Site undergoing maintenance! No connection possible during this time!

Forum "Multiple sequence alignements"

Thread subject: multiple sequence allignment

[ Return to forums ]
multiple sequence allignment
B_hajra
27 Apr 2011 9:52
Non evaluated contribution
gi|254526778|ref|ZP_05138830.1      --------------------------------------------------
gi|157414263|ref|YP_001485129.      --------------------------------------------------
gi|78780134|ref|YP_398246.1|_A      --------------------------------------------------
gi|126697185|ref|YP_001092071.      --------------------------------------------------
gi|123969398|ref|YP_001010256.      --------------------------------------------------
gi|33862213|ref|NP_893774.1|_A      --------------------------------------------------
gi|123967080|ref|YP_001012161.      --------------------------------------------------
gi|87123285|ref|ZP_01079136.1|      --------------------------------------------------
gi|116074349|ref|ZP_01471611.1      --------------------------------------------------
gi|148238400|ref|YP_001223787.      --------------------------------------------------
gi|113955227|ref|YP_729302.1|_      --------------------------------------------------
gi|78211619|ref|YP_380398.1|_A      --------------------------------------------------
gi|260435985|ref|ZP_05789955.1      --------------------------------------------------
gi|78183645|ref|YP_376079.1|_A      --------------------------------------------------
gi|116071741|ref|ZP_01469009.1      --------------------------------------------------
gi|33864599|ref|NP_896158.1|_A      --------------------------------------------------
gi|33862334|ref|NP_893894.1|_A      --------------------------------------------------
gi|124021783|ref|YP_001016090.      --------------------------------------------------
gi|254431561|ref|ZP_05045264.1      --------------------------------------------------
gi|318043032|ref|ZP_07974988.1      --------------------------------------------------
gi|87301612|ref|ZP_01084452.1|      --------------------------------------------------
gi|148241164|ref|YP_001226321.      --------------------------------------------------
gi|33241266|ref|NP_876208.1|_A      --------------------------------------------------
gi|159904324|ref|YP_001551668.      --------------------------------------------------
gi|72383093|ref|YP_292448.1|_A      --------------------------------------------------
GOS_2357010_Genomic_DNA__Carib      TTAAAAACTTATAATCGATGGCTAAATTCGACGCCCATCTTAAATGTTCA
                                                                                      

gi|254526778|ref|ZP_05138830.1      --------------------------------------------------
gi|157414263|ref|YP_001485129.      --------------------------------------------------
gi|78780134|ref|YP_398246.1|_A      --------------------------------------------------
gi|126697185|ref|YP_001092071.      --------------------------------------------------
gi|123969398|ref|YP_001010256.      --------------------------------------------------
gi|33862213|ref|NP_893774.1|_A      --------------------------------------------------
gi|123967080|ref|YP_001012161.      --------------------------------------------------
gi|87123285|ref|ZP_01079136.1|      --------------------------------------------------
gi|116074349|ref|ZP_01471611.1      --------------------------------------------------
gi|148238400|ref|YP_001223787.      --------------------------------------------------
gi|113955227|ref|YP_729302.1|_      --------------------------------------------------
gi|78211619|ref|YP_380398.1|_A      --------------------------------------------------
gi|260435985|ref|ZP_05789955.1      --------------------------------------------------
gi|78183645|ref|YP_376079.1|_A      --------------------------------------------------
gi|116071741|ref|ZP_01469009.1      --------------------------------------------------
gi|33864599|ref|NP_896158.1|_A      --------------------------------------------------
gi|33862334|ref|NP_893894.1|_A      --------------------------------------------------
gi|124021783|ref|YP_001016090.      --------------------------------------------------
gi|254431561|ref|ZP_05045264.1      --------------------------------------------------
gi|318043032|ref|ZP_07974988.1      --------------------------------------------------
gi|87301612|ref|ZP_01084452.1|      --------------------------------------------------
gi|148241164|ref|YP_001226321.      --------------------------------------------------
gi|33241266|ref|NP_876208.1|_A      --------------------------------------------------
gi|159904324|ref|YP_001551668.      --------------------------------------------------
gi|72383093|ref|YP_292448.1|_A      --------------------------------------------------
GOS_2357010_Genomic_DNA__Carib      TTTTGCGGGAAGTCACAAGACCAAGTAAGAAAGCTTATAGCTGGTCCTGG
                                                                                      

gi|254526778|ref|ZP_05138830.1      --------------------------------------------------
gi|157414263|ref|YP_001485129.      --------------------------------------------------
gi|78780134|ref|YP_398246.1|_A      --------------------------------------------------
gi|126697185|ref|YP_001092071.      --------------------------------------------------
gi|123969398|ref|YP_001010256.      --------------------------------------------------
gi|33862213|ref|NP_893774.1|_A      --------------------------------------------------
gi|123967080|ref|YP_001012161.      --------------------------------------------------
gi|87123285|ref|ZP_01079136.1|      --------------------------------------------------
gi|116074349|ref|ZP_01471611.1      --------------------------------------------------
gi|148238400|ref|YP_001223787.      --------------------------------------------------
gi|113955227|ref|YP_729302.1|_      --------------------------------------------------
gi|78211619|ref|YP_380398.1|_A      --------------------------------------------------
gi|260435985|ref|ZP_05789955.1      --------------------------------------------------
gi|78183645|ref|YP_376079.1|_A      --------------------------------------------------
gi|116071741|ref|ZP_01469009.1      --------------------------------------------------
gi|33864599|ref|NP_896158.1|_A      --------------------------------------------------
gi|33862334|ref|NP_893894.1|_A      --------------------------------------------------
gi|124021783|ref|YP_001016090.      --------------------------------------------------
gi|254431561|ref|ZP_05045264.1      --------------------------------------------------
gi|318043032|ref|ZP_07974988.1      --------------------------------------------------
gi|87301612|ref|ZP_01084452.1|      --------------------------------------------------
gi|148241164|ref|YP_001226321.      --------------------------------------------------
gi|33241266|ref|NP_876208.1|_A      --------------------------------------------------
gi|159904324|ref|YP_001551668.      --------------------------------------------------
gi|72383093|ref|YP_292448.1|_A      --------------------------------------------------
GOS_2357010_Genomic_DNA__Carib      GGTTTATATCTGTGATGAATGCATAGACCTTTGTAATGAGATTCTCGATG
                                                                                      

