Site undergoing maintenance! No connection possible during this time!

Forum "Multiple sequence alignements"

Thread subject: multiple sequence allignment

[ Return to forums ]
multiple sequence allignment
B_hajra
27 Apr 2011 9:37
Non evaluated contribution
* shows identical region
: represents conserved substitions
. show semi-conserved substition
gi|87123285|ref|ZP_01079136.1|      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDA
gi|116074349|ref|ZP_01471611.1      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDA
gi|148238400|ref|YP_001223787.      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDS
gi|113955227|ref|YP_729302.1|_      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDA
gi|78211619|ref|YP_380398.1|_A      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDG
gi|260435985|ref|ZP_05789955.1      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDG
gi|78183645|ref|YP_376079.1|_A      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDS
gi|116071741|ref|ZP_01469009.1      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDS
gi|33864599|ref|NP_896158.1|_A      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDS
gi|33862334|ref|NP_893894.1|_A      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCTEILDEELVDS
gi|124021783|ref|YP_001016090.      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCTEILDEELVDS
gi|254431561|ref|ZP_05045264.1      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELVDT
gi|318043032|ref|ZP_07974988.1      MPKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVEG
gi|87301612|ref|ZP_01084452.1|      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELVES
gi|148241164|ref|YP_001226321.      MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELVDG
gi|72383093|ref|YP_292448.1|_A      MAKFEAHLKCSFCGKAQDQVRKLIAGPGVYICDECIDLCNEILDEELIDN
gi|159904324|ref|YP_001551668.      MAKFEAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDN
gi|33241266|ref|NP_876208.1|_A      MAKFEAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELLEN
gi|254526778|ref|ZP_05138830.1      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDN
gi|157414263|ref|YP_001485129.      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDN
gi|78780134|ref|YP_398246.1|_A      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDN
gi|126697185|ref|YP_001092071.      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDN
gi|123969398|ref|YP_001010256.      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDN
gi|33862213|ref|NP_893774.1|_A      MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELIDT
gi|123967080|ref|YP_001012161.      MAKFDAHLKCSFCAKSQDQVRKLIAGPGVYICDECIDLCNEILDEELIDT
                                    *.**:********.*:*:*********************.*******::

gi|87123285|ref|ZP_01079136.1|      QGNPR-HGAEPARKG-GQAPRKSSKPAPTLASIPKPQEIKSFLDRQVVGQ
gi|116074349|ref|ZP_01471611.1      QGNPR-QGAEQGRKA-AQTTRKSNKPAPTLATIPKPQEIKAFLDHQVVGQ
gi|148238400|ref|YP_001223787.      QGGSR-QGAEPSRKAGAAQARKSTKPAPTLASIPKPQDIKAFLDQQVVGQ
gi|113955227|ref|YP_729302.1|_      QGNPR-HGAEPSKKTAAGGTRKTSKPAPTLATIPKPQEIKGFLDEQVVGQ
gi|78211619|ref|YP_380398.1|_A      QGNSR-HSHEPSRKAMPAAR-KSSKPAPTLASIPRPQDIKSFLDQQVVGQ
gi|260435985|ref|ZP_05789955.1      QGNPR-HSHEPSRKATPAAR-KSSKPAPTLASIPRPQDIKNFLDQQVVGQ
