref|YP_001902995.      REVFVESTIPLLAGLPGVDRLALDLAGRYSDYS--SIGSTKTWNIGLDWT 647
gi|325916913|ref|ZP_08179158.1      KEVFVESTIPLLAGLPGVDRLALDVAGRYSDYD--SIGSTKTWNIGLDWT 634
gi|85712231|ref|ZP_01043282.1|      SEIFGEISVPLLRDMFMVQHLNFDAAVRYADYS--TIGGATAWKVGLDWT 654
gi|119468736|ref|ZP_01611788.1      REVFFEATMPILTDLPLIQDLVFDTAVRHADYS--TIGEATSWKLGLDWT 618
gi|113968469|ref|YP_732262.1|       KEVFAEISVPLLSDLPLVRQLDAELAARYANYS--TIGSATTWKAGLSWE 619
gi|295690838|ref|YP_003594531.      KEAFAEIRVPVLANLPWAEELSVNGAVRGADYSG-ATGKVLAYNAGVIYA 662
gi|117921501|ref|YP_870693.1|       WEAFGEANLPLLRDEAFANKLDLDVSLRLADYSQKNIDLMSSYRAGILWE 638
gi|170726613|ref|YP_001760639.      YEVFGEAAFPLLKDVAGAKSLTAEVSARLADYSWSGTGLIQSYKTGVTWQ 649
gi|83858580|ref|ZP_00952102.1|      AELFAEAEIPLVQGRQYVEDLRLNLSARASDYT--TVGQTFAWAANVQYT 652
gi|85713344|ref|ZP_01044360.1|      DEIFSEAKIYLVEGADWADTLTMDLGYRYSEYS--TAKETDTYKLALGWD 298
                                                                                      

gi|88698633|gb|EAQ95758.1|          PIDDIRFRATVSQAVRAPNINELFAP-TTGTNFRPIDPCD---AAQLAAL 823
gi|85710286|ref|ZP_01041351.1|      PTQDILFRGTYSEAVRAPNINELFNP-AQGAFFRPVDPCD---VGNLVTA 801
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      PIPDIRFRGGQAKTVRAPNISELFSP-ITSFNARPIDPCD---ENNIGLG 767
gi|94495576|ref|ZP_01302156.1|      PIPDITFRGTWSEAVRAPNITELFAP-LNGGFSFIGDPCD---PVYIGEG 684
gi|83858794|ref|ZP_00952316.1|      IIDSLTVRSTLSRAVRIPNITEAFSPNFTVSLGASNDPCN---PQFIDAG 737
gi|289669422|ref|ZP_06490497.1      IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNTNRPG 603
gi|289663198|ref|ZP_06484779.1      IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNTNRPG 696
gi|294625102|ref|ZP_06703748.1      IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNINRPG 694
gi|294664562|ref|ZP_06729905.1      IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNINRPG 694
gi|21243469|ref|NP_643051.1|        IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNTNRPG 696
gi|325928875|ref|ZP_08190038.1      IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNINRPG 696
gi|78048450|ref|YP_364625.1|        IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNINRPG 696
gi|325923376|ref|ZP_08185046.1      IIPSLRLRGTVAQAVRAPSIGELYYS-QSENFATINDPCNYLPTNSNRPG 683
gi|21232003|ref|NP_637920.1|        IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLSSNSNRPG 696
gi|66767870|ref|YP_242632.1|        IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLSSNSNRPG 696
gi|188990985|ref|YP_001902995.      IIPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLSSNSNRPG 696
gi|325916913|ref|ZP_08179158.1      ILPSLRLRGTLAQAVRAPSIGELYDS-QSENFATINDPCNYLPTNSNRPG 683
gi|85712231|ref|ZP_01043282.1|      ISDELRSRFTYSEAIRAPNIDELFSG-QSQSFAGVDDPCK--VSNLAQLS 701