gi|254526778|ref|ZP_05138830.1      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|157414263|ref|YP_001485129.      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|78780134|ref|YP_398246.1|_A      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|126697185|ref|YP_001092071.      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|123969398|ref|YP_001010256.      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|33862213|ref|NP_893774.1|_A      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|123967080|ref|YP_001012161.      -----------------------------MAKFDAHLKCSFCAKSQDQVR
gi|87123285|ref|ZP_01079136.1|      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|116074349|ref|ZP_01471611.1      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|148238400|ref|YP_001223787.      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|113955227|ref|YP_729302.1|_      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|78211619|ref|YP_380398.1|_A      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|260435985|ref|ZP_05789955.1      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|78183645|ref|YP_376079.1|_A      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|116071741|ref|ZP_01469009.1      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|33864599|ref|NP_896158.1|_A      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|33862334|ref|NP_893894.1|_A      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|124021783|ref|YP_001016090.      -----------------------------MAKFDAHLKCSFCGKSQDQVR
gi|254431561|ref|ZP_05045264.1      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|318043032|ref|ZP_07974988.1      -----------------------------MPKFDAHLKCSFCGKSQDQVR
gi|87301612|ref|ZP_01084452.1|      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|148241164|ref|YP_001226321.      -----------------------------MAKFDAHLKCSFCGKSQEQVR
gi|33241266|ref|NP_876208.1|_A      -----------------------------MAKFEAHLKCSFCGKSQEQVR
gi|159904324|ref|YP_001551668.      -----------------------------MAKFEAHLKCSFCGKSQEQVR
gi|72383093|ref|YP_292448.1|_A      -----------------------------MAKFEAHLKCSFCGKAQDQVR
GOS_2357010_Genomic_DNA__Carib      AAGAGCTACTTGATAATCAAGCGAACACAAACAACTCTCCACAAGCAAAA
                                                                  .   .  .*. *. .   .

gi|254526778|ref|ZP_05138830.1      KLIAGPGVYICDECIDLCNEILDEELLDNQAHTN----------------
gi|157414263|ref|YP_001485129.      KLIAGPGVYICDECIDLCNEILDEELLDNQTNTN----------------
gi|78780134|ref|YP_398246.1|_A      KLIAGPGVYICDECIDLCNEILDEELLDNQANTN----------------
gi|126697185|ref|YP_001092071.      KLIAGPGVYICDECIDLCNEILDEELLDNQANTN----------------
gi|123969398|ref|YP_001010256.      KLIAGPGVYICDECIDLCNEILDEELLDNQANTN----------------
gi|33862213|ref|NP_893774.1|_A      KLIAGPGVYICDECIDLCNEILDEELIDTQAKIN----------------
gi|123967080|ref|YP_001012161.      KLIAGPGVYICDECIDLCNEILDEELIDTQAKLN----------------
gi|87123285|ref|ZP_01079136.1|      KLIAGPGVYICDECIDLCNEILDEELIDAQGNPR----------------
gi|116074349|ref|ZP_01471611.1      KLIAGPGVYICDECIDLCNEILDEELIDAQGNPR----------------
gi|148238400|ref|YP_001223787.      KLIAGPGVYICDECIDLCNEILDEELIDSQGGSR----------------
gi|113955227|ref|YP_729302.1|_      KLIAGPGVYICDECIDLCNEILDEELIDAQGNPR----------------
gi|78211619|ref|YP_380398.1|_A      KLIAGPGVYICDECIDLCNEILDEELVDGQGNSR----------------
gi|260435985|ref|ZP_05789955.1      KLIAGPGVYICDECIDLCNEILDEELVDGQGNPR----------------
gi|78183645|ref|YP_376079.1|_A      KLIAGPGVYICDECIDLCNEILDEELVDSQGNPR----------------
gi|116071741|ref|ZP_01469009.1      KLIAGPGVYICDECIDLCNEILDEELVDSQGNPR----------------
gi|33864599|ref|NP_896158.1|_A      KLIAGPGVYICDECIDLCNEILDEELVDSQGNRG----------------
gi|33862334|ref|NP_893894.1|_A      KLIAGPGVYICDECIDLCTEILDEELVDSQGNPR----------------
gi|124021783|ref|YP_001016090.      KLIAGPGVYICDECIDLCTEILDEELVDSQGNPR----------------
gi|254431561|ref|ZP_05045264.1      KLIAGPGVYICDECIDLCNEILDEELVDTHGSGGG---------------
gi|318043032|ref|ZP_07974988.1      KLIAGPGVYICDECIDLCNEILDEELVEGHGSG-----------------
gi|87301612|ref|ZP_01084452.1|      KLIAGPGVYICDECIDLCNEILDEELVESHGSAR----------------
gi|148241164|ref|YP_001226321.      KLIAGPGVYICDECIDLCNEILDEELVDGQAGAR----------------
gi|33241266|ref|NP_876208.1|_A      KLIAGPGVYICDECIDLCNEILDEELLENPSKVK----------------
gi|159904324|ref|YP_001551668.      KLIAGPGVYICDECIDLCNEILDEELIDNQTKTR----------------
gi|72383093|ref|YP_292448.1|_A      KLIAGPGVYICDECIDLCNEILDEELIDNPTHQR----------------
GOS_2357010_Genomic_DNA__Carib      AAGAAATTACCAACTGATAATCCAAAAAAATCTGTTCCTTTAGAATTAAC
                                       *.. .  *  * .                                  