gi|78183645|ref|YP_376079.1|_A      QGNPR-AGAEPSRKATPAAH-KSNKPAPTLASIPKPLEIKSFLDQQVVGQ
gi|116071741|ref|ZP_01469009.1      QGNPR-TGAEPSRKAAPAAR-KSNKPAPTLASIPKPLEIKSFLDQQVVGQ
gi|33864599|ref|NP_896158.1|_A      QGNRG-QAADSSRKAAPAAK-KSGKPAPTLASIPKPQQIKSFLDEQVVGQ
gi|33862334|ref|NP_893894.1|_A      QGNPR-HSSESNRKSATASH-KSGKPAPTLATIPKPQQIKSFLDKQVVGQ
gi|124021783|ref|YP_001016090.      QGNPR-HSSESNRKSATASH-KSGKPAPTLATIPKPQEIKNFLDKQVVGQ
gi|254431561|ref|ZP_05045264.1      HGSGGGARHAAEPARGKSGTKKPAKPVPTLAEVPKPQEIKAFLDRQVVGQ
gi|318043032|ref|ZP_07974988.1      HGSG---ARQPAEAKGKSPAKKSAKPAPTLAEIPKPREIKAHLDAQVVGQ
gi|87301612|ref|ZP_01084452.1|      HGSAR----PSGDHGRKPAVKKSSKPAPTLASIPRPQEIKSFLDQQVVGQ
gi|148241164|ref|YP_001226321.      QAGAR--QGQGDASRKQAAPRKPSKPAPTLATIPKPQEIKAHLDEQVVGQ
gi|72383093|ref|YP_292448.1|_A      PTHQR---NGHEQSRKAKAATTTAKPAPTLASIPKPIEIKKFLDAQVVGQ
gi|159904324|ref|YP_001551668.      QTKTR--EANNPSNKNHTAITSTSKPAPTLATIPKPIDIKDFLDKQVVGQ
gi|33241266|ref|NP_876208.1|_A      PSKVK----DGNDSKIPTSASTVSKPAPTLSSIPKPIEIKSFLDNQVVGQ
gi|254526778|ref|ZP_05138830.1      QAHTN---NSQQVKKKLPNDNPKKSVPLELTSIPKPLEIKSFLDNQVVGQ
gi|157414263|ref|YP_001485129.      QTNTN---NSQQVKKKLPNDNPKKCVPLELTSIPKPLEIKSFLDNQVVGQ
gi|78780134|ref|YP_398246.1|_A      QANTN---NSPQVKKKLTNDNPKKSVPLELTSIPKPLEIKSFLDNQVVGQ
gi|126697185|ref|YP_001092071.      QANTN---NSPQVKKKLPTDNPKKSVPLELTSIPKPLEIKSFLDNQVVGQ
gi|123969398|ref|YP_001010256.      QANTN---NPPQVKKKLPTDNPKKSVPLELTSIPKPLEIKSFLDNQVVGQ
gi|33862213|ref|NP_893774.1|_A      QAKIN---NSPQVKKKLPTNNSDKSIPLELTSIPKPLEIKTFLDNQVVGQ
gi|123967080|ref|YP_001012161.      QAKLN---NSTQVKKKLPINNPDTSIPFELTSIPKPLEIKTFLDNQVVGQ
                                                                 *: :*:* :** .** *****

gi|87123285|ref|ZP_01079136.1|      EAAKKVLSVAVYNHYKRLAWQGDGNGE----TEQTATRLHKSNILLIGPT
gi|116074349|ref|ZP_01471611.1      DAAKKVLSVAVYNHYKRLAWQGDGKGE----TEETATRLHKSNILLIGPT
gi|148238400|ref|YP_001223787.      EAAKKVMSVAVYNHYKRLAWQGDGKGE----TEETATRLHKSNILLIGPT
gi|113955227|ref|YP_729302.1|_      EAAKKVMSVAVYNHYKRLAWQGDGQGE----AAQTATRLHKSNILLIGPT
gi|78211619|ref|YP_380398.1|_A      DAAKKVMSVAVYNHYKRLAWQGDGQGE----TEETATRLHKSNILLIGPT
gi|260435985|ref|ZP_05789955.1      DAAKKVMSVAVYNHYKRLAWQGDGQGE----TEETATRLHKSNILLIGPT
gi|78183645|ref|YP_376079.1|_A      NAAKKVMSVAVYNHYKRLAWQGDGKGE----TEETATRLHKSNILLIGPT
gi|116071741|ref|ZP_01469009.1      NAAKKLMSVAVYNHYKRLAWQGDGQGE----TEETATRLHKSNILLIGPT
gi|33864599|ref|NP_896158.1|_A      EAAKKVMSVAVYNHYKRLAWQGDGQGE----TEQTATRLHKSNILLIGPT
gi|33862334|ref|NP_893894.1|_A      EAAKKVLSVAVYNHYKRLAWQGDGQGE----TDLSATRLHKSNILLIGPT
gi|124021783|ref|YP_001016090.      EAAKKVLSVAVYNHYKRLAWQGDGQGE----TDLSATRLHKSNILLIGPT
gi|254431561|ref|ZP_05045264.1      EEAKKSLSVAVYNHYKRLAWQGDGKGE----TDETATRLHKSNILLIGPT
gi|318043032|ref|ZP_07974988.1      EEAKKVLSVAVYNHYKRLAWQGDGKGE----SNETATRLHKSNILLIGPT
gi|87301612|ref|ZP_01084452.1|      DEAKKVLSVAVYNHYKRLAWQGDGKGE----TDRSATRLHKSNILLIGPT
gi|148241164|ref|YP_001226321.      NDAKKVLSVAVYNHYKRLAWQGDGSTE----PESSATRLHKSNILLIGPT
gi|72383093|ref|YP_292448.1|_A      EPAKKILSVAVYNHYKRLAWKGDGSGE----TDLTATKLQKSNILLIGPT
gi|159904324|ref|YP_001551668.      EVAKKILSVAVYNHYKRLAWQGDGNQE----TDLTATRLHKSNILLIGPT
gi|33241266|ref|NP_876208.1|_A      EDAKKILSVAVYNHYKRLAWQGSETNE----IDLHTTKLHKSNILLIGPT
