IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Homolog hunting: BLAST"

Thread subject: Blast results

[ Return to forums ]
Blast results
HiraEjaz
28 Apr 2011 8:11
Non evaluated contribution
>gi|88698633|gb|EAQ95758.1| TonB-dependent receptor [Congregibacter litoralis KT71]
MRKHCQKSRSVLSLSVAAAVASLSAATSTSVFAQQGEDIQLEEVVVTGSRIAGDPNAIASQPVTSVNAED
IAISGEFNITDVINDIPALFSSNTSENSLDGNQGAEVADGTNTLNLRGLGAARTLVLVDGRRHVAGAAGT
QAVDVGSLPMKLIERVEVLTGGASAVYGADAVTGVVNFILKDDYEGFEIDLQTGMSSEADAGQSAISALW
GKNFSNGRGNVAVTLDYRTDEGLKAGERGRDGLLTGTGRDWVNPDLRFQQGDITGDTPNFQQFFNYQNTG
LTDFGLPIPTQEDFIADYQAEFGVAPSITAAEEALFAQAGSAPQRAVELGRSFPFTSGYGYIIPGNPYTF
EGFDPDVPIDLDNNGRNDCQDSFTGYNSVFGAASFGVVGGCWNVDQNGGYAPVQDGRVAGNFQGFGGDSL
NTIQQADSYLITPEDKITFNMVGHFDINENMTAFGEFKYGWQENENQVRPQSFWDLLFGAPDNPFLPGFI
QPVAQELGGVAITIDPIGLGPTQRVTERETFRFVGGLEGTFSNGWTYEVSANYGKFEQTIERSNEVIVDR
FLAAIDAVTDPATGEAACRSSVDPNAPVVATPFDIPVFDPGYYSFTPGDGQCVPLNIWAGQPGITDEAVD
FVTRATSEGATLEQTVFAAVVTGDSADWFELPAGAVSFAAGVEYRKEESETSFDSYALGIIPAGAPFPEG
TQLSDVSDNSNLLFRPALSNSNEVGDYDVTDVFFEVNVPLLSGTPFAESLVFDAAVRASDYSTIGEAYTW
KTGLSWTPIDDIRFRATVSQAVRAPNINELFAPTTGTNFRPIDPCDAAQLAALSGSIGAQTQANCVADFA
TFGLNPFDAEGNYVYTDPLSASFGGTQGGNQDLQEETADTYTIGVVFQPTFLEGLTLSVDYWSIEIEDAI
EEVTSQNIVDACYQGTSLNDAFCSQFTRNTNSSSVQFGGFNFLQVSPINFANLESDGIDFQGSYDFSIGE
HGFKASIGGTYVNELNRFSDPLDSSVVDVELGEVNRPELAGNIWLNWYWKDLTVQWQTQYQDEQLLAFIE
IDTAQELYGDSVVQDEYWQHDIAATFAIKETMSVFGGVRNLTDEQPFITNRGYPASARGTYVYLGFNMVF
GGF



>gi|85710286|ref|ZP_01041351.1| TonB-dependent outer membrane receptor [Erythrobacter sp. NAP1]
MRPLKISGQALLLAAASTMPFTAYAQSTPDGDEAGDGEENRIVVTGSRIAVDPNIGSPAPVISVDAEALT
QAGTPDVVDVLRDIPALSTSTTAEGSIDGVFAEAVGQSILNLRGLGANRTLVLVNGRRHVSGVAGEQAVD
INSIPTALIERVETLTGGASSIYGADAVTGVVNFVLRDDFEGLQANVQSGISDQGDSWRINGDVTWGVNF
DDGRGNFVISGEYAYGEELQFGDRAFSRNNGIFDDQANPALRFQTGELNATDTPNFIANGSVIGGLIPTS
ADGFTPTAAEQALIARSVNAPRRFIAFDPRFSLSSAGGIVAPGDIGLSDGPDINGNGTPDCLESAVGFNS
TFNAGAFGLAGGCAVINNDGSLSVYQDGLITGLFNQFGGDGIPNNFDVNSLIPETERWSVNANLTYEISN
AATFFFEGKYVSNSAEFQAQPNTFYDLLTIRADNPFITPDLQQYVAPLFFGDGVEEGLYLTRDPADLGPN
RNRNEFETYRFVAGFRGDTSDYFSYEVSANYGKFNQTTLDANRVIMDRFFAAIDVVTGPGGSPICRSDID
PTAPATTPFGIPAGDPGFFTFNPGDGQCRPANVLGGVGAISQEAIDFITTTVVNEFELEQLVFSAIFTGN
TGAFLELPGGPIGFAFGLEYREEESTSEFDPLVRGVIPVTTPDATEGALLRDLGFSQNSLVFDPASVISN
AGGQYDVYDIFTEVRLPFLANVPGAELLELSGSARFSSYSTVGDTFTWNVSGLYAPTQDILFRGTYSEAV
RAPNINELFNPAQGAFFRPVDPCDVGNLVTAPDAALRQANCTAFFNQIGFDPTFGTGTYSYVDPLTARFS
GSISGNPNLEEETATTWTVGAQITPRFLPGFVLSVDYYNIEIEDAINPVGSQDIVDNCVDSASIENAFCG
LIDRNPATGGFTFLRQSSLNFARQETAGVEAVMQYQFGVGPLDFTLNASGTWVDKLNNFFDPSDPTLVDP
ELGELQRPEWAGRASLTADYERFSFTWSTTYLDSMGLRAVEIEEVGNTGADTFSVANGLSGDAFIHDIQF
SFEASDMLNIYGGVNNVFGRNPFLTEQAYPVSPVGTLFFLGATVTM