gi|254526778|ref|ZP_05138830.1      -------------NSQQVKKKLPNDNPKKSVPLELTSIPKPLEIKSFLDN
gi|157414263|ref|YP_001485129.      -------------NSQQVKKKLPNDNPKKCVPLELTSIPKPLEIKSFLDN
gi|78780134|ref|YP_398246.1|_A      -------------NSPQVKKKLTNDNPKKSVPLELTSIPKPLEIKSFLDN
gi|126697185|ref|YP_001092071.      -------------NSPQVKKKLPTDNPKKSVPLELTSIPKPLEIKSFLDN
gi|123969398|ref|YP_001010256.      -------------NPPQVKKKLPTDNPKKSVPLELTSIPKPLEIKSFLDN
gi|33862213|ref|NP_893774.1|_A      -------------NSPQVKKKLPTNNSDKSIPLELTSIPKPLEIKTFLDN
gi|123967080|ref|YP_001012161.      -------------NSTQVKKKLPINNPDTSIPFELTSIPKPLEIKTFLDN
gi|87123285|ref|ZP_01079136.1|      -----------HGAEPARKG-GQAPRKSSKPAPTLASIPKPQEIKSFLDR
gi|116074349|ref|ZP_01471611.1      -----------QGAEQGRKA-AQTTRKSNKPAPTLATIPKPQEIKAFLDH
gi|148238400|ref|YP_001223787.      -----------QGAEPSRKAGAAQARKSTKPAPTLASIPKPQDIKAFLDQ
gi|113955227|ref|YP_729302.1|_      -----------HGAEPSKKTAAGGTRKTSKPAPTLATIPKPQEIKGFLDE
gi|78211619|ref|YP_380398.1|_A      -----------HSHEPSRKAMPAAR-KSSKPAPTLASIPRPQDIKSFLDQ
gi|260435985|ref|ZP_05789955.1      -----------HSHEPSRKATPAAR-KSSKPAPTLASIPRPQDIKNFLDQ
gi|78183645|ref|YP_376079.1|_A      -----------AGAEPSRKATPAAH-KSNKPAPTLASIPKPLEIKSFLDQ
gi|116071741|ref|ZP_01469009.1      -----------TGAEPSRKAAPAAR-KSNKPAPTLASIPKPLEIKSFLDQ
gi|33864599|ref|NP_896158.1|_A      -----------QAADSSRKAAPAAK-KSGKPAPTLASIPKPQQIKSFLDE
gi|33862334|ref|NP_893894.1|_A      -----------HSSESNRKSATASH-KSGKPAPTLATIPKPQQIKSFLDK
gi|124021783|ref|YP_001016090.      -----------HSSESNRKSATASH-KSGKPAPTLATIPKPQEIKNFLDK
gi|254431561|ref|ZP_05045264.1      -----------ARHAAEPARGKSGTKKPAKPVPTLAEVPKPQEIKAFLDR
gi|318043032|ref|ZP_07974988.1      ------------ARQPAEAKGKSPAKKSAKPAPTLAEIPKPREIKAHLDA
gi|87301612|ref|ZP_01084452.1|      --------------PSGDHGRKPAVKKSSKPAPTLASIPRPQEIKSFLDQ
gi|148241164|ref|YP_001226321.      ------------QGQGDASRKQAAPRKPSKPAPTLATIPKPQEIKAHLDE
gi|33241266|ref|NP_876208.1|_A      ------------DGND--SKIPTSASTVSKPAPTLSSIPKPIEIKSFLDN
gi|159904324|ref|YP_001551668.      ------------EANNPSNKNHTAITSTSKPAPTLATIPKPIDIKDFLDK
gi|72383093|ref|YP_292448.1|_A      ------------NGHE-QSRKAKAATTTAKPAPTLASIPKPIEIKKFLDA
GOS_2357010_Genomic_DNA__Carib      CTCAATTCCTAAGCCATTAGAAATAAAAAGTTTTCTAGATAATCAGGTTG
                                                                       :  . .        

gi|254526778|ref|ZP_05138830.1      QVVGQESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSNIL
gi|157414263|ref|YP_001485129.      QVVGQESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSNIL
gi|78780134|ref|YP_398246.1|_A      QVVGQESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSNIL
gi|126697185|ref|YP_001092071.      QVVGQESAKKILSVAVYNHYKRLAWKFKEENKNSNSKDSQATKLQKSNIL
gi|123969398|ref|YP_001010256.      QVVGQESAKKILSVAVYNHYKRLAWKVKEDSKNNNATDSQATKLQKSNIL
gi|33862213|ref|NP_893774.1|_A      QVVGQESAKKILSVAVYNHYKRLAWRLKEENKENDSNDLQATKLQKSNIL
gi|123967080|ref|YP_001012161.      QVVGQESAKKILSVAVYNHYKRLTWRLKEENKDNNSNDCHATKLQKSNIL
gi|87123285|ref|ZP_01079136.1|      QVVGQEAAKKVLSVAVYNHYKRLAWQGDGNGE----TEQTATRLHKSNIL
gi|116074349|ref|ZP_01471611.1      QVVGQDAAKKVLSVAVYNHYKRLAWQGDGKGE----TEETATRLHKSNIL
gi|148238400|ref|YP_001223787.      QVVGQEAAKKVMSVAVYNHYKRLAWQGDGKGE----TEETATRLHKSNIL
gi|113955227|ref|YP_729302.1|_      QVVGQEAAKKVMSVAVYNHYKRLAWQGDGQGE----AAQTATRLHKSNIL
gi|78211619|ref|YP_380398.1|_A      QVVGQDAAKKVMSVAVYNHYKRLAWQGDGQGE----TEETATRLHKSNIL
gi|260435985|ref|ZP_05789955.1      QVVGQDAAKKVMSVAVYNHYKRLAWQGDGQGE----TEETATRLHKSNIL
gi|78183645|ref|YP_376079.1|_A      QVVGQNAAKKVMSVAVYNHYKRLAWQGDGKGE----TEETATRLHKSNIL
gi|116071741|ref|ZP_01469009.1      QVVGQNAAKKLMSVAVYNHYKRLAWQGDGQGE----TEETATRLHKSNIL
gi|33864599|ref|NP_896158.1|_A      QVVGQEAAKKVMSVAVYNHYKRLAWQGDGQGE----TEQTATRLHKSNIL
gi|33862334|ref|NP_893894.1|_A      QVVGQEAAKKVLSVAVYNHYKRLAWQGDGQGE----TDLSATRLHKSNIL
gi|124021783|ref|YP_001016090.      QVVGQEAAKKVLSVAVYNHYKRLAWQGDGQGE----TDLSATRLHKSNIL
gi|254431561|ref|ZP_05045264.1      QVVGQEEAKKSLSVAVYNHYKRLAWQGDGKGE----TDETATRLHKSNIL
gi|318043032|ref|ZP_07974988.1      QVVGQEEAKKVLSVAVYNHYKRLAWQGDGKGE----SNETATRLHKSNIL
gi|87301612|ref|ZP_01084452.1|      QVVGQDEAKKVLSVAVYNHYKRLAWQGDGKGE----TDRSATRLHKSNIL
gi|148241164|ref|YP_001226321.      QVVGQNDAKKVLSVAVYNHYKRLAWQGDGSTE----PESSATRLHKSNIL
gi|33241266|ref|NP_876208.1|_A      QVVGQEDAKKILSVAVYNHYKRLAWQGSETNE----IDLHTTKLHKSNIL
gi|159904324|ref|YP_001551668.      QVVGQEVAKKILSVAVYNHYKRLAWQGDGNQE----TDLTATRLHKSNIL
gi|72383093|ref|YP_292448.1|_A      QVVGQEPAKKILSVAVYNHYKRLAWKGDGSGE----TDLTATKLQKSNIL
GOS_2357010_Genomic_DNA__Carib      TTGGACAAGAATCTGCAAAAAAAATATTATCAGTAGCCGTATACAATCAT
                                     . *   *    ...        :                :*    :  

