IMPORTANT NOTICE: electrical maintenance in the Annotathon server room on Monday December 11th 2017 from 18:00 to 22:00 (Paris time, also known as Central European Summer Time GMT+1H) means no annotation will be possible during this downtime!

Forum "Homolog hunting: BLAST"

Thread subject: blast results

[ Return to forums ]
blast results
B_hajra
27 Apr 2011 9:27
Non evaluated contribution
on the basis of evalue these blast results were found.the one closest to 0 was selected.

>gi|78780134|ref|YP_398246.1| ATP-dependent protease ATP-binding subunit [Prochlorococcus marinus str. MIT 9312]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDNQANTNNSPQVKKKLTNDNPK
KSVPLELTSIPKPLEIKSFLDNQVVGQESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGL
EDIVQKRMGKHSIGFTTNSDQNNVDTKKLVEPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKET
LESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAYKRKTGARALRSIIEELMLDVMYTLPSEK
NVKEFTITKKMVDNLFSSKIVKLPSGSKRIIKESA

>gi|126697185|ref|YP_001092071.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9301]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDNQANTNNSPQVKKKLPTDNPK
KSVPLELTSIPKPLEIKSFLDNQVVGQESAKKILSVAVYNHYKRLAWKFKEENKNSNSKDSQATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGL
EDIVQKRMGKHSIGFTTNSDQNKVDTKKIVDPRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKET
LESILTQPRDALVKQFKTLLSMDNVELSFEPDSVEAIANEAYKRKTGARALRSIIEELMLDIMYTLPSEE
NVKEFTITKKMVDNLFSSKIVKLPSGSKRVIKESA

>gi|123969398|ref|YP_001010256.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. AS9601]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDNQANTNNPPQVKKKLPTDNPK
KSVPLELTSIPKPLEIKSFLDNQVVGQESAKKILSVAVYNHYKRLAWKVKEDSKNNNATDSQATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGL
EDIVQKRMGKHSIGFTTNSDQNKVDTKKIVDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKET
LESILTQPRDALVKQFKTLLSMDNVELSFEPDSVEAIANEAYKRKTGARALRSIIEELMLDIMYTLPSEE
NVKEFTITKKMVDNLFSSKIVKLPSGSKRIIKESA

>gi|254526778|ref|ZP_05138830.1| ATP-dependent Clp protease, ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9202]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDNQAHTNNSQQVKKKLPNDNPK
KSVPLELTSIPKPLEIKSFLDNQVVGQESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSDMNVELAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGL
EDIVQKRMGKHSIGFTTNSDKNKVDTKKIIDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKET
LESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAFKRKTGARALRSIIEELMLDVMYTLPSEE
NIKEFTITKKMVDNLFSSKIVKLPSGSKRIIKESA

>gi|157414263|ref|YP_001485129.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9215]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELLDNQTNTNNSQQVKKKLPNDNPK
KCVPLELTSIPKPLEIKSFLDNQVVGQESAKKILSVAVYNHYKRLAWKVKEESKNSNSTDSQATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEMNVELAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGL
EDIVQKRMGKHSIGFTTNSDQNKVDTKKIIDPRDSLKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKET
LESILTQPRDALVKQFKTLLSMDNVELKFEPDSVEAIANEAFKRKTGARALRSIIEELMLDVMYTLPSEE
NIKEFTITKKMVDNLFSSKIVKLPSGSKRIIKESA

>gi|33862213|ref|NP_893774.1| ATP-dependent protease ATP-binding subunit [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELIDTQAKINNSPQVKKKLPTNNSD
KSIPLELTSIPKPLEIKTFLDNQVVGQESAKKILSVAVYNHYKRLAWRLKEENKENDSNDLQATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATSLTEAGYVGEDVENILLRLLQKSEMNVDLAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPNHDCIQIDTSQILFICGGAFIGL
EDIVQKRLGKNSIGFTTNPDESKINAKKIIDSRDALKNLEQDDLVKYGLIPEFIGRIPVCAVLDRLSKET
LESILTEPRDALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKTGARALRSIIEELMLDLMYTLPSQE
EVKEFIITKKMVDKLFLSKIVKLPAGSQRIIKESA

