Site undergoing maintenance! No connection possible during this time!

Forum "Multiple sequence alignements"

Thread subject: multiple sequnce alignmnt

[ Return to forums ]
multiple sequnce alignmnt
sid_afo
18 Apr 2011 9:29
Non evaluated contribution
CLUSTAL W (1.83) multiple sequence alignment

gi|119486597|ref|ZP_01620647.1|   MTA-------LPLSH-----------------------------------
gi|148381088|ref|YP_001255629.1|  MLLFTMVY-NNERED-----------------------------------
gi|150390358|ref|YP_001320407.1|  MIKKVRLKH-----------------------------------------
gi|229496468|ref|ZP_04390183.1|   MKKRNSLLSVVPFPTDYHHKLIRFALIIGSFFLLFLGMGEYVFAQNKVDE
gi|254416267|ref|ZP_05030021.1|   MEFD-FLP-NLPKSD-----------------------------------
gi|315637245|ref|ZP_07892464.1|   MIDINS----LPTPT-----------------------------------
gi|322807449|emb|CBZ05023.1|      MLLFTMVY-NDERED-----------------------------------
gi|77165335|ref|YP_343860.1|      MPV--------PLPN-----------------------------------
                                  *                                                

gi|119486597|ref|ZP_01620647.1|   ------------------HSDRF--STGDA--TRTPE--SNARQSTPTEI
gi|148381088|ref|YP_001255629.1|  ------------------LIDKLV--KLKECFQ-----------------
gi|150390358|ref|YP_001320407.1|  ---------------------------ISEIIDN----------------
gi|229496468|ref|ZP_04390183.1|   SSPLATGRWVKISVDKSGLYTLSYDKLRQMGFSNPEAVGVYGRG-GRLLS
gi|254416267|ref|ZP_05030021.1|   ------------------LDDRAFQDLVEECILRIPR--YCPEWTNYNPS
gi|315637245|ref|ZP_07892464.1|   -----------------VLQILNYLKIKQENIDTLKE--KYPDWE-HIES
gi|322807449|emb|CBZ05023.1|      ------------------LIDKLV--KLKECFQ-----------------
gi|77165335|ref|YP_343860.1|      ------------------LDDRRWADLVEEGRTLIPI--HAPEWTDHNIH
                                                              .                    