>gi|302382112|ref|YP_003817935.1| TonB-dependent receptor [Brevundimonas subvibrioides ATCC 15264]
MRTAKLWLLGSAATFLMAGPVLAQSADPQTPPQEADQVDEIVVTGSRLSSGSVLQAPQPVQVVTAEVIAA
KGTVAISDLLDTLPALISSTSSAQANGGAATLNLRSLGGNRTLVLVNGRRHVSGVPGSSAVDIASIPSGL
IDRVDVLTGGASAVYGSDAVTGVVNFIIKDDFEGSQFTMQAGLSGEGDGNEMYGSFLFGTNFGEGDRGNI
TVSVEGYDRQAVFYGDRDFTRDNFLADNYPNPDLFFQIGDPIPAGQTRALGRTILVGGNPRFAGTDPALV
ARARAARAQTFINRPTFDVSSTSGLIGFDLDGSGFSTPARFFSTTQDLDGDGINDCQESRAGREGYGCYV
VDPVTGRVRPFVDGIYAGGINQSGGDGAGQTFNGTSLVPDETQIAANVFLNYEVNSAFHPYAELKAVRTT
STTYNPYNTFDDSIPIQLDNPFIPADIRRYINAEIAADPSIAGVAKVLLGRDNIDLFDPRAEEERSTYRA
VIGARGELGWNLSYDLSLNYGRTEGEARSAVRLEDRYFAAIDAVTAPNGQVVCRSTLDPTALPSKGQLGP
NPGGTIPFNTFTPGAGSACRPLNLFGLNQASQAALDFIAYTAVDLFTIEQTVVTGVLTGDSAPLFSLPGG
PIGFVIGGEYRKEKSDFNGDDFVNQGFNFESRITADVSGEFDVQEIFAELRVPLLADMPFFDELTVTGAV
RAGEYSTVGSTTTYKYDAVWAPIPDIRFRGGQAKTVRAPNISELFSPITSFNARPIDPCDENNIGLGNNP
ANRLANCRADGIPAGFTDPLTSQFAGRTGGNPNLQEEESDSFTYGIVLQPRFVPGLAVTVDYYNIEITNA
IQAVTTQDIVDSCYDGPDLTNVFCGQFTRNRNASSPTFLGFNSITTTQLNFAGLEASGIDFNVSYAFDFA
ALGRPAWGDMSLSVGGTHVEDRNDYPFATNPTQANPVELQLNNPELSLNAGIRWTIGDFTINTGHQYMGE
QALPGVEIENADNFAFAFADEIWIHDLSVRWDADDYAVTFGVNNVTNEEPFIASVATPVSSVGRYFFLRF
ATTY

>gi|94495576|ref|ZP_01302156.1| TonB-dependent outer membrane receptor [Sphingomonas sp. SKA58]
MHRTAVAARRLLAASALSTLIVAPAFAQDAAPADAGDTIVVTGSRIQRSDYNLANPLVTVTAEALEQAGN
IQLVDTLAQNPALINSLNGARTSGSNADFGAVGVQLLDLRGLGENRTLVLVNGRRHVASLAGSAAVDIST
IPNDLVEAVDVLTGGASAIYGADGVSGVVNFRLKRDFDGFKASGQVGISSRGDAGQRYGSLTYGRNFSDG
RGNIALSYEFREQDRLSSFNRARTGNPLDTYGIVRNPLDFPDDPNIPDRVPTNNLRYADSSLGGAIDVDF
DGIPDYTGEGKVYDRGTLLPSSGGLTQGGDSTPLAGYQGDLQAYNRVHNINLLSHYDFSDAVKFFFEAKY
VKNKTKTLAQPSFDFFTYLSPDNAYLQDQFGALAPDGALISRDNFDMGVRGEENERETMRFVGGFEGAIS
DHARYELSYTFGQTKSKVLLTDYRIGDRYWAAIDAVRDPATGQIVCRSTLDPTGNINPDNYDAPATTFTP
GAGSGCQPLNLLGNGSPSQAALDWVNADIMNRAKIQQHVVSGSISGDFGQFFELPGGPVGFALGAEYRKE
KSSFVPDDLLQQGALADFSLQLPERGSFDVKEVFGELSVPVLKEVPFAYNLSFGAALRLSDYSTIGKTTT
WKVDGTYAPIPDITFRGTWSEAVRAPNITELFAPLNGGFSFIGDPCDPVYIGEGTQYRAANCQAALSALG
LTPDQIAAFNPENDPTATVSLPGNSGGNRNLREETARTWTAGVVVRPSFIRGLVASFDWYDIKLKNAVNT
ATAEEVAELCVDQPSLDNVFCGNISRDPTTGYINGWFVQPQNVANFRTSGADFKLNYQFETASAGNFALS
LVGGYLNKLEFIPTPGATVDVDREEPYYPKWNATGDITWKLDKLTVNYGISWFSKTRRYEIEQTNANPDI
AESKYLWYKEKWQHDLYVAYDVDERFRFYVGANNLFDQQPSIASSNYPISYVGRYMYAGAKITM

>gi|85712231|ref|ZP_01043282.1| TonB-dependent outer membrane receptor [Idiomarina baltica OS145]
MNEQSLLARSIRTILMAGVSSAFIAAPALAQDAQQDDQDVVVSASGQEVVQSENAQVEERIQVTGSRIGR
IGAEAPSPVTVISGDDLVETGAMNIGEVLSRLPALATTFTLANSGRFIGTAGISTLNLRNMGTDRTLVLV
NGKRHVASAPGSSSVDTNTIPSAWIDRVEIITGGASAVYGADAVTGVVNFILKKNVEGLDVTATRGYAEN
SDYSNEKYTFSYGTAFAGGKGNIAVSAEYNAQDSLNALDNPWTATSTASMRYEALYGPRTEDQLDDPAYP
DNIVVPNAGYYAISNQGTVWDPFTGGILGTFNPDGSYRDTYIGDVNDTARLYCQDCDYINLRRYSEVQPE
FSRVNYNLKGNYEFTQDVNMYWNAKYVKSEGQNIGQPFFRFFSTGAAADNYPYLFKRDNPFLPEALASQM
DELGVPFLGLNRMYDDAGRRIEENTRETKRAVIGFDGMLNQDWSYDVSLVWGKSDIERVNGANVILQNME
WALDAVEDETGNIVCRSEEARADGCVPFNPFGLGMASQASQDYVTTTSVGTSEIEQTVFNATFSNSFLYE
LPAGHIGFAGGVEYRDESSVTVEDPFAKTGATFFNALGETDGQYDVSEIFGEISVPLLRDMFMVQHLNFD
AAVRYADYSTIGGATAWKVGLDWTISDELRSRFTYSEAIRAPNIDELFSGQSQSFAGVDDPCKVSNLAQL
SADGRARREANCAALGVPADFDSNYDSATLETLVGGNPDLSEETSESITAGFVYSPEWLEGFSATVDYWE
IDIDDTISGIGFQTILNRCVDAETIDNQFCNLITRDPDTSEITLIRGFALNIARSLNSGVDFEFAYDFDA
LGGQFRTNLIGTYTIEAKDYPFADEPDNYTDYAGVLGDQDLQMQLSVQYGIDNWTFGTTTRYVDRVNLYD
PTSLETNPNPSNEMQYGTYVITDVTAGYKFDNGLGLTLGVDNFFNRELPGYTTGTGAGSAIYDNIGRFAY
LRASLSF