>gi|123967080|ref|YP_001012161.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9515]
MAKFDAHLKCSFCAKSQDQVRKLIAGPGVYICDECIDLCNEILDEELIDTQAKLNNSTQVKKKLPINNPD
TSIPFELTSIPKPLEIKTFLDNQVVGQESAKKILSVAVYNHYKRLTWRLKEENKDNNSNDCHATKLQKSN
ILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSEMNVDLAQKGIIYID
EIDKIARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGL
EDIVQKRLGRHSIGFTTNSDESKIDAKKLVDSRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKET
LESILTEPRDALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKTGARALRSIIEELMLDLMYTLPSQE
EVTKFTITKKMVDNLFSSKIVKLPAGSHRIIKESA

>gi|33241266|ref|NP_876208.1| ATP-dependent protease ATP-binding subunit [Prochlorococcus marinus subsp. marinus str. CCMP1375]
MAKFEAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELLENPSKVKDGNDSKIPTSASTVS
KPAPTLSSIPKPIEIKSFLDNQVVGQEDAKKILSVAVYNHYKRLAWQGSETNEIDLHTTKLHKSNILLIG
PTGSGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSDMDVELAQRGIIYIDEIDKI
ARKSENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYQDSIQIDTSQILFICGGAFVGLEDIVQ
KRLGRNSIGFMTNDNRGKSRKSNDLPKNQVLNNLEPDDLVRYGLIPEFIGRMPVSAVLEPLDVDALEAIL
QEPRDAVIKQFITLMSMDNVKLTFEENAIKSIAKEAFRRKTGARALRGIVEELMLELMYKLPSQDEIKNC
SVTQAMVEAITGGKIVPLPPSDKRATKESA

>gi|33862334|ref|NP_893894.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9313]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCTEILDEELVDSQGNPRHSSESNRKSATASHK
SGKPAPTLATIPKPQQIKSFLDKQVVGQEAAKKVLSVAVYNHYKRLAWQGDGQGETDLSATRLHKSNILL
IGPTGCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVEHAQRGIIYVDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFIGLEDV
VQKRLGRNAIGFMPSDGRGRSRANRDLQASQVLHHLEADDLVRYGLIPEFIGRIPVSAVLEPLDSQALES
ILTEPRDALVKQFSTLLSMDNVQLEFESDAVEAIAQEAHRRKTGARALRGIIEELMLDLMYDLPSKKNVK
KFTVTRTMVDEHTGGKVLPLPANDERSHQESA

>gi|124021783|ref|YP_001016090.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9303]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCTEILDEELVDSQGNPRHSSESNRKSATASHK
SGKPAPTLATIPKPQEIKNFLDKQVVGQEAAKKVLSVAVYNHYKRLAWQGDGQGETDLSATRLHKSNILL
IGPTGCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVEHAQRGIIYVDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFIGLEDV
VQRRLGRNAIGFMPSDGRGRSRANRDLKASQVLHHLEADDLVRYGLIPEFIGRIPVSAVLEPLDSQALES
ILTEPRDALVKQFSTLLSMDNVQLEFESDAVEAIAQEAHRRKTGARALRGIIEELMLDLMYDLPSKKNVK
KFTVTRTMVDEHTGGKVLPLPANDERSHKESA