gi|119486597|ref|ZP_01620647.1|   TPVRTLKELVARLHRE-QQNV---NEL--------LSS------------
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  -----------------------------REPIGLFYA------------
gi|229496468|ref|ZP_04390183.1|   EDLQKA-SSVAGLPQVPLLRHNNAIY---------FYGEGTTHWYYDTAQ
gi|254416267|ref|ZP_05030021.1|   DPGITLIELFAWLTDQMLLRF---NQVPRRNYVTFLEL------------
gi|315637245|ref|ZP_07892464.1|   DDFMPNIEANAYRELLLRQEF---NQLALA----FFLA------------
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      DPGITLMELFAWVAEMDIYQL---NQIPDRHKRKFLAL------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   L---------GFALR-------------------SFKNL------NQFL-
gi|148381088|ref|YP_001255629.1|  -------------------------------------SR------NVVI-
gi|150390358|ref|YP_001320407.1|  V---------GIKID-----S---TKTNCTMCYVGVDNS------TGDAW
gi|229496468|ref|ZP_04390183.1|   K-------------------CYRHVTNHYTRLGYYLLSDAATPGPLLMEE
gi|254416267|ref|ZP_05030021.1|   L---------GIRLQ-----A---PTPAQTQQTFYLSSS------LPEAY
gi|315637245|ref|ZP_07892464.1|   TATKADLDHWGVAFDCTRLEG---SKPW-ANYTF----------------
gi|322807449|emb|CBZ05023.1|      -------------------------------------SR------NVVI-
gi|77165335|ref|YP_343860.1|      V---------GIVPE-----P---PYPARTMLHFSLASS------STVV-
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ELTPLVASRVT---------------------------------------
gi|148381088|ref|YP_001255629.1|  GLSENIEDK-----------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   RKPTASQAAPALTSTYDALVLHE-RDIFSPKQSGRMLFGEPLLGGQPKRI
gi|254416267|ref|ZP_05030021.1|   TIPTGTEVATVRTQADDAIIFSTDRPL-----------------------
gi|315637245|ref|ZP_07892464.1|   --------------------------------------------------
gi|322807449|emb|CBZ05023.1|      GLSENIEDK-----------------------------------------
gi|77165335|ref|YP_343860.1|      QLPETVEFEGADP-FGVATGFRTLAPI-----------------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ------------------------------------------D-----A-
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   IVNLGHGEQAGNAIKINYAYMARPSTQGFFTLSLDGRELAKDPISLSEDH
gi|254416267|ref|ZP_05030021.1|   -------------------VIAKPSIRHFLTS----------DIAEEEPQ
gi|315637245|ref|ZP_07892464.1|   --------------------------------------------SLSEAK
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      -------------------CIAPGFLKAIQL----------KD-----QR
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ------------------DG--GALVLFKPNGQ------VRFQRLH----
gi|148381088|ref|YP_001255629.1|  ---------------------------------------THFIKIY----
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   TTRDFLAGIYHFRPNVTVTSSSRNLALDASYRPAGDNAYVDFLEFIIE--
gi|254416267|ref|ZP_05030021.1|   VLRDRFVGTWTQQPGGEWQG--LELSIFNEQPQVGNC-------------
gi|315637245|ref|ZP_07892464.1|   ----------------------------------------------TTDI
gi|322807449|emb|CBZ05023.1|      ---------------------------------------THFIKIY----
gi|77165335|ref|YP_343860.1|      GF-HDFTDSWV-------RG--ENFAVFGTEPQLGTELYFGFSEAFPQEE
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ------------CQEGRQC--QDIRQALETATRQVS-----------V--
gi|148381088|ref|YP_001255629.1|  ------------CEEKFLN--KKVIDSINN--ELVN-----------I--
gi|150390358|ref|YP_001320407.1|  -----------------AED------------------------------
gi|229496468|ref|ZP_04390183.1|   --------QRLHYTTGQQTDFRRIQEG-----------------------
gi|254416267|ref|ZP_05030021.1|   --------------------FYLVFEG-----------------------
gi|315637245|ref|ZP_07892464.1|   TINKGLAL---------ADD------------------------------
gi|322807449|emb|CBZ05023.1|      ------------CEEKFLN--KKVIDSINN--ELVN-----------I--
gi|77165335|ref|YP_343860.1|      FVSLFFSFAHHRSDEAERC--RLIDES--SARQRICRTPLSDFPCPNVAP
                                                                                    