gi|254526778|ref|ZP_05138830.1      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|157414263|ref|YP_001485129.      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|78780134|ref|YP_398246.1|_A      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|126697185|ref|YP_001092071.      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|123969398|ref|YP_001010256.      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|33862213|ref|NP_893774.1|_A      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|123967080|ref|YP_001012161.      LIGPTGSGKTLLAQTLAEFLDVPFAVADAT--------------------
gi|87123285|ref|ZP_01079136.1|      LIGPTGCGKTLLAQTLAELLDVPFAVADAT--------------------
gi|116074349|ref|ZP_01471611.1      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|148238400|ref|YP_001223787.      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|113955227|ref|YP_729302.1|_      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|78211619|ref|YP_380398.1|_A      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|260435985|ref|ZP_05789955.1      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|78183645|ref|YP_376079.1|_A      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|116071741|ref|ZP_01469009.1      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|33864599|ref|NP_896158.1|_A      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
gi|33862334|ref|NP_893894.1|_A      LIGPTGCGKTLLAQTLAELLDVPFAVADAT--------------------
gi|124021783|ref|YP_001016090.      LIGPTGCGKTLLAQTLAELLDVPFAVADAT--------------------
gi|254431561|ref|ZP_05045264.1      LIGPTGCGKTLLAQTLAEILEVPFAVADAT--------------------
gi|318043032|ref|ZP_07974988.1      LIGPTGCGKTLLAQTLAELLDVPFAVADAT--------------------
gi|87301612|ref|ZP_01084452.1|      LIGPTGCGKTLLAQTLAELLDVPFAVADAT--------------------
gi|148241164|ref|YP_001226321.      LIGPTGCGKTLLAQTLAEMMEVPFAVADAT--------------------
gi|33241266|ref|NP_876208.1|_A      LIGPTGSGKTLLAQTLAELLDVPFAVADAT--------------------
gi|159904324|ref|YP_001551668.      LIGPTGSGKTLLAQTLAELLDVPFAVADAT--------------------
gi|72383093|ref|YP_292448.1|_A      LIGPTGCGKTLLAQTLAEMLDVPFAVADAT--------------------
GOS_2357010_Genomic_DNA__Carib      TACAAGCGATTAGCTTGGAAAGTTAAAGAAGAGAGTAAAAATAGCAATTC
                                       .:*.* *  . * .     . *.*.*:                    