>gi|159904324|ref|YP_001551668.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9211]
MAKFEAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDNQTKTREANNPSNKNHTAITS
TSKPAPTLATIPKPIDIKDFLDKQVVGQEVAKKILSVAVYNHYKRLAWQGDGNQETDLTATRLHKSNILL
IGPTGSGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDIELAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYHDCIQIDTSQILFICGGAFVGLEDI
VQKRLGKNSIGFMPTDSRGQNHLNRDLDNNQMINNLEPDDLIRYGLIPEFIGRMPVTAVLEPLNSEALEA
ILKEPRDAVIKQFRTLMSMDNVKLEFDEGAVTAIAQEAFRRKTGARALRGIVEELMVDLMYKLPSEKNVS
DFTVTKKMVDEMIIGGKVLKLPSNEKIDHPESA

>gi|78211619|ref|YP_380398.1| ATP-dependent protease ATP-binding subunit [Synechococcus sp. CC9605]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDGQGNSRHSHEPSRKAMPAARK
SSKPAPTLASIPRPQDIKSFLDQQVVGQDAAKKVMSVAVYNHYKRLAWQGDGQGETEETATRLHKSNILL
IGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKAEMDVDQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDV
VQKRMGRNAIGFMPSDGRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDESALQS
ILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKTGARALRGIVEELMLDLMYDLPSQTSVK
EFTVTRAMVEEHTGGKVLPLPGAEQQKTA

>gi|72383093|ref|YP_292448.1| ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. NATL2A]
MAKFEAHLKCSFCGKAQDQVRKLIAGPGVYICDECIDLCNEILDEELIDNPTHQRNGHEQSRKAKAATTT
AKPAPTLASIPKPIEIKKFLDAQVVGQEPAKKILSVAVYNHYKRLAWKGDGSGETDLTATKLQKSNILLI
GPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVDLAQRGIIYIDEIDK
IARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYGDSIQIDTSQILFICGGAFVGLDDVV
EKRLGKNSIGFIQNENRTRTKSNRDRVGADLINDLEPDDLVKYGLIPEFIGRMPVSAILEPLNAKALESI
LTEPRDALVKQFRTLLSMDNVELSFDEDAVEAIAQEAYKRKTGARALRGIVEEIMLDLMYSLPSQTKIKN
FNVTKKMVDESTGGKVVPLLSNEKRIVKESA

>gi|87123285|ref|ZP_01079136.1| ATP-dependent Clp protease, ATP-binding subunit ClpX [Synechococcus sp. RS9917]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDAQGNPRHGAEPARKGGQAPRK
SSKPAPTLASIPKPQEIKSFLDRQVVGQEAAKKVLSVAVYNHYKRLAWQGDGNGETEQTATRLHKSNILL
IGPTGCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKSDMDVDQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDV
VQKRLGRNSIGFMPDAGRGRHRANRDLQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPLDEHALES
ILTEPRDALVKQFRTLLSMDNVQLDFEAGAVEAIAHEAHRRKTGARALRGIVEELMLDLMYELPSRKNVK
TFTVTRAMVEEHTGGKVLPLPGNERQQESA

>gi|33864599|ref|NP_896158.1| ATP-dependent protease ATP-binding subunit ClpX [Synechococcus sp. WH 8102]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDSQGNRGQAADSSRKAAPAAKK
SGKPAPTLASIPKPQQIKSFLDEQVVGQEAAKKVMSVAVYNHYKRLAWQGDGQGETEQTATRLHKSNILL
IGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDEV
VQKRMGRNAIGFMPTDGRGRSRANRELQTTQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPLDESALES
ILTEPRDALVKQFRTLLSMDNVQLQFEPAAIHAIAQEAHRRKTGARALRGIVEELMLDLMYDLPSQSTVK
EFTITQAMVEQHTGGKVLPLPGTEQQKTA

>gi|260435985|ref|ZP_05789955.1| ATP-dependent Clp protease, ATP-binding subunit ClpX [Synechococcus sp. WH 8109]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDGQGNPRHSHEPSRKATPAARK
SSKPAPTLASIPRPQDIKNFLDQQVVGQDAAKKVMSVAVYNHYKRLAWQGDGQGETEETATRLHKSNILL
IGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVEQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDV
VQKRMGRNAIGFMPGDGRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDESALQS
ILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKTGARALRGIVEELMLDLMYDLPSQTSVK
EFTVTRTMVEEHTGGKVLPLPGTEQQKTA