gi|119486597|ref|ZP_01620647.1|   QPLNAVDRMPKNMLKS----------------------------YI----
gi|148381088|ref|YP_001255629.1|  LYGITADRFIKVELNKFITDDYFFLKQEEIKELSEKISDVLKDRDKRYIE
gi|150390358|ref|YP_001320407.1|  ---------------------------------------------FRTEE
gi|229496468|ref|ZP_04390183.1|   ---------------------------------------------SDALL
gi|254416267|ref|ZP_05030021.1|   ---------------------------------------------DQPIE
gi|315637245|ref|ZP_07892464.1|   --------E----SKF----------------------------EARLIE
gi|322807449|emb|CBZ05023.1|      LYGITTDRFIKVELNKFITGDYFFLKQEEIKELSEKISDVLKDRDKRYIE
gi|77165335|ref|YP_343860.1|      LSPPVEDRIKKTLLHH----------------------------GVRLVW
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --------------------------------------------------
gi|148381088|ref|YP_001255629.1|  DSIYCLNKKN-----------------------EIIK-------------
gi|150390358|ref|YP_001320407.1|  ECIAWL-KQE-----------------------RL---------------
gi|229496468|ref|ZP_04390183.1|   YQVSGLPQNGIILATSPESSLPYRVQTTQSGGTHSFTTQALDREGQPYNF
gi|254416267|ref|ZP_05030021.1|   GNVIALRIKG-----------------------EAATSTGINPEDPPRLW
gi|315637245|ref|ZP_07892464.1|   DIIIKK-GQT-----------------------EAIG-------------
gi|322807449|emb|CBZ05023.1|      DSIYCLNKKN-----------------------EIIK-------------
gi|77165335|ref|YP_343860.1|      EILITADGDW-----------------------ELL--------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   -----------------------ANLDYQVSN------------------
gi|148381088|ref|YP_001255629.1|  -----------KIKKC-IDENN----------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   L---ACSWQDAY----------TPNVVGEVANQNIHSAPIPDLIILSPEA
gi|254416267|ref|ZP_05030021.1|   QAWNGMSWQP--------------ILL-----------------------
gi|315637245|ref|ZP_07892464.1|   -----------KVELQVYTQSS----------------------------
gi|322807449|emb|CBZ05023.1|      -----------KIKKC-IDENN----------------------------
gi|77165335|ref|YP_343860.1|      -----------EPDH-INDETRALTLDGQVRL------------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --------------FLGPEVQVFGTAILVNNIERG---------------
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   FLSEAERLAEFHRSVDGMQVLVVGETALFNEFNAGTPDATAYRLMAKYFY
gi|254416267|ref|ZP_05030021.1|   --QEA---------------------------------------------
gi|315637245|ref|ZP_07892464.1|   ---------------------DVQTNNIITTLPY----------------
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      --------------SIPSEMAKKKLGQVINELYYL---------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --------------------------------------------------
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   D--RWMAAHPGEKQSAQQLLLFGDGAADNRKVSVHWESIGLQNTPFLLTY
gi|254416267|ref|ZP_05030021.1|   DDST-------KGFSFSELIRQGGNPLQGADVVLHL-PLRLPVTQF-VTY
gi|315637245|ref|ZP_07892464.1|   ----------------------------------------------ILSA
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      --------------------------------------------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   -----RLYVFSHDL----NYHWTPT-RQ-------------KLMRLVA--
gi|148381088|ref|YP_001255629.1|  ------------EI----NIDGFLTFRC-------------REL------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   QSSNSLNIYSYTTD----DYFGYLR-DGEDHLTNGRKQLSIGIGRFPIRT
gi|254416267|ref|ZP_05030021.1|   QGRWLRCIYNQPQF----NQPGYMR-SP-------------RIVGLDVRS
gi|315637245|ref|ZP_07892464.1|   KANSE---FKAGSNVESDDD----F-RF-------------RILLSMS--
gi|322807449|emb|CBZ05023.1|      ------------EI----NIDGFLTFRC-------------REL------
gi|77165335|ref|YP_343860.1|      -----RVRFVAGSY----DAPPFLH-RL-------------ALNGIIA--
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ---------DQT---------------AVAIANDELAVS-LREKERLDRE
gi|148381088|ref|YP_001255629.1|  -------------------------------FKDIKGII-DKIVEKY---
gi|150390358|ref|YP_001320407.1|  -----------------------------------------------INK
gi|229496468|ref|ZP_04390183.1|   LGEAK-AAVDKTIRYAENGDPGVWKTRTLFLADNQDGYSHARQA---NEL
gi|254416267|ref|ZP_05030021.1|   IGGTVEVTQCT------------------------------------TIR
gi|315637245|ref|ZP_07892464.1|   ---------DKS---------------TAGSKDTYKSYA-YKA----DER
gi|322807449|emb|CBZ05023.1|      -------------------------------FKDIKGII-DKIVEKY---
gi|77165335|ref|YP_343860.1|      ---------EQA---------------AS--VGEIKTID-DQAIEAILLG
                                                                                    

gi|119486597|ref|ZP_01620647.1|   LEIGAEIQVRLLPRKC----------------------P---KIPGVDVA
gi|148381088|ref|YP_001255629.1|  -----------------------------------------------MVD
gi|150390358|ref|YP_001320407.1|  IEVYKKALVT------W-----------------------GQEA------
gi|229496468|ref|ZP_04390183.1|   TEILEEIQPELIVNKVYLDAFPKSTVNGLTTVPTAKRKLLDAIDQGLLLV
gi|254416267|ref|ZP_05030021.1|   NEILGE-----------SDGNPGQT------FQLQGRGILPRREEEHILV
gi|315637245|ref|ZP_07892464.1|   IEDIKVVN------------------------------------------
gi|322807449|emb|CBZ05023.1|      -----------------------------------------------MVD
gi|77165335|ref|YP_343860.1|      ISDGSPNQKWTLPEAP----------------------V---HVPSFQLY
                                                                                    