gi|254526778|ref|ZP_05138830.1      ESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSNILLIGPT
gi|157414263|ref|YP_001485129.      ESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSNILLIGPT
gi|78780134|ref|YP_398246.1|_A      ESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSNILLIGPT
gi|126697185|ref|YP_001092071.      ESAKKILSVAVYNHYKRLAWKFKEENKNSNSKDSQATKLQKSNILLIGPT
gi|123969398|ref|YP_001010256.      ESAKKILSVAVYNHYKRLAWKVKEDSKNNNATDSQATKLQKSNILLIGPT
gi|33862213|ref|NP_893774.1|_A      ESAKKILSVAVYNHYKRLAWRLKEENKENDSNDLQATKLQKSNILLIGPT
gi|123967080|ref|YP_001012161.      ESAKKILSVAVYNHYKRLTWRLKEENKDNNSNDCHATKLQKSNILLIGPT
                                    : *** :***********:*: .   :        :*:*:**********

gi|87123285|ref|ZP_01079136.1|      GCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSDM
gi|116074349|ref|ZP_01471611.1      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|148238400|ref|YP_001223787.      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|113955227|ref|YP_729302.1|_      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|78211619|ref|YP_380398.1|_A      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKAEM
gi|260435985|ref|ZP_05789955.1      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|78183645|ref|YP_376079.1|_A      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|116071741|ref|ZP_01469009.1      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|33864599|ref|NP_896158.1|_A      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|33862334|ref|NP_893894.1|_A      GCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|124021783|ref|YP_001016090.      GCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|254431561|ref|ZP_05045264.1      GCGKTLLAQTLAEILEVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|318043032|ref|ZP_07974988.1      GCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADL
gi|87301612|ref|ZP_01084452.1|      GCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADL
gi|148241164|ref|YP_001226321.      GCGKTLLAQTLAEMMEVPFAVADATTLTEAGYVGEDVENILLRLLQKADG
gi|72383093|ref|YP_292448.1|_A      GCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|159904324|ref|YP_001551668.      GSGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADM
gi|33241266|ref|NP_876208.1|_A      GSGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSDM
gi|254526778|ref|ZP_05138830.1      GSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSDM
gi|157414263|ref|YP_001485129.      GSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEM
gi|78780134|ref|YP_398246.1|_A      GSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEM
gi|126697185|ref|YP_001092071.      GSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEM
gi|123969398|ref|YP_001010256.      GSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEM
gi|33862213|ref|NP_893774.1|_A      GSGKTLLAQTLAEFLDVPFAVADATSLTEAGYVGEDVENILLRLLQKSEM
gi|123967080|ref|YP_001012161.      GSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEM
                                    *.***********:::*********:*********************::