gi|119468736|ref|ZP_01611788.1      VNDELRVRVTQSAALRAPNISEVFGA-ASQTFYSVDDPCR--AENLANLS 665
gi|113968469|ref|YP_732262.1|       VYDDLRIRSTYSEAIRAPNISELFGA-QSQNFFNVDDSCK--SSELDNLA 666
gi|295690838|ref|YP_003594531.      PIRDVRFRANYSKSVRAPLLAELYSA-PSQNFASVSDPCD-----VANIG 706
gi|117921501|ref|YP_870693.1|       PIANYALRANYSRSQRAPNITELISP-PRGDYDSIRDICDG--VTATSTG 685
gi|170726613|ref|YP_001760639.      PVEGYAIRANWARAQRAPSITELLSP-PRGDYDSFDDICEG--TTLTSTD 696
gi|83858580|ref|ZP_00952102.1|      PIDMLRFRAQYSESVRAPNIGELFQP-PSETFEGADDVCAGLTLSGSDPA 701
gi|85713344|ref|ZP_01044360.1|      INEMWKVRGSFQRSARHANIRELYQAQSIGLYDMDSDPCG-----GADPE 343
                                                                                      

gi|88698633|gb|EAQ95758.1|          SGSIGAQTQANCVADFATFGLNPFDAEG---------NYVYTDPLS-ASF 863
gi|85710286|ref|ZP_01041351.1|      PD--AALRQANCTAFFNQIGFDPTFGTG---------TYSYVDPLT-ARF 839
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      NN--PANRLANCRADGIPAG--------------------FTDPLT-SQF 794
gi|94495576|ref|ZP_01302156.1|      TQ----YRAANCQAALSALGLTPDQIAA---------FNPENDPTATVSL 721
gi|83858794|ref|ZP_00952316.1|      SQFRRANCEALIGIPIDTYN---------------------STDYVSARI 766
gi|289669422|ref|ZP_06490497.1      TAGDVALRQANCSALGIPVG--------------------WIDTYT-ATR 632
gi|289663198|ref|ZP_06484779.1      TAGDVALRQANCSALGIPVG--------------------WIDTYT-ATR 725
gi|294625102|ref|ZP_06703748.1      TAGDVALRQANCSALGIPVG--------------------WIDTYT-ATR 723
gi|294664562|ref|ZP_06729905.1      TAGDVALRQANCSALGIPVG--------------------WIDTYT-ATR 723
gi|21243469|ref|NP_643051.1|        TAGDVGLRQANCSALGIPVG--------------------WIDTYT-ATR 725
gi|325928875|ref|ZP_08190038.1      TAGDVALRQANCSALGIPVG--------------------WIDTFT-STR 725
gi|78048450|ref|YP_364625.1|        TAGDVALRQANCSALGIPVG--------------------WIDTFT-STR 725
gi|325923376|ref|ZP_08185046.1      TAGDVALRQANCSALGVPVG--------------------WIDTFT-STR 712
gi|21232003|ref|NP_637920.1|        TAGDVALRQANCSALGVPVG--------------------WIDTYT-ANR 725
gi|66767870|ref|YP_242632.1|        TAGDVALRQANCSALGVPVG--------------------WIDTYT-ANR 725
gi|188990985|ref|YP_001902995.      TAGDVALRQANCSALGVPVG--------------------WIDTYT-ANR 725
gi|325916913|ref|ZP_08179158.1      TAGDVALRQANCSALGVPVG--------------------WIDTYT-ATR 712
gi|85712231|ref|ZP_01043282.1|      AD-GRARREANCAALGVPAD--------------------FDSNYDSATL 730
gi|119468736|ref|ZP_01611788.1      N---ATTRSANCSALGVASD--------------------FNSGYDSASL 692
gi|113968469|ref|YP_732262.1|       N---SELRRQNCAALGIPTS--------------------FDSDYDSASV 693
gi|295690838|ref|YP_003594531.      SG--TATRAANCAAAGIPVG--------------------FINDEARAAT 734
gi|117921501|ref|YP_870693.1|       AGHDSCRQDPGIAAAIATNG----------------------VFEDEGGS 713
gi|170726613|ref|YP_001760639.      AGHDNCRLEPGIAAVIADGS----------------------EFEDDNNG 724