gi|119486597|ref|ZP_01620647.1|   AHCQ-TANRVGGDYY-----------------------DFIP--------
gi|148381088|ref|YP_001255629.1|  KEYN-EFIKLLKYFV-----------------------EIEE--------
gi|150390358|ref|YP_001320407.1|  --------QITMVFE-----------------------EMAE--------
gi|229496468|ref|ZP_04390183.1|   NYTGHGSPTAWTDEQIMTLPDVQRLSNKRLPLWITATCDFCPYDNSTTSA
gi|254416267|ref|ZP_05030021.1|   IPPG-GLPQIWQEVN-----------------------DFAD--------
gi|315637245|ref|ZP_07892464.1|   ------------GLK-----------------------DFS---------
gi|322807449|emb|CBZ05023.1|      KEYN-EFIKLLKYFV-----------------------EIEE--------
gi|77165335|ref|YP_343860.1|      IQEE-DKWRVWRRRS-----------------------DFDE--------
                                                                        ::          

gi|119486597|ref|ZP_01620647.1|   --------SN----------------------------------------
gi|148381088|ref|YP_001255629.1|  --------SKLDKL-----------------------NILIDPT-GKYTL
gi|150390358|ref|YP_001320407.1|  --------L-------------------------------------QKEL
gi|229496468|ref|ZP_04390183.1|   GEVAFLNDRGGASALFTTTRVVFDVPNQELNRHFLRTLFTQDKGGRLHQL
gi|254416267|ref|ZP_05030021.1|   --------SGPEDL-----------------------HYTIDAITGMIQF
gi|315637245|ref|ZP_07892464.1|   ------------------------------------------------TY
gi|322807449|emb|CBZ05023.1|      --------SKLDKL-----------------------NILIDPT-GKYTL
gi|77165335|ref|YP_343860.1|      --------SARSDS-----------------------DFLLDPTDGVITF
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --------------------------------------------------
gi|148381088|ref|YP_001255629.1|  K-------------------------------------------------
gi|150390358|ref|YP_001320407.1|  CKVLR---------------------------------------------
gi|229496468|ref|ZP_04390183.1|   GDVLRNAKNSAYTSDTINKLNFSLIGDPALRLKMPTHQAALLKINGKQPD
gi|254416267|ref|ZP_05030021.1|   GPLLREPSQ--LQEQTWWR---------SRSQRVPSQMLSLVSGRNSGVE
gi|315637245|ref|ZP_07892464.1|   IPLFL--------------GKNE---------------VEILEAIKNLIA
gi|322807449|emb|CBZ05023.1|      K-------------------------------------------------
gi|77165335|ref|YP_343860.1|      S-------------------------------------------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --------------------------------------------------
gi|148381088|ref|YP_001255629.1|  ----------DSE-----------------------GNDLTQE------V
gi|150390358|ref|YP_001320407.1|  ------------------------------------GEKVTGN------I
gi|229496468|ref|ZP_04390183.1|   PQKGISLHALERV----SLEGAIHDLSG-TIDGNFNGTIAITVFDAEQIS
gi|254416267|ref|ZP_05030021.1|   RREGAAMQSMERQYGAVPPRGAVIQMAAYRIGGGQQGNVQRGA------I
gi|315637245|ref|ZP_07892464.1|   EFCTVN--------------------------------------------
gi|322807449|emb|CBZ05023.1|      ----------DSE-----------------------GNDLTEE------V
gi|77165335|ref|YP_343860.1|      ----------DGEKGRVPPKGAQIY-AIYCATQAEAGNLSSGT------I
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ----FDQRESRPSVTSESISQEKTQENWSIV-------------------
gi|148381088|ref|YP_001255629.1|  YIEVPDVKYV------------------ENI-------------------
gi|150390358|ref|YP_001320407.1|  AEEIADVE----------------------I-------------------
gi|229496468|ref|ZP_04390183.1|   STLKENIPEY-----------------QESVYKFSEYPGIIYAGNAEVVN
gi|254416267|ref|ZP_05030021.1|   QVLKSAVPYV------------------ANV-------------------
gi|315637245|ref|ZP_07892464.1|   --------------------------------------------------
gi|322807449|emb|CBZ05023.1|      YIEVSDVKYV------------------ENI-------------------
gi|77165335|ref|YP_343860.1|      HRL-ADSPHNRRVLGS---DYEKIKESLAVI-------------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ------------IGDVMGKGVPAGLIMTMTRGMLRAEVLNRHSPAKI---
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   GQFTASFVVPKDISYSDKKG---------------------KINFYAYSS
gi|254416267|ref|ZP_05030021.1|   ------------INYSPARN---------------------GADAES---
gi|315637245|ref|ZP_07892464.1|   -----VYY------YSE-----------------------------N---
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      ------------TNPIAATG---------------------GAPAEI---
                                                                                    