>gi|295690838|ref|YP_003594531.1| TonB-dependent receptor [Caulobacter segnis ATCC 21756]
MSYRHILFSGAAALACALATASTAQTTAPAPEQDAATVEQVVVTGSRIRTPNLQSNVPVTSISAAQVQNT
GIVSVGDILNELPSIRSTFSSSNSTRFIGTAGLNFLDLRGLGTTRTLVLVNGRRHVSSSEGSNEVDTNTI
PTDLIDRIDVVTGGNSAIYGSDAIGGVVNFVLKRNFEGLQLRAQDGISSRGDGNAWFVSGTAGRNFAEDR
GNVALSVEYAKQEDIYFSDRRQFRERGGFVIVDSDPAGSPNGSDGIPDRIFVSDIHSLLLSEGGTFQPSC
TAGNPLTCRPDGRARLFRFQQDGTLREADYGQDFRPLANSSAGGDGSTLRRYGQLQPQTERLAVNLIGHF
DVNRAFRPYVEAKYVRNKVFQQSSPSFDQPLLLNSGDQISLDNPFLSAETRAFIAARLPAGATTFRLNRN
NLDLGVREESIRRETYRAVLGAEGDIGDAWRYDVSATYGEFKKRTLSRNNRVEQRYAYALDAVRSPTGQI
VCRVTVDPTARVPYAPDLASYVAGDVAACVPLNPFGEGAPSEAAKAYVNTTSRSDGKQTQAVFSGSISGD
TSPWFSLPAGPIGLAAGAEYRRETAREEYDELVRRGGTFLNAIPIFDPPAFSVKEAFAEIRVPVLANLPW
AEELSVNGAVRGADYSGATGKVLAYNAGVIYAPIRDVRFRANYSKSVRAPLLAELYSAPSQNFASVSDPC
DVANIGSGTATRAANCAAAGIPVGFINDEARAATTEITSAGNPRLGEETAKSWTIGAVLQPRFVPGLTVS
VDYYDIKLANVISSVAPQQVLNNCYDAANLDNAFCALFQRDPTTKFFVPGSLQDTSLNFAKRRARGVDSD
INYRFDLPQDSGTVNLRGTVTYVVQRDNYPFIDDPNRPDQILYELGDPRWAFNISAQWRKDKLTVGYQGR
YIGKMSVDVIENIKSVGGRPPQNADFATINYYPDVMYHDLTAEYAINGNYTVYGGMENVFDRLPPYRLTG
AGEGSGIYDNRGRYMYLGVKANF


>gi|119468736|ref|ZP_01611788.1| TonB-dependent receptor [Alteromonadales bacterium TW-7]
MKHYSLISNSIKCALLTAAATASSTVLAQDEQVAKKIERVEVTGSRILREGAIAPAPVTVISGDQLVNSG
AVNIGEALNNLPALGSTYSMANSGRFIGTAGLNILDLRNMGTDRTLVLVNGKRHVSSSAGSQSVDTNTIP
SVWIERVEIITGGASAVYGADAVTGVVNFILKDNIEGLDVSLTRGFADLNSYNNKKATFSYGSNFNDDRG
NAAFAVEYSGQDSLNALDHPWTSTSFSSLPNQAQTDENKNSADFPDDILTPNAGYYAINDSGVYALEDPT
KLINSFNPDSSARDLYIGNNADPYSCANCDFFNLGQFEEIQPEFERYNVNFKVNYDVTDDLNVYFDAKYV
NSQGESIGQPAFFFFDSDNSIKLDNPYLDPSIKARMQEEGVDSIMINRMMSDLGRRVENNTRETTRFVTG
LQGTVFEDWELDTSIVYGKTELERENGANMILANYFNALDAVEDANGNIVCRSAEAQADGCVPVNIMGFG
APSQQAIDYINTVSIGDSTIEQTVVSASLANGAIYELPAGYVGIAFGAEYRKEESETNEPDNAEGTFFNA
LGEDKGSFNVREVFFEATMPILTDLPLIQDLVFDTAVRHADYSTIGEATSWKLGLDWTVNDELRVRVTQS
AALRAPNISEVFGAASQTFYSVDDPCRAENLANLSNATTRSANCSALGVASDFNSGYDSASLDGLTSGNR
DVKGEESTSTTVGIVYQPEFIDNAVLTIDYWEIDLENAIDTIDAQEILDRCVDSTTGINNQYCNLITRNA
SGEISLIQNSVLNVAGQKASGVDFELGYDFDALEGSFKTRLIGTYLIERKDYPFQDDPSSYIEYAGTTGE
AKWQTNLSLTYAKDNFYSTVETRFISEVDLYTNVDLASNSNPSNQMFYGKYFITDMTVGYSFDSGLGVKV
GVDNLFNRKLPYGSRGTSAGSASYDNIGRFGYINLSYSL