gi|83858580|ref|ZP_00952102.1|      FFNAADDATSGVDSSTVNSSLAQACFADPSVAARVDRDGFYIPTQGEIQG 751
gi|85713344|ref|ZP_01044360.1|      ATLEECQRTGVTSAQYGNIP------------------------QSPANQ 369
                                                                                      

gi|88698633|gb|EAQ95758.1|          GGTQ-GGNQDLQEETADTYTIGVVFQPTFLEG-----LTLSVDYWSIEIE 907
gi|85710286|ref|ZP_01041351.1|      SGSI-SGNPNLEEETATTWTVGAQITPRFLPG-----FVLSVDYYNIEIE 883
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      AGRT-GGNPNLQEEESDSFTYGIVLQPRFVPG-----LAVTVDYYNIEIT 838
gi|94495576|ref|ZP_01302156.1|      PGNS-GGNRNLREETARTWTAGVVVRPSFIRG-----LVASFDWYDIKLK 765
gi|83858794|ref|ZP_00952316.1|      PGQS-GGNPDLEPEEADSFTLGAIWRPVEDFGGLFDGLTVTVDYYKIEID 815
gi|289669422|ref|ZP_06490497.1      PGVS-GGNPDLKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 676
gi|289663198|ref|ZP_06484779.1      PGVS-GGNPDLKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 769
gi|294625102|ref|ZP_06703748.1      PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 767
gi|294664562|ref|ZP_06729905.1      PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 767
gi|21243469|ref|NP_643051.1|        PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 769
gi|325928875|ref|ZP_08190038.1      PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 769
gi|78048450|ref|YP_364625.1|        PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLR 769
gi|325923376|ref|ZP_08185046.1      PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLQ 756
gi|21232003|ref|NP_637920.1|        PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSVDYWRIDLQ 769
gi|66767870|ref|YP_242632.1|        PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSVDYWRIDLQ 769
gi|188990985|ref|YP_001902995.      PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSVDYWRIDLQ 769
gi|325916913|ref|ZP_08179158.1      PGVS-GGNPELKPERARSLSYGLVWQPEFFEG-----FGMSIDYWRIDLQ 756
gi|85712231|ref|ZP_01043282.1|      ETLV-GGNPDLSEETSESITAGFVYSPEWLEG-----FSATVDYWEIDID 774
gi|119468736|ref|ZP_01611788.1      DGLT-SGNRDVKGEESTSTTVGIVYQPEFIDN-----AVLTIDYWEIDLE 736
gi|113968469|ref|YP_732262.1|       DGFS-GGNRELKAEESTSYTVGGVFQPSFVDG-----LVLTVDYWNIKID 737
gi|295690838|ref|YP_003594531.      TEITSAGNPRLGEETAKSWTIGAVLQPRFVPG-----LTVSVDYYDIKLA 779
gi|117921501|ref|YP_870693.1|       KYSPNAGNENLTEETADTYTLGFTMAPAFLEG-----FNLAVDYYDIKVT 758
gi|170726613|ref|YP_001760639.      -YSPNVGNSELKEETADTYTLGITLAPEFAEG-----LRIAVDYYDITIS 768
gi|83858580|ref|ZP_00952102.1|      IAGFNGGNPNLSEETATSITLGAVFSPEFGNQWIDN-FALSVDYYNIEIE 800
gi|85713344|ref|ZP_01044360.1|      YNSISGGNPDLEPETSDTISVGFVYR--TMEG----DFDVSLDYFDIKVE 413
                                                                                      