>gi|78183645|ref|YP_376079.1| ATP-dependent protease ATP-binding subunit ClpX [Synechococcus sp. CC9902]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDSQGNPRAGAEPSRKATPAAHK
SNKPAPTLASIPKPLEIKSFLDQQVVGQNAAKKVMSVAVYNHYKRLAWQGDGKGETEETATRLHKSNILL
IGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDV
VQKRMGRNAIGFMPPADSRGRSRANRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPLDEKTLE
SILTEPRDALVKQFRTLLSMDNVQLQFADDAITAIAQEAHRRKTGARALRGIIEEIMLDLMYDLPSQSSV
KDFTVTRSMVEEHTGGKVLPLPGTDQQKTA

>gi|116071741|ref|ZP_01469009.1| ATP-dependent protease ATP-binding subunit [Synechococcus sp. BL107]
MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVDSQGNPRTGAEPSRKAAPAARK
SNKPAPTLASIPKPLEIKSFLDQQVVGQNAAKKLMSVAVYNHYKRLAWQGDGQGETEETATRLHKSNILL
IGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDV
VQKRMGRNAIGFMPPADSRGRNRTNRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPLDEKTLE
SILTEPRDALVKQFRTLLSMDNVQLEFADDAITAIAQEAHRRKTGARALRGIIEEIMLDLMYDLPSQSSV
KDFTVTRAMVEEHTGGKILPLPSTDQQKTA

>gi|148238400|ref|YP_001223787.1| ATP-dependent protease ATP-binding subunit [Synechococcus sp. WH 7803]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDSQGGSRQGAEPSRKAGAAQAR
KSTKPAPTLASIPKPQDIKAFLDQQVVGQEAAKKVMSVAVYNHYKRLAWQGDGKGETEETATRLHKSNIL
LIGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVDLAQRGIIYIDEI
DKIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDD
VVQKRMGRNAIGFMPTEGRGRGKATRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDEHALE
SILTEPRDALVKQFRTLLSMDNVQLEFEPSAIEAIAQEAHRRKTGARALRGIVEELMLDLMYELPSRKDA
SSFTITRAMVEEHTGGKVLPLPGSERQQESA

>gi|116074349|ref|ZP_01471611.1| ATP-dependent protease ATP-binding subunit [Synechococcus sp. RS9916]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDAQGNPRQGAEQGRKAAQTTRK
SNKPAPTLATIPKPQEIKAFLDHQVVGQDAAKKVLSVAVYNHYKRLAWQGDGKGETEETATRLHKSNILL
IGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDV
VQKRMGRNAIGFVPSSDGRGRNKASRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVLEPLDEEALK
SILTEPRDALVKQFRTLLSMDNVQLDFETEAVEAIASEAHRRKTGARALRGIVEELMLDLMYDLPSRKNV
KNFTVTRTMVEEHTGGKVLPLPGSDRQQESA

>gi|113955227|ref|YP_729302.1| ATP-dependent protease ATP-binding subunit ClpX [Synechococcus sp. CC9311]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELIDAQGNPRHGAEPSKKTAAGGTR
KTSKPAPTLATIPKPQEIKGFLDEQVVGQEAAKKVMSVAVYNHYKRLAWQGDGQGEAAQTATRLHKSNIL
LIGPTGCGKTLLAQTLAEMLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVEQAQRGIIYIDEI
DKIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDD
VVQKRMGRNAIGFVPNDGRGRNRATRDIQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAVLEPLDEHALE
SILTEPRDALVKQFSTLLSMDNVQLDFEAQAVEAIAKEAHRRKTGARALRGIVEELMLDLMYELPSDQNV
TAFTITKAMVEEHTGGKVLPLPGTKQHKESA