>gi|294625102|ref|ZP_06703748.1| TonB-dependent receptor [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122]
MSSRTSQRIRRHRLSTALFGVLAAGNAAAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAISAEE
IRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTAVD
VNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFIGFETRAQTGLADEGNYSRSFASFSAGTDF
AGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVSVPNPAFDPTLPPSERNPQNVLSGPGGNHSTSYGGTFN
LGTFDFRNPASYGNRYLFNDDGSFRRNRYNGTVVSNTSCVDCDFVDLNAVADLQPGFDRKSVNTMINFEI
SENHRVFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGENI
ERKTYRAVLGAEGNVTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPTAV
NPHTGRVYSALAREGCVPFSVFGNGAVTPEAAAWFNTTARSQARIQQTVFSASVANSNLLSLPAGDIGFA
GGVEYRKEQSEEVTDPLAASGATFLNAIPNSGGDYSVKEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS
SIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNINRPGTAGDVA
LRQANCSALGIPVGWIDTYTATRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRDAI
GAVTAETNATRCVDNPGGIGNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDLEM
DYRFQLGQGNTVLRFVGTRLIQSREWVFQDFPQEYDEYVTYVTDPRWRAQFQTKYNWNAWRASWDMNYVD
GNLRVTPESYNSNPGSASPIKNGSYVYHNVQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSALYD
NVGRFFYLGTTVRF


>gi|294664562|ref|ZP_06729905.1| TonB-dependent receptor [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535]
MSSRTSQRIRRHRLSTALFGVLAAGNAAAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAISAEE
IRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTAVD
VNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYSRSFASFSAGTDF
AGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVSVPNPAFDPTLPPSERNPQNVLSGPGGNHSTSYGGTFN
LGTFDFRNPASYGNRYLFNDDGSFRRNRYNGTVVSNTSCVDCDFVDLNAVADLQPGFDRKSVNTMINFEI
SENHRVFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGENI
ERKTYRAVLGAEGNVTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPTAV
NPHTGRVYSALAREGCVPFSVFGNGAVTPEAAAWFNTTARSQARIQQTVFSASVANSNLLSLPAGDIGFA
GGVEYRKEQSEEVTDPLAASGATFLNAIPNSGGDYSVKEVFVESTIPLLAGLPGVDRLALDVAGRYSDYS
SIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNINRPGTAGDVA
LRQANCSALGIPVGWIDTYTATRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRDAI
GAVTAETNATRCVDNPGGIGNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDLEM
DYRFQLGQGNTVLRFVGTRLIQSREWVFQDFPQEYDEYVTYVTDPRWRAQFQTKYNWNAWRASWDMNYVD
GNLRVTPESYNSNPGSASPIKNGSYVYHNVQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSALYD
NVGRFFYLGTTVRF


>gi|21243469|ref|NP_643051.1| TonB-dependent receptor [Xanthomonas axonopodis pv. citri str. 306]
MSSRTSQRIRRHRLSTALFGVLAASAGTAAAQSDNGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAISA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVSVPNPAFDPTLPPSERNPQNVLSGPGGNHSTSYGGT
FNLGTFDFRNPASYGNRYLFNDDGSFRRNRYNGTVVSNTSCVDCDFVDLNAVADLQPGFDRKSVNTMINF
EISENHRVFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNVTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGDIVCRTTLDPT
AVNPHTGRVYSALAREGCVPFSVFGNGAVTPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIG
FAGGVEYRKEQSEEVTDPLAASGATFLNAIPNSGGDYSVKEVFVESTIPLLAGLPGVDRLALDVAGRYSD
YSSIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNTNRPGTAGD
VGLRQANCSALGIPVGWIDTYTATRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRD
AIGAVTAETNATRCVDNPGGIGNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDL
EMDYRFQLGQGNTVLRFVGTRLIQSREWVFQDFPQEYDEYVTYVTDPRWRAQFQTKYNWNAWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYVYHNFQFGYQFPGSKIDVYLGIDNALDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVRF

>gi|325928875|ref|ZP_08190038.1| outer membrane cobalamin receptor protein [Xanthomonas perforans 91-118]
MSSRTSQRTRRHRLSTALFGVLAASAGNAAAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAISA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVSVPNPGFDPTRPPSESNPQNVLSGPGGNHSTSYGGT
FNLGTFDFRNPASYGNRYLFNDDGSFRRNRYDGTVVSNTSCVDCDFVDLNAVADLQPGFDRKSVNTMINF
EISENHRVFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNLTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPT
AVNPNTGRVYSALAREGCVPFSVFGNGAVTPEAAAWFNTTARSQAKIQQTVFSASVANSNMLSLPAGDIG
FAGGVEYRKEQSEEVTDPLAASGATFLNAIPNSGGDYSVKEVFVESTIPLLAGLPGVDRLALDVAGRYSD
YSSIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNINRPGTAGD
VALRQANCSALGIPVGWIDTFTSTRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRD
AIGTVTAETNATRCVDNPGGIGNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDL
EMDYRFQIGGGNTVLRFVGTRLIQSREWVFQDFPAEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYVYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVRF


>gi|78048450|ref|YP_364625.1| TonB-dependent outer membrane receptor [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSSRTSQRTRRHRLSTALFGVLAASAGNAAAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAISA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSVGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVSVPNPGFDPTRPPSESNPQNVLSGPGGNHSTSYGGT
FNLGTFDFRNPASYGNRYVFNDDGSFRRNRYDGTVVSNTSCVDCDFVDLNAVADLQPGFDRKSVNTMVNF
EISENHRVFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNLTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPT
AVNPNTGRVYSALAREGCVPFSVFGNGAVTPEAAAWFNTTARSQAKIQQTVFSASVANSSLLSLPAGDIG
FAGGVEYRKEQSEEVTDPLAASGATFLNAIPNSGGDYSVKEVFVESTIPLLAGLPGVDRLALDVAGRYSD
YSSIGSTKTWNVGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNINRPGTAGD
VALRQANCSALGIPVGWIDTFTSTRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRD
AIGAVTAETNATRCVDNPGGIGNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDL
EMDYRFQIGGGNTVLRFVGTRLIQSREWVFQDFPAEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYVYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVRF


>gi|83858580|ref|ZP_00952102.1| putative TonB-dependent receptor with TonB-box [Oceanicaulis alexandrii HTCC2633]
MSYKNLKTWALASSLLAGLGAVSAPALAQEEGADAQQDIIQVTGTRIQRGNMTEATPVNTFNSEQFELSG
AVNTAELLRTLPAVGVSSLTSTNSNFTVASSGVNTIELRNLTEDRTLVLMNGRRFVAGLPGTNNVDFNSI
PTELIDRVDVVTGGASAVYGSDALAGVVNVILKDDFEGVVASTQAGISDEGDDETYRASLTMGSMFDQGR
GNAVVSTTWSRENGVYARDREGLDRDGLSRAYFDPTVENWQEDVIPYYSSYSERGRILIPGLSAGGTPTN
AANLVFDETTGQVRPFTSANPDGSALDGFNRQAYRAIAVPTERFTFSSLVNYEVNEKMNFFFEGTYASTE
TTSSLEPFALASDDVFGDNAAQFVDVDGDGVYDRSTNGISILNPYVPLAMRQAARDAADFDGDGIQDVAD
EDLVVGFVRRMTEVGQRASANTRQTARIVFGLEGDLTDNWSYEVSANLGRTTQSQRSSGQVNVLNLRQAL
NATTLNGEIVCADEIARAQGCVPVNIFGKGSISPEAAAYINAPSSRQAEITQQVYSGFLSGDLGFASPFA
EENVQVVVGAEYRSEESESVPDALSQSGLNGGNVSPAVYGDFQVAELFAEAEIPLVQGRQYVEDLRLNLS
ARASDYTTVGQTFAWAANVQYTPIDMLRFRAQYSESVRAPNIGELFQPPSETFEGADDVCAGLTLSGSDP
AFFNAADDATSGVDSSTVNSSLAQACFADPSVAARVDRDGFYIPTQGEIQGIAGFNGGNPNLSEETATSI
TLGAVFSPEFGNQWIDNFALSVDYYNIEIEDAIAGIARQTSVNQCYDNGTGAYNANSVFCSNIVRYNSGP
SIGAIKELNALQQNLATIETAGIDVQASYFLGLNDVFTNSSWGLGDLNFTLTYGYLEKWEQQAFPGAEVI
DYSDTAGLFEHEVLFSTVYRNGPLTVAYDMNWMPETRLEATGDLSEAMVPSATFQDVQVRWAFENQLELV
FGVDNLTDEFIKYGQGFDSTGTGTDGAIYDAIGRRWYVGARKTF


>gi|21232003|ref|NP_637920.1| TonB-dependent receptor [Xanthomonas campestris pv. campestris str. ATCC 33913]
MSSRSLHRTRRHRLSAALLAVLVAPAGHALAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAITA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVTVPNPAYDPTRPPSERNPQNVLSGPGGNHSTSYGGT
FNLGTFDFRNPASYGNRYLFNEDGTFRRNRYDGTVVSNTSCVDCDFADLNAVADLQPGFDRKSVNTMVNF
ELSENHRLFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNFTDNWTYDVSANYGKTTVDRQNLNNRINERWQAGIDAARDASGNIVCRTTLDPN
AINPNTNRVYSALAREGCVPFSVFGNGAVSPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIG
IAGGVEYRKEQSEEITDPLAASGVTFLNAIPNSGGEYTVREVFVESTIPLLAGLPGVDRLALDLAGRYSD
YSSIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLSSNSNRPGTAGD
VALRQANCSALGVPVGWIDTYTANRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSVDYWRIDLQD
AIGSVTAETNSTRCVDNPGGINNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDL
EMDYRFQLGEGNTVLRLVGTRLIQSREWVFQDFPEEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYTYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVKF


>gi|188990985|ref|YP_001902995.1| TonB-dependent outer membrane receptor precursor [Xanthomonas campestris pv. campestris str. B100]
MSSRSLHRTRRHRLSAALLAVLVAPAGHALAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAITA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVTVPNPAYDPTRPPSERNPQNVLSGPGGNHSTSYGGT
FNLGTFDFRNPASYGNRYLFNEDGTFRRNRYDGTVVSNTSCVDCDFADLNAVADLQPGFDRKSVNTMVNF
ELSENHRLFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNFTDNWTYDVSANYGKTTVDRQNLNNRINERWQAGIDAARDASGNIVCRTTLDPT
AINPNTNRVYSALAREGCVPFSVFGNGAVSPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIG
IAGGVEYRKEQSEEITDPLAASGVTFLNAIPNSGGEYTVREVFVESTIPLLAGLPGVDRLALDLAGRYSD
YSSIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLSSNSNRPGTAGD
VALRQANCSALGVPVGWIDTYTANRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSVDYWRIDLQD
AIGSVTAETNATRCVDNPGGINNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDL
EMDYRFQLGEGNTVLRLVGTRLIQSREWVFQDFPEEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYTYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVKF


>gi|66767870|ref|YP_242632.1| TonB-dependent receptor [Xanthomonas campestris pv. campestris str. 8004]
MSSRSLHRTRRHRLSAALLAVLVAPAGHALAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAITA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVTVPNPAYDPTRPPSERNPQNVLSGPGGNHSTSYGGT
FNLGTFDFRNPASYGNRYLFNEDGTFRRNRYDGTVVSNTSCVDCDFADLNAVADLQPGFDRKSVNTMVNF
ELSENHRLFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNFTDNWTYDVSANYGKTTVDRQNLNNRINERWQAGIDAARDASGNIVCRTTLDPN
AINPNTNRVYSALAREGCVPFSVFGNGAVSPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIG
IAGGVEYRKEQSEEITDPLAASGVTFLNAIPNSGGEYTVREVFVESTIPLLAGLPGVDRLALDLAGRYSD
YSSIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLSSNSNRPGTAGD
VALRQANCSALGVPVGWIDTYTANRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSVDYWRIDLQD
AIGSVTAETNATRCVDNPGGINNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLARSRRVGVDL
EMDYRFQLGEGNTVLRLVGTRLIQSREWVFQDFPEEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYTYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVKF


>gi|325916913|ref|ZP_08179158.1| outer membrane cobalamin receptor protein [Xanthomonas vesicatoria ATCC 35937]
MSAALLVALVAPAGHVVAQSENGVAPDTTDLDKVTVTGSRIARTGFVTPSPVTAITAEEIRATGATTISD
LMARMPALAPTYTLGNSTRFIGTAGLGLLDLRGMGTDRTLVLVNGRRHVGSSPGSTAVDVNTIPVEWVER
VEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGTDFAQGRGNIAISG
EYSKQDRFGRGNRAIGREYLVSVQNPGFDPSRPPSESNPQTVLSGPGGNHSTSYGGTFNLGTFDFRNPAT
YGNRYLFNDDGTFRRNRYNGTVVSNTSCVDCDFADLNAVADLQPGFDRKSVNTMVNFELSENHRLFFEGK
YSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGENIERKTYRAVLGA
EGNFTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDANGNIVCRTTLDPNAINPNTNRVYSAL
AREGCVPFSIFGNGAVTPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIGVAGGVEYRKEQSE
EITDPLAASGVTFLNAIPNSGGEYTVKEVFVESTIPLLAGLPGVDRLALDVAGRYSDYDSIGSTKTWNIG
LDWTILPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNSNRPGTAGDVALRQANCSALGV
PVGWIDTYTATRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLQDAIGTVTAETNATR
CVDNPGGINNSFCGFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLSRSRRVGVDLEMDYRFQLGEGNT
VLRLVGTRLIQSREWVFQDFPAEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNYVDGNLRVTPESYN
SNPGSASPIKNGSYTYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFNSALYDNVGRFFYLGTT
VRF


>gi|325923376|ref|ZP_08185046.1| outer membrane cobalamin receptor protein [Xanthomonas gardneri ATCC 19865]
MSTALFAVLAASAGQAAAQSENGVAPGTTDLDKVTVTGSRIARTGFVTPSPVTAISAEEIRATGATTISD
LMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTAVDVNTIPVEWVER
VEVITGGASAVYGADAVAGVVNFILKKNFTGFETRAQTGLANEGNYNRSFASFSAGTDFAEGRGNIAVSG
EYSKQDRLGRGNRAIGREYLVSVQNPNFDPTRPPSESNPQNVLSGPGGNHSTSYGGTFNLGTFDFRNPAS
YGNRYLFNDDGSFRRNRYNGTVVSNTSCVDCDFADLNAVADLQPGFDRKSVNTMINFEISENHRLFFEGK
YSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGENIERKTYRAVLGA
EGNFTDNWTYDVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPTAINPNTNRVYSAL
AREGCVPFSVFGNGAVTPEAAAWFNTTARAQAKIQQTVFSASVANSNLLSLPAGDIGFAGGVEYRKEQSE
EITDPLAASGVTFLNAIPNNGGEYTVKEIFVESTIPLLAGLPGVDRLALDVAGRYSDYDSIGSTKTWNVG
LDWTIIPSLRLRGTVAQAVRAPSIGELYYSQSENFATINDPCNYLPTNSNRPGTAGDVALRQANCSALGV
PVGWIDTFTSTRPGVSGGNPELKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLQDAIGTVTAETNATR
CVDNPGGIDNSFCSFVQRAPLGGFTDPQGRIYPEHSIIGWQALNENLSRSRRVGVDLEMDYRFQIGQGNT
VLRFVGTRLIQSREWVFQDFPAEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNYVDGNLRVTPESYN
SNPGSASPIKNGSYTYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFNSALYDNVGRFFYLGTT
VRF

>gi|113968469|ref|YP_732262.1| TonB-dependent receptor [Shewanella sp. MR-4]
MAIESYLTKAVRVALVASTASIMFGASAYAAEDAPGANKKEEVERIAVTGSRIIREGAIAPTPVTVITGE
ELLSTGVTNIGEALNQLPALGSTYSLANSGRFIGTSGLNLLDLRNMGTDRTLVLVDGRRHVASSSGTSSV
DINTIPSTWVEKVEVITGGASAIYGADAVTGVVNFILKKHVTGLDVSTTLGTAEDSNFTKKRFSVSYGTD
FDNGRGNIAGAFEYSGQNQLKAFDRDQTATSFASITNSNRPNGDENDPAYPDKILTPNAGHYRISNAGTF
NLNGWKTFNPDGSIKDVYIGPNSDGGYCADCDYTNLNQFVELQPEFDRYNFNVKGNYAISDDMNFYAEGK
YVRSKSHDMFQPAFFFFNPVNTISIDNAFIQDDLRDLMTANGKTSLTINRFTTDLGLRLEDDTRETQRYV
VGLEGNLLEDWSYDVFATYGQTDLERVNRNNLVYANYENALDSILVDGVAVCRDEAARAAGCVPVNIFGD
GQASQGARDYINTTSTGSSVIKQTVLGGSVTNSALFDLPAGAVGFSAGVEYRKEESEVFEPDNAEGTFFN
VLGEDKGDFDVKEVFAEISVPLLSDLPLVRQLDAELAARYANYSTIGSATTWKAGLSWEVYDDLRIRSTY
SEAIRAPNISELFGAQSQNFFNVDDSCKSSELDNLANSELRRQNCAALGIPTSFDSDYDSASVDGFSGGN
RELKAEESTSYTVGGVFQPSFVDGLVLTVDYWNIKIDDAISAVSAQDIIDKCVDSPSGVNNEYCALITRD
PNSHEITSIRQYALNISSLEAAGIDFDIGYNFELFGGDLRSNLIATKLLKRRDYSFQDEPDVYENYVGVV
GTPEWQANLTFNYSWNSWQATWRTRFIEGVSLYTDQELAVNANPNSLLSYGDYYISDMGIGYNFDNGIEL
KVGVDNLFNKDLPYGSTGTTAGSAAYDNIGRFFYTTISFSL