gi|88698633|gb|EAQ95758.1|          DAIEEVTSQNIVDACYQGTS----LNDAFCSQFTRNTNSSS-------VQ 946
gi|85710286|ref|ZP_01041351.1|      DAINPVGSQDIVDNCVDSAS----IENAFCGLIDRNPAT----------- 918
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      NAIQAVTTQDIVDSCYDGPD----LTNVFCGQFTRNRNASS-------PT 877
gi|94495576|ref|ZP_01302156.1|      NAVNTATAEEVAELCVDQPS----LDNVFCGNISRDPTT----------- 800
gi|83858794|ref|ZP_00952316.1|      GLIDQLGAFDIAQNCVDAPT----INNQFCAAIDRDPTIG---------- 851
gi|289669422|ref|ZP_06490497.1      DAIGTVTAETNATRCVDNPGG---IGNNFCGFVQRAPLGGFTDPQGRIYP 723
gi|289663198|ref|ZP_06484779.1      DAIGTVTAETNATRCVDNPGG---IGNNFCGFVQRAPLGGFTDPQGRIYP 816
gi|294625102|ref|ZP_06703748.1      DAIGAVTAETNATRCVDNPGG---IGNSFCGFVQRAPLGGFTDPQGRIYP 814
gi|294664562|ref|ZP_06729905.1      DAIGAVTAETNATRCVDNPGG---IGNSFCGFVQRAPLGGFTDPQGRIYP 814
gi|21243469|ref|NP_643051.1|        DAIGAVTAETNATRCVDNPGG---IGNSFCGFVQRAPLGGFTDPQGRIYP 816
gi|325928875|ref|ZP_08190038.1      DAIGTVTAETNATRCVDNPGG---IGNSFCGFVQRAPLGGFTDPQGRIYP 816
gi|78048450|ref|YP_364625.1|        DAIGAVTAETNATRCVDNPGG---IGNSFCGFVQRAPLGGFTDPQGRIYP 816
gi|325923376|ref|ZP_08185046.1      DAIGTVTAETNATRCVDNPGG---IDNSFCSFVQRAPLGGFTDPQGRIYP 803
gi|21232003|ref|NP_637920.1|        DAIGSVTAETNSTRCVDNPGG---INNSFCGFVQRAPLGGFTDPQGRIYP 816
gi|66767870|ref|YP_242632.1|        DAIGSVTAETNATRCVDNPGG---INNSFCGFVQRAPLGGFTDPQGRIYP 816
gi|188990985|ref|YP_001902995.      DAIGSVTAETNATRCVDNPGG---INNSFCGFVQRAPLGGFTDPQGRIYP 816
gi|325916913|ref|ZP_08179158.1      DAIGTVTAETNATRCVDNPGG---INNSFCGFVQRAPLGGFTDPQGRIYP 803
gi|85712231|ref|ZP_01043282.1|      DTISGIGFQTILNRCVDAET----IDNQFCNLITRDP------------D 808
gi|119468736|ref|ZP_01611788.1      NAIDTIDAQEILDRCVDSTTG---INNQYCNLITRN-------------A 770
gi|113968469|ref|YP_732262.1|       DAISAVSAQDIIDKCVDSPSG---VNNEYCALITRDP------------N 772
gi|295690838|ref|YP_003594531.      NVISSVAPQQVLNNCYDAAN----LDNAFCALFQRDP----------TTK 815
gi|117921501|ref|YP_870693.1|       DAIGSLSNEDILAECYNSSNPYG-ADNEYCQVISRDTEG----------- 796
gi|170726613|ref|YP_001760639.      DAISSFSNEDIIDYCYNSSLDFG-DDNNFCNDIQRDAEG----------- 806
gi|83858580|ref|ZP_00952102.1|      DAIAGIARQTSVNQCYDNGTGAYNANSVFCSNIVRYNSGP---------S 841
gi|85713344|ref|ZP_01044360.1|      DAIGIVAAETTLDLCLDTGDA------QFCDLINRGPETG--------SL 449
                                                                                      

gi|88698633|gb|EAQ95758.1|          FGGFNFLQVSPINFANLESDGIDFQGSYDFSIGEHG-------FKASIGG 989
gi|85710286|ref|ZP_01041351.1|      -GGFTFLRQSSLNFARQETAGVEAVMQYQFGVGPLD-------FTLNASG 960
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      FLGFNSITTTQLNFAGLEASGIDFNVSYAFDFAALGRPAWG-DMSLSVGG 926
gi|94495576|ref|ZP_01302156.1|      -GYINGWFVQPQNVANFRTSGADFKLNYQFETASAG------NFALSLVG 843
gi|83858794|ref|ZP_00952316.1|      --FITGFRSGFVNLAAVETSGIDWRIEYAFDMPSILGLEDAGELRLSSLG 899