gi|254526778|ref|ZP_05138830.1      -----TLTEAGYVGEDVENILLRLLQKSDMNVELAQKGIIYIDEIDKIAR
gi|157414263|ref|YP_001485129.      -----TLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYIDEIDKIAR
gi|78780134|ref|YP_398246.1|_A      -----TLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYIDEIDKIAR
gi|126697185|ref|YP_001092071.      -----TLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYIDEIDKIAR
gi|123969398|ref|YP_001010256.      -----TLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYIDEIDKIAR
gi|33862213|ref|NP_893774.1|_A      -----SLTEAGYVGEDVENILLRLLQKSEMNVDLAQKGIIYIDEIDKIAR
gi|123967080|ref|YP_001012161.      -----TLTEAGYVGEDVENILLRLLQKSEMNVDLAQKGIIYIDEIDKIAR
gi|87123285|ref|ZP_01079136.1|      -----TLTEAGYVGEDVENILLRLLQKSDMDVDQAQRGIIYIDEIDKIAR
gi|116074349|ref|ZP_01471611.1      -----TLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEIDKIAR
gi|148238400|ref|YP_001223787.      -----TLTEAGYVGEDVENILLRLLQKADMDVDLAQRGIIYIDEIDKIAR
gi|113955227|ref|YP_729302.1|_      -----TLTEAGYVGEDVENILLRLLQKADMDVEQAQRGIIYIDEIDKIAR
gi|78211619|ref|YP_380398.1|_A      -----TLTEAGYVGEDVENILLRLLQKAEMDVDQAQRGIIYIDEIDKIAR
gi|260435985|ref|ZP_05789955.1      -----TLTEAGYVGEDVENILLRLLQKADMDVEQAQRGIIYIDEIDKIAR
gi|78183645|ref|YP_376079.1|_A      -----TLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEIDKIAR
gi|116071741|ref|ZP_01469009.1      -----TLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEIDKIAR
gi|33864599|ref|NP_896158.1|_A      -----TLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEIDKIAR
gi|33862334|ref|NP_893894.1|_A      -----TLTEAGYVGEDVENILLRLLQKADMDVEHAQRGIIYVDEIDKIAR
gi|124021783|ref|YP_001016090.      -----TLTEAGYVGEDVENILLRLLQKADMDVEHAQRGIIYVDEIDKIAR
gi|254431561|ref|ZP_05045264.1      -----TLTEAGYVGEDVENILLRLLQKADMDVELAQRGIIYIDEIDKIAR
gi|318043032|ref|ZP_07974988.1      -----TLTEAGYVGEDVENILLRLLQKADLDVDQAQRGIIYIDEIDKIAR
gi|87301612|ref|ZP_01084452.1|      -----TLTEAGYVGEDVENILLRLLQKADLDVEQAQRGIIYIDEIDKIAR
gi|148241164|ref|YP_001226321.      -----TLTEAGYVGEDVENILLRLLQKADGDVEQAQRGIIYIDEIDKIAR
gi|33241266|ref|NP_876208.1|_A      -----TLTEAGYVGEDVENILLRLLQKSDMDVELAQRGIIYIDEIDKIAR
gi|159904324|ref|YP_001551668.      -----TLTEAGYVGEDVENILLRLLQKADMDIELAQRGIIYIDEIDKIAR
gi|72383093|ref|YP_292448.1|_A      -----TLTEAGYVGEDVENILLRLLQKADMDVDLAQRGIIYIDEIDKIAR
GOS_2357010_Genomic_DNA__Carib      AACTGATTCACAAGCAACTAAATTACAAAAATCAAATATTTTACTCATCG
                                         : * *  .*  . .        :      *  .          .

gi|254526778|ref|ZP_05138830.1      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|157414263|ref|YP_001485129.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|78780134|ref|YP_398246.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|126697185|ref|YP_001092071.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|123969398|ref|YP_001010256.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|33862213|ref|NP_893774.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|123967080|ref|YP_001012161.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|87123285|ref|ZP_01079136.1|      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|116074349|ref|ZP_01471611.1      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|148238400|ref|YP_001223787.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|113955227|ref|YP_729302.1|_      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|78211619|ref|YP_380398.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|260435985|ref|ZP_05789955.1      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|78183645|ref|YP_376079.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|116071741|ref|ZP_01469009.1      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|33864599|ref|NP_896158.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|33862334|ref|NP_893894.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|124021783|ref|YP_001016090.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|254431561|ref|ZP_05045264.1      -----------------KSENPSITRDVSGEGVQQALLKLLEGTTANVPP
gi|318043032|ref|ZP_07974988.1      -----------------KSENPSITRDVSGEGVQQALLKLLEGTVANVPP
gi|87301612|ref|ZP_01084452.1|      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|148241164|ref|YP_001226321.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|33241266|ref|NP_876208.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTIANVPP
gi|159904324|ref|YP_001551668.      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
gi|72383093|ref|YP_292448.1|_A      -----------------KSENPSITRDVSGEGVQQALLKMLEGTVANVPP
GOS_2357010_Genomic_DNA__Carib      GCCCTACTGGAAGTGGAAAAACATTATTGGCGCAAACTTTAGCAGAGTTT
                                                      :   : *  ..* *   *  .    : *....

gi|254526778|ref|ZP_05138830.1      QGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT-NS
gi|157414263|ref|YP_001485129.      QGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT-NS
gi|78780134|ref|YP_398246.1|_A      QGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT-NS
gi|126697185|ref|YP_001092071.      QGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT-NS
gi|123969398|ref|YP_001010256.      QGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT-NS
gi|33862213|ref|NP_893774.1|_A      QGGRKHPNHDCIQIDTSQILFICGGAFIGLEDIVQKRLGKNSIGFTT-NP
gi|123967080|ref|YP_001012161.      QGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRLGRHSIGFTT-NS
gi|87123285|ref|ZP_01079136.1|      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRLGRNSIGFMP-DA
gi|116074349|ref|ZP_01471611.1      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFVPSSD
gi|148238400|ref|YP_001223787.      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFMP-TE
gi|113955227|ref|YP_729302.1|_      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFVP-ND
gi|78211619|ref|YP_380398.1|_A      QGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMP-SD
gi|260435985|ref|ZP_05789955.1      QGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMP-GD
gi|78183645|ref|YP_376079.1|_A      QGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMPPAD
gi|116071741|ref|ZP_01469009.1      QGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMPPAD
gi|33864599|ref|NP_896158.1|_A      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDEVVQKRMGRNAIGFMP-TD
gi|33862334|ref|NP_893894.1|_A      QGGRKHPYQDCIQIDTSQILFICGGAFIGLEDVVQKRLGRNAIGFMP-SD
gi|124021783|ref|YP_001016090.      QGGRKHPYQDCIQIDTSQILFICGGAFIGLEDVVQRRLGRNAIGFMP-SD
gi|254431561|ref|ZP_05045264.1      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFIN-PE
gi|318043032|ref|ZP_07974988.1      QGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQRRMGRNSIGFIP-EG
gi|87301612|ref|ZP_01084452.1|      QGGRKHPYQDCIQIDTSQILFICGGAFVGLEEVVQRRLGRNSIGFLP-AD
gi|148241164|ref|YP_001226321.      QGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVIQRRMGRNAIGFVP-GE
gi|33241266|ref|NP_876208.1|_A      QGGRKHPYQDSIQIDTSQILFICGGAFVGLEDIVQKRLGRNSIGFMT-ND
gi|159904324|ref|YP_001551668.      QGGRKHPYHDCIQIDTSQILFICGGAFVGLEDIVQKRLGKNSIGFMP-TD
gi|72383093|ref|YP_292448.1|_A      QGGRKHPYGDSIQIDTSQILFICGGAFVGLDDVVEKRLGKNSIGFIQ-NE
GOS_2357010_Genomic_DNA__Carib      TTAGATGTTCCTTTTGCAGTAGCTGATGCAACGACTTTGACAGAAGCTGG
                                      .       .     .     * **            *  : .      