gi|87123285|ref|ZP_01079136.1|      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|116074349|ref|ZP_01471611.1      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|148238400|ref|YP_001223787.      DVDLAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|113955227|ref|YP_729302.1|_      DVEQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|78211619|ref|YP_380398.1|_A      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|260435985|ref|ZP_05789955.1      DVEQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|78183645|ref|YP_376079.1|_A      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|116071741|ref|ZP_01469009.1      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|33864599|ref|NP_896158.1|_A      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|33862334|ref|NP_893894.1|_A      DVEHAQRGIIYVDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|124021783|ref|YP_001016090.      DVEHAQRGIIYVDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|254431561|ref|ZP_05045264.1      DVELAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKLLEGTTAN
gi|318043032|ref|ZP_07974988.1      DVDQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKLLEGTVAN
gi|87301612|ref|ZP_01084452.1|      DVEQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|148241164|ref|YP_001226321.      DVEQAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|72383093|ref|YP_292448.1|_A      DVDLAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|159904324|ref|YP_001551668.      DIELAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVAN
gi|33241266|ref|NP_876208.1|_A      DVELAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|254526778|ref|ZP_05138830.1      NVELAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|157414263|ref|YP_001485129.      NVELAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|78780134|ref|YP_398246.1|_A      NVELAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|126697185|ref|YP_001092071.      NVELAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|123969398|ref|YP_001010256.      NVELAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|33862213|ref|NP_893774.1|_A      NVDLAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
gi|123967080|ref|YP_001012161.      NVDLAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIAN
                                    ::: **:****:******************************:**** **

gi|87123285|ref|ZP_01079136.1|      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRLGRNSIGFMP
gi|116074349|ref|ZP_01471611.1      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFVP
gi|148238400|ref|YP_001223787.      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFMP
gi|113955227|ref|YP_729302.1|_      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFVP
gi|78211619|ref|YP_380398.1|_A      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMP
gi|260435985|ref|ZP_05789955.1      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMP
gi|78183645|ref|YP_376079.1|_A      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMP
gi|116071741|ref|ZP_01469009.1      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQKRMGRNAIGFMP
gi|33864599|ref|NP_896158.1|_A      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDEVVQKRMGRNAIGFMP
gi|33862334|ref|NP_893894.1|_A      VPPQGGRKHPYQDCIQIDTSQILFICGGAFIGLEDVVQKRLGRNAIGFMP
gi|124021783|ref|YP_001016090.      VPPQGGRKHPYQDCIQIDTSQILFICGGAFIGLEDVVQRRLGRNAIGFMP