gi|289669422|ref|ZP_06490497.1      EHSITGWQALNENLARSRRVGVDLEMDYRFQIGEGN-------TVLRFVG 766
gi|289663198|ref|ZP_06484779.1      EHSITGWQALNENLARSRRVGVDLEMDYRFQIGEGN-------TVLRFVG 859
gi|294625102|ref|ZP_06703748.1      EHSIIGWQALNENLARSRRVGVDLEMDYRFQLGQGN-------TVLRFVG 857
gi|294664562|ref|ZP_06729905.1      EHSIIGWQALNENLARSRRVGVDLEMDYRFQLGQGN-------TVLRFVG 857
gi|21243469|ref|NP_643051.1|        EHSIIGWQALNENLARSRRVGVDLEMDYRFQLGQGN-------TVLRFVG 859
gi|325928875|ref|ZP_08190038.1      EHSIIGWQALNENLARSRRVGVDLEMDYRFQIGGGN-------TVLRFVG 859
gi|78048450|ref|YP_364625.1|        EHSIIGWQALNENLARSRRVGVDLEMDYRFQIGGGN-------TVLRFVG 859
gi|325923376|ref|ZP_08185046.1      EHSIIGWQALNENLSRSRRVGVDLEMDYRFQIGQGN-------TVLRFVG 846
gi|21232003|ref|NP_637920.1|        EHSIIGWQALNENLARSRRVGVDLEMDYRFQLGEGN-------TVLRLVG 859
gi|66767870|ref|YP_242632.1|        EHSIIGWQALNENLARSRRVGVDLEMDYRFQLGEGN-------TVLRLVG 859
gi|188990985|ref|YP_001902995.      EHSIIGWQALNENLARSRRVGVDLEMDYRFQLGEGN-------TVLRLVG 859
gi|325916913|ref|ZP_08179158.1      EHSIIGWQALNENLSRSRRVGVDLEMDYRFQLGEGN-------TVLRLVG 846
gi|85712231|ref|ZP_01043282.1|      TSEITLIRGFALNIARSLNSGVDFEFAYDFDALGGQ-------FRTNLIG 851
gi|119468736|ref|ZP_01611788.1      SGEISLIQNSVLNVAGQKASGVDFELGYDFDALEGS-------FKTRLIG 813
gi|113968469|ref|YP_732262.1|       SHEITSIRQYALNISSLEAAGIDFDIGYNFELFGGD-------LRSNLIA 815
gi|295690838|ref|YP_003594531.      FFVPGSLQDTSLNFAKRRARGVDSDINYRFDLPQDS-------GTVNLRG 858
gi|117921501|ref|YP_870693.1|       --QITQVIQQEQNLNDIVTRGVDIAMAYEWQLDGYG--------ELSLKT 836
gi|170726613|ref|YP_001760639.      --QITTVNQRVYNVDEIKTNGFDFAAEYRYELDKYG--------SLKFKA 846
gi|83858580|ref|ZP_00952102.1|      IGAIKELNALQQNLATIETAGIDVQASYFLGLNDVFTNSSWGLGDLNFTL 891
gi|85713344|ref|ZP_01044360.1|      WLGQDNIIATNVNIGFEQRSGFDLNSSYTIRFDNDFG-----KLKFNLVG 494
                                                                                      

gi|88698633|gb|EAQ95758.1|          --TYVNELNRFSDPLDSSVVDVELGEVNRPELA--GNIWLNWYWKD-LTV 1034
gi|85710286|ref|ZP_01041351.1|      --TWVDKLNNFFDPSDPTLVDPELGELQRPEWA--GRASLTADYER-FSF 1005
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      --THVEDRNDYPFATNPTQANPVELQLNNPELS--LNAGIRWTIGD-FTI 971
gi|94495576|ref|ZP_01302156.1|      --GYLNKLEFIPTPG--ATVDVDREEPYYPKWN--ATGDITWKLDK-LTV 886
gi|83858794|ref|ZP_00952316.1|      --TNFLSNEETRDVSAPDEITDVLTTMSRPEWI--FNLNATWAIGD-LSL 944
gi|289669422|ref|ZP_06490497.1      --TRLIQSREWVFQDFPQEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 811
gi|289663198|ref|ZP_06484779.1      --TRLIQSREWVFQDFPQEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 904
gi|294625102|ref|ZP_06703748.1      --TRLIQSREWVFQDFPQEYDEYVTYVTDPRWR--AQFQTKYNWNA-WRA 902
gi|294664562|ref|ZP_06729905.1      --TRLIQSREWVFQDFPQEYDEYVTYVTDPRWR--AQFQTKYNWNA-WRA 902