gi|254526778|ref|ZP_05138830.1      DKNKVDTKKIIDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKE
gi|157414263|ref|YP_001485129.      DQNKVDTKKIIDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKE
gi|78780134|ref|YP_398246.1|_A      DQNNVDTKKLVEPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKE
gi|126697185|ref|YP_001092071.      DQNKVDTKKIVDPRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKE
gi|123969398|ref|YP_001010256.      DQNKVDTKKIVDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKE
gi|33862213|ref|NP_893774.1|_A      DESKINAKKIIDSRDALKNLEQDDLVKYGLIPEFIGRIPVCAVLDRLSKE
gi|123967080|ref|YP_001012161.      DESKIDAKKLVDSRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKE
gi|87123285|ref|ZP_01079136.1|      GRGRHRANRDLQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPLDEH
gi|116074349|ref|ZP_01471611.1      GRGRNKASRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDEE
gi|148238400|ref|YP_001223787.      GRGRGKATRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDEH
gi|113955227|ref|YP_729302.1|_      GRGRNRATRDIQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPLDEH
gi|78211619|ref|YP_380398.1|_A      GRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDES
gi|260435985|ref|ZP_05789955.1      GRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDES
gi|78183645|ref|YP_376079.1|_A      SRGRSRANRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPLDEK
gi|116071741|ref|ZP_01469009.1      SRGRNRTNRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPLDEK
gi|33864599|ref|NP_896158.1|_A      GRGRSRANRELQTTQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPLDES
gi|33862334|ref|NP_893894.1|_A      GRGRSRANRDLQASQVLHHLEADDLVRYGLIPEFIGRIPVSAVLEPLDSQ
gi|124021783|ref|YP_001016090.      GRGRSRANRDLKASQVLHHLEADDLVRYGLIPEFIGRIPVSAVLEPLDSQ
gi|254431561|ref|ZP_05045264.1      GNNRPRSARERLAADVLRHLEPDDLVKYGLIPEFIGRLPVTAVLEPLDIH
gi|318043032|ref|ZP_07974988.1      GRSRSRQNKDQQAAHVLRHLEPDDLVKYGLIPEFIGRLPVSAVLEPLDSR
gi|87301612|ref|ZP_01084452.1|      G--RGRGHRELKASHVLRHLEPDDLVRYGLIPEFTGRLPVSAVLEPLDVR
gi|148241164|ref|YP_001226321.      TRNGRSRQKDQEASQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPLDEQ
gi|33241266|ref|NP_876208.1|_A      NRGKSRKSNDLPKNQVLNNLEPDDLVRYGLIPEFIGRMPVSAVLEPLDVD
gi|159904324|ref|YP_001551668.      SRGQNHLNRDLDNNQMINNLEPDDLIRYGLIPEFIGRMPVTAVLEPLNSE
gi|72383093|ref|YP_292448.1|_A      NRTRTKSNRDRVGADLINDLEPDDLVKYGLIPEFIGRMPVSAILEPLNAK
GOS_2357010_Genomic_DNA__Carib      ATATGTTGGGGAGGATGTTGAAAACATACTTTTAAGACTTCTACAGAAAT
                                                                   .   *  .. :        

gi|254526778|ref|ZP_05138830.1      TLESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAFKRKTGAR
gi|157414263|ref|YP_001485129.      TLESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAFKRKTGAR
gi|78780134|ref|YP_398246.1|_A      TLESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAYKRKTGAR
gi|126697185|ref|YP_001092071.      TLESILTQPRDALVKQFKTLLSMDNVELSFEPDSVEAIANEAYKRKTGAR
gi|123969398|ref|YP_001010256.      TLESILTQPRDALVKQFKTLLSMDNVELSFEPDSVEAIANEAYKRKTGAR
gi|33862213|ref|NP_893774.1|_A      TLESILTEPRDALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKTGAR
gi|123967080|ref|YP_001012161.      TLESILTEPRDALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKTGAR
gi|87123285|ref|ZP_01079136.1|      ALESILTEPRDALVKQFRTLLSMDNVQLDFEAGAVEAIAHEAHRRKTGAR
gi|116074349|ref|ZP_01471611.1      ALKSILTEPRDALVKQFRTLLSMDNVQLDFETEAVEAIASEAHRRKTGAR
gi|148238400|ref|YP_001223787.      ALESILTEPRDALVKQFRTLLSMDNVQLEFEPSAIEAIAQEAHRRKTGAR
gi|113955227|ref|YP_729302.1|_      ALESILTEPRDALVKQFSTLLSMDNVQLDFEAQAVEAIAKEAHRRKTGAR
gi|78211619|ref|YP_380398.1|_A      ALQSILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKTGAR
gi|260435985|ref|ZP_05789955.1      ALQSILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKTGAR
gi|78183645|ref|YP_376079.1|_A      TLESILTEPRDALVKQFRTLLSMDNVQLQFADDAITAIAQEAHRRKTGAR
gi|116071741|ref|ZP_01469009.1      TLESILTEPRDALVKQFRTLLSMDNVQLEFADDAITAIAQEAHRRKTGAR
gi|33864599|ref|NP_896158.1|_A      ALESILTEPRDALVKQFRTLLSMDNVQLQFEPAAIHAIAQEAHRRKTGAR
gi|33862334|ref|NP_893894.1|_A      ALESILTEPRDALVKQFSTLLSMDNVQLEFESDAVEAIAQEAHRRKTGAR
gi|124021783|ref|YP_001016090.      ALESILTEPRDALVKQFSTLLSMDNVQLEFESDAVEAIAQEAHRRKTGAR
gi|254431561|ref|ZP_05045264.1      ALEAILTEPRDALVKQFQTLLSMDDVQLHFEQGAIEAIAAEAHRRKTGAR
gi|318043032|ref|ZP_07974988.1      ALEAILTEPRDALVKQFQTLLSMDEVRLDFEPGAVEAIAAEAHRRKTGAR
gi|87301612|ref|ZP_01084452.1|      SLESILTEPRDALVKQFQTLMSMDSVRLEFEPGAIEAIAHEAHRRRTGAR
gi|148241164|ref|YP_001226321.      ALEAILTEPRDALVKQFQTLLSMDSVRLEFQPEAVRAIAREAHRRKTGAR
gi|33241266|ref|NP_876208.1|_A      ALEAILQEPRDAVIKQFITLMSMDNVKLTFEENAIKSIAKEAFRRKTGAR
gi|159904324|ref|YP_001551668.      ALEAILKEPRDAVIKQFRTLMSMDNVKLEFDEGAVTAIAQEAFRRKTGAR
gi|72383093|ref|YP_292448.1|_A      ALESILTEPRDALVKQFRTLLSMDNVELSFDEDAVEAIAQEAYKRKTGAR
GOS_2357010_Genomic_DNA__Carib      CAGAAATGAATGTAGAACTAGCTCAAAAAGGAATTATTTATATTGATGAA
                                       :    .  .      *  .   .       :  : :  *    ***