>gi|117921501|ref|YP_870693.1| phosphatidylglycerophosphatase [Shewanella sp. ANA-3]
MKKKLLTLAIQASMFGIAPSVAWAADSIEVSAVNESANRVEVEVADKQESIEKVTVTGSRIKRDSFSLST
PLQGLDAKDIADSGIGSLADILVDQIPALSEGVSSTNSQSSVQNTGLSTIDLRDLGTDRTLTLIDGRRVV
SNSYSGNYVSLSTIPAAMVDKVEIITGGASAVYGSDAIAGVVNIITQQNKTGFEINARGGETTEGGGRET
TVDVGYGTDFNGDKGYIFASATYDKQHGLFATDRERALYESSFAYDAKQMCNAMNTVDGDQCMRDITRDD
WRERSNDIVGGRFKSNSWWYDGTELKTDFKEERDGYNGYTTGLLKVPEDTLAAAVKMNYDLSDDVRANVQ
VQFSRNNAFRRTDAEGQDYNDAELYIDPVTGLPGTIAAGSISPNNPYVPAEIAATAGKSITWDRRFQEVG
PVESDNERTTLRTWAGLQGNLFETWTWDASLGYGKFEQRQRRSNEISIRRLQYALDAEYADDGVTIQCAS
EEARAEGCVPVNIFGEGSISKEGADYIRANPYINTDITQFNALGFISGELFELPAGGVQSAFGVEYRRDT
QAVDTDKAMRGDAITFNDVPPFEGDVTVWEAFGEANLPLLRDEAFANKLDLDVSLRLADYSQKNIDLMSS
YRAGILWEPIANYALRANYSRSQRAPNITELISPPRGDYDSIRDICDGVTATSTGAGHDSCRQDPGIAAA
IATNGVFEDEGGSKYSPNAGNENLTEETADTYTLGFTMAPAFLEGFNLAVDYYDIKVTDAIGSLSNEDIL
AECYNSSNPYGADNEYCQVISRDTEGQITQVIQQEQNLNDIVTRGVDIAMAYEWQLDGYGELSLKTNWTH
VLEFSTSYYGADGLVEDDYVGELASGIFEDRGAISLTWSNDDWRVRWSAKYKSAMVDSHDRVEEWNVLRA
ENQAKLDAGDASAVANPETPAFLFYSSYITHDLSVSYTMDVSQAELRLYGGVRNIFDNQGPWVADTGDLV
ETGNGNYSSAYGGGVGRYAYLGAELKF


>gi|289669422|ref|ZP_06490497.1| TonB-dependent receptor [Xanthomonas campestris pv. musacearum NCPPB4381]
SYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTAVDVNTIPVEWVERVEVITGGASA
VYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGTDFAGGRGNIAVSGEYSKQDRFGR
GNRAIGREYLVSVPNPAFDSTRPPSESNPQNVLSGPGGNHSTSYGGTFNLGTFDFGNPASYGNRYLFNDD
GSFRRNRYNGTVASNTSCVDCDFVDLNAVADLQPGFDRKSVNTMINFEISENHRLFFEGKYSETDSEFFG
QPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGENIERKTYRAVLGAEGNFTDNWTY
EVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPTSVNPNTGRVYSALARDGCVPFSV
FGNGAVTPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIGIAGGVEYRKEQSEEVTDPLAASG
VTFLNAIPNSGGEYNVREAFVESTIPLLAGLPGVDRLALDVAGRYSDYSSIGSTKTWNIGLDWTIIPSLR
LRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNTNRPGTAGDVALRQANCSALGIPVGWIDTYTA
TRPGVSGGNPDLKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRDAIGTVTAETNATRCVDNPGGIGN
NFCGFVQRAPLGGFTDPQGRIYPEHSITGWQALNENLARSRRVGVDLEMDYRFQIGEGNTVLRFVGTRLI
QSREWVFQDFPQEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNYVDGNLRVTPESYNSNPGSASPIK
NGSYVYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSALYDNVGRFFYLGTTVRF

>gi|289663198|ref|ZP_06484779.1| TonB-dependent outer membrane receptor [Xanthomonas campestris pv. vasculorum NCPPB702]
MSSRTSQRIRRHRLSSALFGVLAVSAGHAAAQSENGVAPDTTDLDKVTVTGSRIARTGFVAPSPVTAISA
EEIRATGATTISDLMARMPALAPSYTLGNSTRFIGTAGLGLLDLRGMGVDRTLVLVNGRRHVGSSPGSTA
VDVNTIPVEWVERVEVITGGASAVYGADAVAGVVNFILKKSFTGFETRAQTGLADEGNYNRSFASFSAGT
DFAGGRGNIAVSGEYSKQDRFGRGNRAIGREYLVSVPNPAFDSTRPPSESNPQNVLSGPGGNHSTSYGGT
FNLGTFDFGNPASYGNRYLFNDDGSFRRNRYNGTVASNTSCVDCDFVDLNAVADLQPGFDRKSVNTMINF
EISENHRLFFEGKYSETDSEFFGQPAFDSSLRVRRQNPYVSPELGALMDSRGATQILMNRFNVDAGRRGE
NIERKTYRAVLGAEGNFTDNWTYEVSANYGKTTVDRLNLNNRINERWQAGIDAARDASGNIVCRTTLDPT
SVNPNTGRVYSALARDGCVPFSVFGNGAVTPEAAAWFNTTARSQAKIQQTVFSASVANSNLLSLPAGDIG
IAGGVEYRKEQSEEVTDPLAASGVTFLNAIPNSGGEYNVREAFVESTIPLLAGLPGVDRLALDVAGRYSD
YSSIGSTKTWNIGLDWTIIPSLRLRGTLAQAVRAPSIGELYDSQSENFATINDPCNYLPTNTNRPGTAGD
VALRQANCSALGIPVGWIDTYTATRPGVSGGNPDLKPERARSLSYGLVWQPEFFEGFGMSIDYWRIDLRD
AIGTVTAETNATRCVDNPGGIGNNFCGFVQRAPLGGFTDPQGRIYPEHSITGWQALNENLARSRRVGVDL
EMDYRFQIGEGNTVLRFVGTRLIQSREWVFQDFPQEYDEYVTYVTDPRWRAQFQTKYNWNEWRASWDMNY
VDGNLRVTPESYNSNPGSASPIKNGSYVYHNFQFGYQFPGSKIDVYLGIDNAFDKDPPRNYFGSDFTSAL
YDNVGRFFYLGTTVRF