gi|21243469|ref|NP_643051.1|        --TRLIQSREWVFQDFPQEYDEYVTYVTDPRWR--AQFQTKYNWNA-WRA 904
gi|325928875|ref|ZP_08190038.1      --TRLIQSREWVFQDFPAEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 904
gi|78048450|ref|YP_364625.1|        --TRLIQSREWVFQDFPAEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 904
gi|325923376|ref|ZP_08185046.1      --TRLIQSREWVFQDFPAEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 891
gi|21232003|ref|NP_637920.1|        --TRLIQSREWVFQDFPEEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 904
gi|66767870|ref|YP_242632.1|        --TRLIQSREWVFQDFPEEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 904
gi|188990985|ref|YP_001902995.      --TRLIQSREWVFQDFPEEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 904
gi|325916913|ref|ZP_08179158.1      --TRLIQSREWVFQDFPAEYDEYVTYVTDPRWR--AQFQTKYNWNE-WRA 891
gi|85712231|ref|ZP_01043282.1|      --TYTIEAKDYPFADEPDNYTDYAGVLGDQDLQ--MQLSVQYGIDN-WTF 896
gi|119468736|ref|ZP_01611788.1      --TYLIERKDYPFQDDPSSYIEYAGTTGEAKWQ--TNLSLTYAKDN-FYS 858
gi|113968469|ref|YP_732262.1|       --TKLLKRRDYSFQDEPDVYENYVGVVGTPEWQ--ANLTFNYSWNS-WQA 860
gi|295690838|ref|YP_003594531.      TVTYVVQRDNYPFIDDPNRPDQILYELGDPRWA--FNISAQWRKDK-LTV 905
gi|117921501|ref|YP_870693.1|       NWTHVLEFSTSYYGADGLVEDDYVGELASGIFEDRGAISLTWSNDD-WRV 885
gi|170726613|ref|YP_001760639.      DWTHVIGYEQTVQSPEGPATTNYEGDLSQDIFEDKVTASLSWYYDDAWRV 896
gi|83858580|ref|ZP_00952102.1|      TYGYLEKWEQQAFPGAEVIDYSDTAGLFEHEVL----FSTVYRNGP-LTV 936
gi|85713344|ref|ZP_01044360.1|      TYFTKFDTQPVVGLRVYECAGYWGGVCGAPNPEWQHNLRATWENNDGLAV 544
                                                                                      

gi|88698633|gb|EAQ95758.1|          QWQTQYQDEQLLAFIEIDTAQEL-----------------YGDSV----- 1062
gi|85710286|ref|ZP_01041351.1|      TWSTTYLDSMGLRAVEIEEVGNT-----------------GADTFSVANG 1038
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      NTGHQYMGEQALPGVEIENADN------------------------FAFA 997
gi|94495576|ref|ZP_01302156.1|      NYGISWFSKTRRYEIEQTNANPD-----------------IAES---KYL 916
gi|83858794|ref|ZP_00952316.1|      GWKGRYESEQLLGGIELDDLESD-----------------PNFAN---IT 974
gi|289669422|ref|ZP_06490497.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 839
gi|289663198|ref|ZP_06484779.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|294625102|ref|ZP_06703748.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 930
gi|294664562|ref|ZP_06729905.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 930
gi|21243469|ref|NP_643051.1|        SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|325928875|ref|ZP_08190038.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|78048450|ref|YP_364625.1|        SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|325923376|ref|ZP_08185046.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 919