>gi|254431561|ref|ZP_05045264.1| ATP-dependent Clp protease, ATP-binding subunit ClpX [Cyanobium sp. PCC 7001]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELVDTHGSGGGARHAAEPARGKSGT
KKPAKPVPTLAEVPKPQEIKAFLDRQVVGQEEAKKSLSVAVYNHYKRLAWQGDGKGETDETATRLHKSNI
LLIGPTGCGKTLLAQTLAEILEVPFAVADATTLTEAGYVGEDVENILLRLLQKADMDVELAQRGIIYIDE
IDKIARKSENPSITRDVSGEGVQQALLKLLEGTTANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLD
DVVQKRMGRNAIGFINPEGNNRPRSARERLAADVLRHLEPDDLVKYGLIPEFIGRLPVTAVLEPLDIHAL
EAILTEPRDALVKQFQTLLSMDDVQLHFEQGAIEAIAAEAHRRKTGARALRGILEELMLELMYDLPSRRN
VKTFTVTQELVEQRSQAKVVPLGSSHEDAQASA

>gi|87301612|ref|ZP_01084452.1| ATP-dependent protease ATP-binding subunit [Synechococcus sp. WH 5701]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELVESHGSARPSGDHGRKPAVKKSS
KPAPTLASIPRPQEIKSFLDQQVVGQDEAKKVLSVAVYNHYKRLAWQGDGKGETDRSATRLHKSNILLIG
PTGCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADLDVEQAQRGIIYIDEIDKI
ARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEEVVQ
RRLGRNSIGFLPADGRGRGHRELKASHVLRHLEPDDLVRYGLIPEFTGRLPVSAVLEPLDVRSLESILTE
PRDALVKQFQTLMSMDSVRLEFEPGAIEAIAHEAHRRRTGARALRGIVEELMLDLMYDLPSNNEVSSFTI
TRELVEQRSKAKVLPYPNVVSQQESA

>gi|318043032|ref|ZP_07974988.1| ATP-dependent protease ATP-binding subunit ClpX [Synechococcus sp. CB0101]
MPKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDEELVEGHGSGARQPAEAKGKSPAKKS
AKPAPTLAEIPKPREIKAHLDAQVVGQEEAKKVLSVAVYNHYKRLAWQGDGKGESNETATRLHKSNILLI
GPTGCGKTLLAQTLAELLDVPFAVADATTLTEAGYVGEDVENILLRLLQKADLDVDQAQRGIIYIDEIDK
IARKSENPSITRDVSGEGVQQALLKLLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVV
QRRMGRNSIGFIPEGGRSRSRQNKDQQAAHVLRHLEPDDLVKYGLIPEFIGRLPVSAVLEPLDSRALEAI
LTEPRDALVKQFQTLLSMDEVRLDFEPGAVEAIAAEAHRRKTGARALRGIVEELMLDLMYDLPSDKSTKA
FTVTRELVEERTKAKVLPMPGSDQVQQESA

>gi|148241164|ref|YP_001226321.1| ATP-dependent protease ATP-binding subunit ClpX [Synechococcus sp. RCC307]
MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDEELVDGQAGARQGQGDASRKQAAPRK
PSKPAPTLATIPKPQEIKAHLDEQVVGQNDAKKVLSVAVYNHYKRLAWQGDGSTEPESSATRLHKSNILL
IGPTGCGKTLLAQTLAEMMEVPFAVADATTLTEAGYVGEDVENILLRLLQKADGDVEQAQRGIIYIDEID
KIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDV
IQRRMGRNAIGFVPGETRNGRSRQKDQEASQVLRNLEPDDLVKYGLIPEFIGRIPVSAVLEPLDEQALEA
ILTEPRDALVKQFQTLLSMDSVRLEFQPEAVRAIAREAHRRKTGARALRGIIEDLMLDLMYDLPSQNEVQ
KFVITEELVDECHGNKVLPHPSSLEQQSA