gi|254526778|ref|ZP_05138830.1      ALRSIIEELMLDVMYTLPSEEN----------------------------
gi|157414263|ref|YP_001485129.      ALRSIIEELMLDVMYTLPSEEN----------------------------
gi|78780134|ref|YP_398246.1|_A      ALRSIIEELMLDVMYTLPSEKN----------------------------
gi|126697185|ref|YP_001092071.      ALRSIIEELMLDIMYTLPSEEN----------------------------
gi|123969398|ref|YP_001010256.      ALRSIIEELMLDIMYTLPSEEN----------------------------
gi|33862213|ref|NP_893774.1|_A      ALRSIIEELMLDLMYTLPSQEE----------------------------
gi|123967080|ref|YP_001012161.      ALRSIIEELMLDLMYTLPSQEE----------------------------
gi|87123285|ref|ZP_01079136.1|      ALRGIVEELMLDLMYELPSRKN----------------------------
gi|116074349|ref|ZP_01471611.1      ALRGIVEELMLDLMYDLPSRKN----------------------------
gi|148238400|ref|YP_001223787.      ALRGIVEELMLDLMYELPSRKD----------------------------
gi|113955227|ref|YP_729302.1|_      ALRGIVEELMLDLMYELPSDQN----------------------------
gi|78211619|ref|YP_380398.1|_A      ALRGIVEELMLDLMYDLPSQTS----------------------------
gi|260435985|ref|ZP_05789955.1      ALRGIVEELMLDLMYDLPSQTS----------------------------
gi|78183645|ref|YP_376079.1|_A      ALRGIIEEIMLDLMYDLPSQSS----------------------------
gi|116071741|ref|ZP_01469009.1      ALRGIIEEIMLDLMYDLPSQSS----------------------------
gi|33864599|ref|NP_896158.1|_A      ALRGIVEELMLDLMYDLPSQST----------------------------
gi|33862334|ref|NP_893894.1|_A      ALRGIIEELMLDLMYDLPSKKN----------------------------
gi|124021783|ref|YP_001016090.      ALRGIIEELMLDLMYDLPSKKN----------------------------
gi|254431561|ref|ZP_05045264.1      ALRGILEELMLELMYDLPSRRN----------------------------
gi|318043032|ref|ZP_07974988.1      ALRGIVEELMLDLMYDLPSDKS----------------------------
gi|87301612|ref|ZP_01084452.1|      ALRGIVEELMLDLMYDLPSNNE----------------------------
gi|148241164|ref|YP_001226321.      ALRGIIEDLMLDLMYDLPSQNE----------------------------
gi|33241266|ref|NP_876208.1|_A      ALRGIVEELMLELMYKLPSQDE----------------------------
gi|159904324|ref|YP_001551668.      ALRGIVEELMVDLMYKLPSEKN----------------------------
gi|72383093|ref|YP_292448.1|_A      ALRGIVEEIMLDLMYSLPSQTK----------------------------
GOS_2357010_Genomic_DNA__Carib      ATAGATAAAATTGCAAGAAAAAGCGAGAATCCTTCAATTACTAGAGATGT
                                    *  .             .:                              