gi|21232003|ref|NP_637920.1|        SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|66767870|ref|YP_242632.1|        SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|188990985|ref|YP_001902995.      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 932
gi|325916913|ref|ZP_08179158.1      SWDMNYVDGNLRVTPESYN----------------------SNPGSASPI 919
gi|85712231|ref|ZP_01043282.1|      GTTTRYVDRVNLYDPTSLE----------------------TNPNPSNEM 924
gi|119468736|ref|ZP_01611788.1      TVETRFISEVDLYTNVDLA----------------------SNSNPSNQM 886
gi|113968469|ref|YP_732262.1|       TWRTRFIEGVSLYTDQELA----------------------VNANPNSLL 888
gi|295690838|ref|YP_003594531.      GYQGRYIGKMSVDVIENIKSVGGRP---------------PQNADFATIN 940
gi|117921501|ref|YP_870693.1|       RWSAKYKSAMVDSHDRVEEWNVLRAENQAKLDAGDASAVANPETPAFLFY 935
gi|170726613|ref|YP_001760639.      RWSTRFKSAVVASRSVYDDWEKAITKNNEYCADGSDKCVLEPEALDDSFY 946
gi|83858580|ref|ZP_00952102.1|      AYDMNWMPETRLEATGDLS-----------------------------EA 957
gi|85713344|ref|ZP_01044360.1|      SANWRYLGETQQLDSGPQD------------------------------- 563
                                                                                      

gi|88698633|gb|EAQ95758.1|          VQDEYWQHDIAATF---AIKET-MSVFGGVRNLTDEQPFITNRG------ 1102
gi|85710286|ref|ZP_01041351.1|      LSGDAFIHDIQFSF---EASDM-LNIYGGVNNVFGRNPFLTEQA------ 1078
Translation                         --------------------------------------------------
gi|302382112|ref|YP_003817935.      FADEIWIHDLSVRW---DADDY-AVTFG-VNNVTNEEPFIASVA------ 1036
gi|94495576|ref|ZP_01302156.1|      WYKEKWQHDLYVAY---DVDER-FRFYVGANNLFDQQPSIASSN------ 956
gi|83858794|ref|ZP_00952316.1|      HADGAWVHDFSISY---FLKDE-LEIYGGINNAFDEEPYLGQYS------ 1014
gi|289669422|ref|ZP_06490497.1      KNGSYVYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 880
gi|289663198|ref|ZP_06484779.1      KNGSYVYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 973
gi|294625102|ref|ZP_06703748.1      KNGSYVYHNVQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 971
gi|294664562|ref|ZP_06729905.1      KNGSYVYHNVQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 971
gi|21243469|ref|NP_643051.1|        KNGSYVYHNFQFGY---QFPGSKIDVYLGIDNALDKDPPRNYFG------ 973
gi|325928875|ref|ZP_08190038.1      KNGSYVYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 973
gi|78048450|ref|YP_364625.1|        KNGSYVYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 973
gi|325923376|ref|ZP_08185046.1      KNGSYTYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 960
gi|21232003|ref|NP_637920.1|        KNGSYTYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 973
gi|66767870|ref|YP_242632.1|        KNGSYTYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 973