gi|254431561|ref|ZP_05045264.1      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVVQKRMGRNAIGFIN
gi|318043032|ref|ZP_07974988.1      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVVQRRMGRNSIGFIP
gi|87301612|ref|ZP_01084452.1|      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEEVVQRRLGRNSIGFLP
gi|148241164|ref|YP_001226321.      VPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVIQRRMGRNAIGFVP
gi|72383093|ref|YP_292448.1|_A      VPPQGGRKHPYGDSIQIDTSQILFICGGAFVGLDDVVEKRLGKNSIGFIQ
gi|159904324|ref|YP_001551668.      VPPQGGRKHPYHDCIQIDTSQILFICGGAFVGLEDIVQKRLGKNSIGFMP
gi|33241266|ref|NP_876208.1|_A      VPPQGGRKHPYQDSIQIDTSQILFICGGAFVGLEDIVQKRLGRNSIGFMT
gi|254526778|ref|ZP_05138830.1      VPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT
gi|157414263|ref|YP_001485129.      VPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT
gi|78780134|ref|YP_398246.1|_A      VPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT
gi|126697185|ref|YP_001092071.      VPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT
gi|123969398|ref|YP_001010256.      VPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRMGKHSIGFTT
gi|33862213|ref|NP_893774.1|_A      VPPQGGRKHPNHDCIQIDTSQILFICGGAFIGLEDIVQKRLGKNSIGFTT
gi|123967080|ref|YP_001012161.      VPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRLGRHSIGFTT
                                    **********  *.****************:**::::::*:*:::***  

gi|87123285|ref|ZP_01079136.1|      -DAGRGRHRANRDLQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPL
gi|116074349|ref|ZP_01471611.1      SSDGRGRNKASRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPL
gi|148238400|ref|YP_001223787.      -TEGRGRGKATRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPL
gi|113955227|ref|YP_729302.1|_      -NDGRGRNRATRDIQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPL
gi|78211619|ref|YP_380398.1|_A      -SDGRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPL
gi|260435985|ref|ZP_05789955.1      -GDGRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPL
gi|78183645|ref|YP_376079.1|_A      PADSRGRSRANRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPL
gi|116071741|ref|ZP_01469009.1      PADSRGRNRTNRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPL
gi|33864599|ref|NP_896158.1|_A      -TDGRGRSRANRELQTTQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPL
gi|33862334|ref|NP_893894.1|_A      -SDGRGRSRANRDLQASQVLHHLEADDLVRYGLIPEFIGRIPVSAVLEPL
gi|124021783|ref|YP_001016090.      -SDGRGRSRANRDLKASQVLHHLEADDLVRYGLIPEFIGRIPVSAVLEPL
gi|254431561|ref|ZP_05045264.1      -PEGNNRPRSARERLAADVLRHLEPDDLVKYGLIPEFIGRLPVTAVLEPL
gi|318043032|ref|ZP_07974988.1      -EGGRSRSRQNKDQQAAHVLRHLEPDDLVKYGLIPEFIGRLPVSAVLEPL
gi|87301612|ref|ZP_01084452.1|      -ADG--RGRGHRELKASHVLRHLEPDDLVRYGLIPEFTGRLPVSAVLEPL
gi|148241164|ref|YP_001226321.      -GETRNGRSRQKDQEASQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPL
gi|72383093|ref|YP_292448.1|_A      -NENRTRTKSNRDRVGADLINDLEPDDLVKYGLIPEFIGRMPVSAILEPL
gi|159904324|ref|YP_001551668.      -TDSRGQNHLNRDLDNNQMINNLEPDDLIRYGLIPEFIGRMPVTAVLEPL
gi|33241266|ref|NP_876208.1|_A      -NDNRGKSRKSNDLPKNQVLNNLEPDDLVRYGLIPEFIGRMPVSAVLEPL
gi|254526778|ref|ZP_05138830.1      -NSDKNKVDTKKIIDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRL
gi|157414263|ref|YP_001485129.      -NSDQNKVDTKKIIDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRL
gi|78780134|ref|YP_398246.1|_A      -NSDQNNVDTKKLVEPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRL
gi|126697185|ref|YP_001092071.      -NSDQNKVDTKKIVDPRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRL
gi|123969398|ref|YP_001010256.      -NSDQNKVDTKKIVDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRL
gi|33862213|ref|NP_893774.1|_A      -NPDESKINAKKIIDSRDALKNLEQDDLVKYGLIPEFIGRIPVCAVLDRL
gi|123967080|ref|YP_001012161.      -NSDESKIDAKKLVDSRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRL
                                               .     . :..** ***::******* **:** *:*: *

gi|87123285|ref|ZP_01079136.1|      DEHALESILTEPRDALVKQFRTLLSMDNVQLDFEAGAVEAIAHEAHRRKT
gi|116074349|ref|ZP_01471611.1      DEEALKSILTEPRDALVKQFRTLLSMDNVQLDFETEAVEAIASEAHRRKT
gi|148238400|ref|YP_001223787.      DEHALESILTEPRDALVKQFRTLLSMDNVQLEFEPSAIEAIAQEAHRRKT
gi|113955227|ref|YP_729302.1|_      DEHALESILTEPRDALVKQFSTLLSMDNVQLDFEAQAVEAIAKEAHRRKT
gi|78211619|ref|YP_380398.1|_A      DESALQSILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKT
gi|260435985|ref|ZP_05789955.1      DESALQSILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKT
gi|78183645|ref|YP_376079.1|_A      DEKTLESILTEPRDALVKQFRTLLSMDNVQLQFADDAITAIAQEAHRRKT
gi|116071741|ref|ZP_01469009.1      DEKTLESILTEPRDALVKQFRTLLSMDNVQLEFADDAITAIAQEAHRRKT
gi|33864599|ref|NP_896158.1|_A      DESALESILTEPRDALVKQFRTLLSMDNVQLQFEPAAIHAIAQEAHRRKT
gi|33862334|ref|NP_893894.1|_A      DSQALESILTEPRDALVKQFSTLLSMDNVQLEFESDAVEAIAQEAHRRKT
gi|124021783|ref|YP_001016090.      DSQALESILTEPRDALVKQFSTLLSMDNVQLEFESDAVEAIAQEAHRRKT
gi|254431561|ref|ZP_05045264.1      DIHALEAILTEPRDALVKQFQTLLSMDDVQLHFEQGAIEAIAAEAHRRKT
gi|318043032|ref|ZP_07974988.1      DSRALEAILTEPRDALVKQFQTLLSMDEVRLDFEPGAVEAIAAEAHRRKT
gi|87301612|ref|ZP_01084452.1|      DVRSLESILTEPRDALVKQFQTLMSMDSVRLEFEPGAIEAIAHEAHRRRT
gi|148241164|ref|YP_001226321.      DEQALEAILTEPRDALVKQFQTLLSMDSVRLEFQPEAVRAIAREAHRRKT
gi|72383093|ref|YP_292448.1|_A      NAKALESILTEPRDALVKQFRTLLSMDNVELSFDEDAVEAIAQEAYKRKT
gi|159904324|ref|YP_001551668.      NSEALEAILKEPRDAVIKQFRTLMSMDNVKLEFDEGAVTAIAQEAFRRKT
gi|33241266|ref|NP_876208.1|_A      DVDALEAILQEPRDAVIKQFITLMSMDNVKLTFEENAIKSIAKEAFRRKT
gi|254526778|ref|ZP_05138830.1      TKETLESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAFKRKT
gi|157414263|ref|YP_001485129.      TKETLESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAFKRKT
gi|78780134|ref|YP_398246.1|_A      TKETLESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAYKRKT
gi|126697185|ref|YP_001092071.      TKETLESILTQPRDALVKQFKTLLSMDNVELSFEPDSVEAIANEAYKRKT
gi|123969398|ref|YP_001010256.      TKETLESILTQPRDALVKQFKTLLSMDNVELSFEPDSVEAIANEAYKRKT
gi|33862213|ref|NP_893774.1|_A      SKETLESILTEPRDALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKT
gi|123967080|ref|YP_001012161.      TKETLESILTEPRDALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKT
                                       :*::** :****::*** **:***.*.* *   :: :** **.:*:*

gi|87123285|ref|ZP_01079136.1|      GARALRGIVEELMLDLMYELPSRKNVKTFTVTRAMVEEHTGG-KVLPLPG
gi|116074349|ref|ZP_01471611.1      GARALRGIVEELMLDLMYDLPSRKNVKNFTVTRTMVEEHTGG-KVLPLPG