gi|254526778|ref|ZP_05138830.1      --------------------IKEFTITKKMVDNLFSS-KIVKLPSGSKRI
gi|157414263|ref|YP_001485129.      --------------------IKEFTITKKMVDNLFSS-KIVKLPSGSKRI
gi|78780134|ref|YP_398246.1|_A      --------------------VKEFTITKKMVDNLFSS-KIVKLPSGSKRI
gi|126697185|ref|YP_001092071.      --------------------VKEFTITKKMVDNLFSS-KIVKLPSGSKRV
gi|123969398|ref|YP_001010256.      --------------------VKEFTITKKMVDNLFSS-KIVKLPSGSKRI
gi|33862213|ref|NP_893774.1|_A      --------------------VKEFIITKKMVDKLFLS-KIVKLPAGSQRI
gi|123967080|ref|YP_001012161.      --------------------VTKFTITKKMVDNLFSS-KIVKLPAGSHRI
gi|87123285|ref|ZP_01079136.1|      --------------------VKTFTVTRAMVEEHTGG-KVLPLPGNERQQ
gi|116074349|ref|ZP_01471611.1      --------------------VKNFTVTRTMVEEHTGG-KVLPLPGSDRQQ
gi|148238400|ref|YP_001223787.      --------------------ASSFTITRAMVEEHTGG-KVLPLPGSERQQ
gi|113955227|ref|YP_729302.1|_      --------------------VTAFTITKAMVEEHTGG-KVLPLPGTKQHK
gi|78211619|ref|YP_380398.1|_A      --------------------VKEFTVTRAMVEEHTGG-KVLPLPGAEQQK
gi|260435985|ref|ZP_05789955.1      --------------------VKEFTVTRTMVEEHTGG-KVLPLPGTEQQK
gi|78183645|ref|YP_376079.1|_A      --------------------VKDFTVTRSMVEEHTGG-KVLPLPGTDQQK
gi|116071741|ref|ZP_01469009.1      --------------------VKDFTVTRAMVEEHTGG-KILPLPSTDQQK
gi|33864599|ref|NP_896158.1|_A      --------------------VKEFTITQAMVEQHTGG-KVLPLPGTEQQK
gi|33862334|ref|NP_893894.1|_A      --------------------VKKFTVTRTMVDEHTGG-KVLPLPANDERS
gi|124021783|ref|YP_001016090.      --------------------VKKFTVTRTMVDEHTGG-KVLPLPANDERS
gi|254431561|ref|ZP_05045264.1      --------------------VKTFTVTQELVEQRSQA-KVVPLGSSHEDA
gi|318043032|ref|ZP_07974988.1      --------------------TKAFTVTRELVEERTKA-KVLPMPGSDQVQ
gi|87301612|ref|ZP_01084452.1|      --------------------VSSFTITRELVEQRSKA-KVLPYPNVVSQQ
gi|148241164|ref|YP_001226321.      --------------------VQKFVITEELVDECHGN-KVLPHPSSLEQQ
gi|33241266|ref|NP_876208.1|_A      --------------------IKNCSVTQAMVEAITGG-KIVPLPPSDKRA
gi|159904324|ref|YP_001551668.      --------------------VSDFTVTKKMVDEMIIGGKVLKLPSNEKID
gi|72383093|ref|YP_292448.1|_A      --------------------IKNFNVTKKMVDESTGG-KVVPLLSNEKRI
GOS_2357010_Genomic_DNA__Carib      CTCCGGTGAAGGGGTACAGCAAGCATTATTAAAAATGCTTGAAGGACAAT
                                                              *   .       .          

gi|254526778|ref|ZP_05138830.1      IKESA---------------------------------------------
gi|157414263|ref|YP_001485129.      IKESA---------------------------------------------
gi|78780134|ref|YP_398246.1|_A      IKESA---------------------------------------------
gi|126697185|ref|YP_001092071.      IKESA---------------------------------------------
gi|123969398|ref|YP_001010256.      IKESA---------------------------------------------
gi|33862213|ref|NP_893774.1|_A      IKESA---------------------------------------------
gi|123967080|ref|YP_001012161.      IKESA---------------------------------------------
gi|87123285|ref|ZP_01079136.1|      ESA-----------------------------------------------
gi|116074349|ref|ZP_01471611.1      ESA-----------------------------------------------
gi|148238400|ref|YP_001223787.      ESA-----------------------------------------------
gi|113955227|ref|YP_729302.1|_      ESA-----------------------------------------------
gi|78211619|ref|YP_380398.1|_A      TA------------------------------------------------
gi|260435985|ref|ZP_05789955.1      TA------------------------------------------------
gi|78183645|ref|YP_376079.1|_A      TA------------------------------------------------
gi|116071741|ref|ZP_01469009.1      TA------------------------------------------------
gi|33864599|ref|NP_896158.1|_A      TA------------------------------------------------
gi|33862334|ref|NP_893894.1|_A      HQESA---------------------------------------------
gi|124021783|ref|YP_001016090.      HKESA---------------------------------------------
gi|254431561|ref|ZP_05045264.1      QASA----------------------------------------------
gi|318043032|ref|ZP_07974988.1      QESA----------------------------------------------
gi|87301612|ref|ZP_01084452.1|      ESA-----------------------------------------------
gi|148241164|ref|YP_001226321.      SA------------------------------------------------
gi|33241266|ref|NP_876208.1|_A      TKESA---------------------------------------------
gi|159904324|ref|YP_001551668.      HPESA---------------------------------------------
gi|72383093|ref|YP_292448.1|_A      VKESA---------------------------------------------
GOS_2357010_Genomic_DNA__Carib      TGCTAATGTGCCACCTCAAGGCGGAAGAAAGCATCCTTATCATGACTGCA
                                                                                      

gi|254526778|ref|ZP_05138830.1      --------------------------
gi|157414263|ref|YP_001485129.      --------------------------
gi|78780134|ref|YP_398246.1|_A      --------------------------
gi|126697185|ref|YP_001092071.      --------------------------
gi|123969398|ref|YP_001010256.      --------------------------
gi|33862213|ref|NP_893774.1|_A      --------------------------
gi|123967080|ref|YP_001012161.      --------------------------
gi|87123285|ref|ZP_01079136.1|      --------------------------
gi|116074349|ref|ZP_01471611.1      --------------------------
gi|148238400|ref|YP_001223787.      --------------------------
gi|113955227|ref|YP_729302.1|_      --------------------------
gi|78211619|ref|YP_380398.1|_A      --------------------------
gi|260435985|ref|ZP_05789955.1      --------------------------
gi|78183645|ref|YP_376079.1|_A      --------------------------
gi|116071741|ref|ZP_01469009.1      --------------------------
gi|33864599|ref|NP_896158.1|_A      --------------------------
gi|33862334|ref|NP_893894.1|_A      --------------------------
gi|124021783|ref|YP_001016090.      --------------------------
gi|254431561|ref|ZP_05045264.1      --------------------------
gi|318043032|ref|ZP_07974988.1      --------------------------
gi|87301612|ref|ZP_01084452.1|      --------------------------
gi|148241164|ref|YP_001226321.      --------------------------
gi|33241266|ref|NP_876208.1|_A      --------------------------
gi|159904324|ref|YP_001551668.      --------------------------
gi|72383093|ref|YP_292448.1|_A      --------------------------
GOS_2357010_Genomic_DNA__Carib      TCCAAATTGATACGAGTCAATACTAT