gi|188990985|ref|YP_001902995.      KNGSYTYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 973
gi|325916913|ref|ZP_08179158.1      KNGSYTYHNFQFGY---QFPGSKIDVYLGIDNAFDKDPPRNYFG------ 960
gi|85712231|ref|ZP_01043282.1|      QYGTYVITDVTAGY---KFDNG-LGLTLGVDNFFNRELPGYTTG------ 964
gi|119468736|ref|ZP_01611788.1      FYGKYFITDMTVGY---SFDSG-LGVKVGVDNLFNRKLPYGSRG------ 926
gi|113968469|ref|YP_732262.1|       SYGDYYISDMGIGY---NFDNG-IELKVGVDNLFNKDLPYGSTG------ 928
gi|295690838|ref|YP_003594531.      YYPDVMYHDLTAEY---AINGN-YTVYGGMENVFDRLPPYRLTG------ 980
gi|117921501|ref|YP_870693.1|       --SSYITHDLSVSYTMDVS-QAELRLYGGVRNIFDNQGPWVADTGDLVET 982
gi|170726613|ref|YP_001760639.      NLPSYITHNLSVSYTLDLANDGELRFFGGVNNIFDDRGPFMAIG------ 990
gi|83858580|ref|ZP_00952102.1|      MVPSATFQDVQVRWAFENQLELVFGVDNLTDEFIKYGQGFDSTG------ 1001
gi|85713344|ref|ZP_01044360.1|      -IDAENYLDLTARYR----WGDNTTISVGVNNVLENDPPYLTGAPG---- 604
                                                                                      

gi|88698633|gb|EAQ95758.1|          --YPASA-----RGTYVYLGFNMVFGGF 1123
gi|85710286|ref|ZP_01041351.1|      --YPVSP-----VGTLFFLGATVTM--- 1096
Translation                         ----------------------------
gi|302382112|ref|YP_003817935.      --TPVSS-----VGRYFFLRFATTY--- 1054
gi|94495576|ref|ZP_01302156.1|      --YPISY-----VGRYMYAGAKITM--- 974
gi|83858794|ref|ZP_00952316.1|      --RPAGP-----RGRFFYAGVNATF--- 1032
gi|289669422|ref|ZP_06490497.1      --SDFTSALYDNVGRFFYLGTTVRF--- 903
gi|289663198|ref|ZP_06484779.1      --SDFTSALYDNVGRFFYLGTTVRF--- 996
gi|294625102|ref|ZP_06703748.1      --SDFTSALYDNVGRFFYLGTTVRF--- 994
gi|294664562|ref|ZP_06729905.1      --SDFTSALYDNVGRFFYLGTTVRF--- 994
gi|21243469|ref|NP_643051.1|        --SDFTSALYDNVGRFFYLGTTVRF--- 996
gi|325928875|ref|ZP_08190038.1      --SDFTSALYDNVGRFFYLGTTVRF--- 996
gi|78048450|ref|YP_364625.1|        --SDFTSALYDNVGRFFYLGTTVRF--- 996
gi|325923376|ref|ZP_08185046.1      --SDFNSALYDNVGRFFYLGTTVRF--- 983
gi|21232003|ref|NP_637920.1|        --SDFTSALYDNVGRFFYLGTTVKF--- 996
gi|66767870|ref|YP_242632.1|        --SDFTSALYDNVGRFFYLGTTVKF--- 996
gi|188990985|ref|YP_001902995.      --SDFTSALYDNVGRFFYLGTTVKF--- 996
gi|325916913|ref|ZP_08179158.1      --SDFNSALYDNVGRFFYLGTTVRF--- 983
gi|85712231|ref|ZP_01043282.1|      --TGAGSAIYDNIGRFAYLRASLSF--- 987
gi|119468736|ref|ZP_01611788.1      --TSAGSASYDNIGRFGYINLSYSL--- 949
gi|113968469|ref|YP_732262.1|       --TTAGSAAYDNIGRFFYTTISFSL--- 951
gi|295690838|ref|YP_003594531.      --AGEGSGIYDNRGRYMYLGVKANF--- 1003
gi|117921501|ref|YP_870693.1|       GNGNYSSAYGGGVGRYAYLGAELKF--- 1007
gi|170726613|ref|YP_001760639.      GRGNFDSNYGGGKGRFAYAGAEFKF--- 1015
gi|83858580|ref|ZP_00952102.1|      --TGTDGAIYDAIGRRWYVGARKTF--- 1024
gi|85713344|ref|ZP_01044360.1|      SNGNTYPGYFDALGRYVFASISYQFM-- 630