gi|148238400|ref|YP_001223787.      GARALRGIVEELMLDLMYELPSRKDASSFTITRAMVEEHTGG-KVLPLPG
gi|113955227|ref|YP_729302.1|_      GARALRGIVEELMLDLMYELPSDQNVTAFTITKAMVEEHTGG-KVLPLPG
gi|78211619|ref|YP_380398.1|_A      GARALRGIVEELMLDLMYDLPSQTSVKEFTVTRAMVEEHTGG-KVLPLPG
gi|260435985|ref|ZP_05789955.1      GARALRGIVEELMLDLMYDLPSQTSVKEFTVTRTMVEEHTGG-KVLPLPG
gi|78183645|ref|YP_376079.1|_A      GARALRGIIEEIMLDLMYDLPSQSSVKDFTVTRSMVEEHTGG-KVLPLPG
gi|116071741|ref|ZP_01469009.1      GARALRGIIEEIMLDLMYDLPSQSSVKDFTVTRAMVEEHTGG-KILPLPS
gi|33864599|ref|NP_896158.1|_A      GARALRGIVEELMLDLMYDLPSQSTVKEFTITQAMVEQHTGG-KVLPLPG
gi|33862334|ref|NP_893894.1|_A      GARALRGIIEELMLDLMYDLPSKKNVKKFTVTRTMVDEHTGG-KVLPLPA
gi|124021783|ref|YP_001016090.      GARALRGIIEELMLDLMYDLPSKKNVKKFTVTRTMVDEHTGG-KVLPLPA
gi|254431561|ref|ZP_05045264.1      GARALRGILEELMLELMYDLPSRRNVKTFTVTQELVEQRSQA-KVVPLGS
gi|318043032|ref|ZP_07974988.1      GARALRGIVEELMLDLMYDLPSDKSTKAFTVTRELVEERTKA-KVLPMPG
gi|87301612|ref|ZP_01084452.1|      GARALRGIVEELMLDLMYDLPSNNEVSSFTITRELVEQRSKA-KVLPYPN
gi|148241164|ref|YP_001226321.      GARALRGIIEDLMLDLMYDLPSQNEVQKFVITEELVDECHGN-KVLPHPS
gi|72383093|ref|YP_292448.1|_A      GARALRGIVEEIMLDLMYSLPSQTKIKNFNVTKKMVDESTGG-KVVPLLS
gi|159904324|ref|YP_001551668.      GARALRGIVEELMVDLMYKLPSEKNVSDFTVTKKMVDEMIIGGKVLKLPS
gi|33241266|ref|NP_876208.1|_A      GARALRGIVEELMLELMYKLPSQDEIKNCSVTQAMVEAITGG-KIVPLPP
gi|254526778|ref|ZP_05138830.1      GARALRSIIEELMLDVMYTLPSEENIKEFTITKKMVDNLFSS-KIVKLPS
gi|157414263|ref|YP_001485129.      GARALRSIIEELMLDVMYTLPSEENIKEFTITKKMVDNLFSS-KIVKLPS
gi|78780134|ref|YP_398246.1|_A      GARALRSIIEELMLDVMYTLPSEKNVKEFTITKKMVDNLFSS-KIVKLPS
gi|126697185|ref|YP_001092071.      GARALRSIIEELMLDIMYTLPSEENVKEFTITKKMVDNLFSS-KIVKLPS
gi|123969398|ref|YP_001010256.      GARALRSIIEELMLDIMYTLPSEENVKEFTITKKMVDNLFSS-KIVKLPS
gi|33862213|ref|NP_893774.1|_A      GARALRSIIEELMLDLMYTLPSQEEVKEFIITKKMVDKLFLS-KIVKLPA
gi|123967080|ref|YP_001012161.      GARALRSIIEELMLDLMYTLPSQEEVTKFTITKKMVDNLFSS-KIVKLPA
                                    ******.*:*::*:::** ***        :*. :*:      *::    

gi|87123285|ref|ZP_01079136.1|      NERQQESA--
gi|116074349|ref|ZP_01471611.1      SDRQQESA--
gi|148238400|ref|YP_001223787.      SERQQESA--
gi|113955227|ref|YP_729302.1|_      TKQHKESA--
gi|78211619|ref|YP_380398.1|_A      AEQQKTA---
gi|260435985|ref|ZP_05789955.1      TEQQKTA---
gi|78183645|ref|YP_376079.1|_A      TDQQKTA---
gi|116071741|ref|ZP_01469009.1      TDQQKTA---
gi|33864599|ref|NP_896158.1|_A      TEQQKTA---
gi|33862334|ref|NP_893894.1|_A      NDERSHQESA
gi|124021783|ref|YP_001016090.      NDERSHKESA
gi|254431561|ref|ZP_05045264.1      SHEDAQASA-
gi|318043032|ref|ZP_07974988.1      SDQVQQESA-
gi|87301612|ref|ZP_01084452.1|      VVSQQESA--
gi|148241164|ref|YP_001226321.      SLEQQSA---
gi|72383093|ref|YP_292448.1|_A      NEKRIVKESA
gi|159904324|ref|YP_001551668.      NEKIDHPESA
gi|33241266|ref|NP_876208.1|_A      SDKRATKESA
gi|254526778|ref|ZP_05138830.1      GSKRIIKESA
gi|157414263|ref|YP_001485129.      GSKRIIKESA
gi|78780134|ref|YP_398246.1|_A      GSKRIIKESA
gi|126697185|ref|YP_001092071.      GSKRVIKESA
gi|123969398|ref|YP_001010256.      GSKRIIKESA
gi|33862213|ref|NP_893774.1|_A      GSQRIIKESA
gi|123967080|ref|YP_001012161.      GSHRIIKESA