>gi|170726613|ref|YP_001760639.1| TonB-dependent receptor [Shewanella woodyi ATCC 51908]
MNKKLITIAIQTAIMGGALSLAPQVYAADDTEIAKPKLEATADEQGKEPEIQEKITVTGSRLRRDSFSIT
TPLAVLGRDDIEDTGLGSLAEILVEELPQISEGSSNSNSQSSVQNTGLSTIDLRELGTNRTLTLIDGRRV
VSNSYSGNYVSLSTIPSGMVERVEVITGGASAAYGSDAIAGVVNIITQQDKEGFSFKARGGESTEGGAKE
FTLDLDYGTEFADDRGYLFFSSTYDKQYGLSYWDRDRAQQQESWRYNTAEMCNAMYSEDNTSSKGTCMRD
MTQADWRNLSDSIAGGVFDEKSSYKPDSGFWYDENGLRDDWHEEKYGRDFNQFVMLKVPDEAISAAIKVD
FELTDDIQSYFQVQYSENRSINQKSPESEDEFDGIVVIDPVTGESSQIGAGRIPKNNPYMPQEIYDQASS
KGVKWDRGFDEVGNIINDNTRKTIRSWAGLQGTIFDGNWDWDLSVGYGKFTQEQTRYNELYIANLTHALN
AEKLDDGTIQCADADARAAGCVPINLFGEGSITPEAADYIRATPTISTDVQQTTVLGYIAGDLFEMPAGP
VASAFGFEYRKDEQSVDTNVPLGGVSFNYVPTFSGDVSVYEVFGEAAFPLLKDVAGAKSLTAEVSARLAD
YSWSGTGLIQSYKTGVTWQPVEGYAIRANWARAQRAPSITELLSPPRGDYDSFDDICEGTTLTSTDAGHD
NCRLEPGIAAVIADGSEFEDDNNGYSPNVGNSELKEETADTYTLGITLAPEFAEGLRIAVDYYDITISDA
ISSFSNEDIIDYCYNSSLDFGDDNNFCNDIQRDAEGQITTVNQRVYNVDEIKTNGFDFAAEYRYELDKYG
SLKFKADWTHVIGYEQTVQSPEGPATTNYEGDLSQDIFEDKVTASLSWYYDDAWRVRWSTRFKSAVVASR
SVYDDWEKAITKNNEYCADGSDKCVLEPEALDDSFYNLPSYITHNLSVSYTLDLANDGELRFFGGVNNIF
DDRGPFMAIGGRGNFDSNYGGGKGRFAYAGAEFKF


>gi|85713344|ref|ZP_01044360.1| hypothetical protein OS145_10867 [Idiomarina baltica OS145]
MEFFGEVGFVKDRSVSQIAESGAFFPQVDLSCDNPFLSPQQASVLCGPGGPATVSGDPNVWEGVYIGKRN
VEGGPRQNDIQHLSYRGVFGIRGYLNDTWSYDVSANFGNVTLSSTYLNDFSITNIGRALNVTTDPDTGEA
VCTAALSGVDPNCVPWNIFAPNITQDALDYLTLPLYANGETNLREYTAYVIGNLGDYGIRSPYAVGGVEL
LLGATTRSEELVFQPDSGFTSGDGAGQGGPTIGVSGSLSVDEIFSEAKIYLVEGADWADTLTMDLGYRYS
EYSTAKETDTYKLALGWDINEMWKVRGSFQRSARHANIRELYQAQSIGLYDMDSDPCGGADPEATLEECQ
RTGVTSAQYGNIPQSPANQYNSISGGNPDLEPETSDTISVGFVYRTMEGDFDVSLDYFDIKVEDAIGIVA
AETTLDLCLDTGDAQFCDLINRGPETGSLWLGQDNIIATNVNIGFEQRSGFDLNSSYTIRFDNDFGKLKF
NLVGTYFTKFDTQPVVGLRVYECAGYWGGVCGAPNPEWQHNLRATWENNDGLAVSANWRYLGETQQLDSG
PQDIDAENYLDLTARYRWGDNTTISVGVNNVLENDPPYLTGAPGSNGNTYPGYFDALGRYVFASISYQFM

>gi|83858794|ref|ZP_00952316.1| TonB-dependent outer membrane receptor [Oceanicaulis alexandrii HTCC2633]
MTEFTKSRGLRALALAGASLSALIAAPAFAQSAEDETADEAQSRDTIVITGSRIQSDGTLEAPSPVVAVG
GDDIRTSGQIDITALLRESPQLQASLPGTFSAFNGTPLGASLLNLRNLGTTRTLVIENGRRHVAGIEGTS
SVDVNTISTALLSRVEVLTGGASAVYGADAVTGVVNFIMRDGASFDGMEVRTQAGISSESDAEEYFISLA
NGFESADGRADIVFAAEYQSTESIEAGDRDFGGTGLFSLVPNGPATGIDPRFSNVWLPNYRLPISSHYGI
IALGDGGASAFVEAVSSGGVPGCDTLGLAGIPTCQIVDETGTLRPYNPGDIFIDGFNASGGDGVFAEPDD
ELLLPQTDRFLFQTAFSYELTENVEFFADAKYVFTETIESNQVNGFNDDIPISEDNPFIPAALRAQLATL
RAEGIDPVIAISRDVLDTTTRSNPVAERKTMRGVAGFRGFIPQLGFDWEMSYTYGRTDADITSRLRLEDR
YFAAIDAVIDPSTGDIVCRSDIDPTANVPPSSPYPAQNAGFQITTFTPGDGQCVPINIMGANSISQEAAD
FIFQPATAQNEIEQRDFLATLSGTSEQFFSLPAGPIGFALGYEYRKEESAFTPDAYSAAGLTFGTINSNG
GPTNASSGLIEVSEFFGELQVPIISDVPFIQDFELNGAYRYSDYDTFGETDTWSVGARWTIIDSLTVRST
LSRAVRIPNITEAFSPNFTVSLGASNDPCNPQFIDAGSQFRRANCEALIGIPIDTYNSTDYVSARIPGQS
GGNPDLEPEEADSFTLGAIWRPVEDFGGLFDGLTVTVDYYKIEIDGLIDQLGAFDIAQNCVDAPTINNQF
CAAIDRDPTIGFITGFRSGFVNLAAVETSGIDWRIEYAFDMPSILGLEDAGELRLSSLGTNFLSNEETRD
VSAPDEITDVLTTMSRPEWIFNLNATWAIGDLSLGWKGRYESEQLLGGIELDDLESDPNFANITHADGAW
VHDFSISYFLKDELEIYGGINNAFDEEPYLGQYSRPAGPRGRFFYAGVNATF