gi|119486597|ref|ZP_01620647.1|   -----------------------------------LEHLNRVMYADLETS
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   SLKREAMGVDKSLKLEMGGSGSEEDKTPPEIQRIYLNDSTLRAPIVVGTT
gi|254416267|ref|ZP_05030021.1|   -----------------------------------LEQAVIRVPRLLRTR
gi|315637245|ref|ZP_07892464.1|   -----------------------------------ADELMKQRIEASLNS
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      -----------------------------------LTHAIGRAIEQREKT
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --------------------------------NRFVTLFYSEY-DP----
gi|148381088|ref|YP_001255629.1|  --------------------------------------------SVDD--
gi|150390358|ref|YP_001320407.1|  --------------------------------------------MLEQ--
gi|229496468|ref|ZP_04390183.1|   PLFVADLFDMSGINLSAGGLGHGITLSIDNNPTYTFTLNDYYRANQLEAG
gi|254416267|ref|ZP_05030021.1|   --------------------------------DRAVTREDFEY-LAMEAG
gi|315637245|ref|ZP_07892464.1|   --------------------------------ESVRPLTDYVK-VVEAT-
gi|322807449|emb|CBZ05023.1|      --------------------------------------------SVDD--
gi|77165335|ref|YP_343860.1|      --------------------------------QRAVTLQDYEV-LALQTP
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ---TTRILSYSNAAHHPPLLWQA-STRSIQQLDTLGMLIGLDA-------
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   KGSV------------------------------VYLLPTLPEGDHTAT-
gi|254416267|ref|ZP_05030021.1|   GGSIARVLCLS------PILKEDAGRV------RLLLVPNANTDGIERGE
gi|315637245|ref|ZP_07892464.1|   -----------------------------PKLFKIEAVLNCEK-------
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      GVQLARVKAWANLHPGLPCLKAQ-GLI------TVIILPYLPL-------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   --DTRYSEAQVQLHQ--------GDIIVYYTDGFTDAANQKGERF---DE
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   --------------L-----------------------------------
gi|254416267|ref|ZP_05030021.1|   GIDPDFLTLTPQLTERVLSYLDER--------------RLLGVEILCSQP
gi|315637245|ref|ZP_07892464.1|   --NQEYGLIQTQALENL---------------------------------
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      --DKPM--PSVGLRRTVATYLNRR--------------RIIGTRVEVVGP
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ENLQ------NAFEWACQNYNSSQAILDYI-FEQ-------VQQFVGPG-
gi|148381088|ref|YP_001255629.1|  --------------------------------------------------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   -----------RVWDVFNN-AAEKSISFRV-NKDLAPQVAASQAFPNPAL
gi|254416267|ref|ZP_05030021.1|   DYVGVAVQTEVALDTAYNNPRAQQEILLKL-QTA-------LYRFLNPLT
gi|315637245|ref|ZP_07892464.1|   ----------------KENLKALRKIGEKITLSE-------INDFLRV--
gi|322807449|emb|CBZ05023.1|      --------------------------------------------------
gi|77165335|ref|YP_343860.1|      TYLEISVRTKVQAYVGANKAALQQ----NI-IET-------LNNFLHPLK
                                                                                    

gi|119486597|ref|ZP_01620647.1|   -------------------------------SHNIDDMTLVVMQV--QPS
gi|148381088|ref|YP_001255629.1|  -------------------MLISWLITNVPKEINIYNIENCTNKELINTI
gi|150390358|ref|YP_001320407.1|  -------------------MKLLFEIEGLVRDNKIYKLER----------
gi|229496468|ref|ZP_04390183.1|   LGSPI-------------TFEIFTNTPG---EEMSLTIELFDF----TGR
gi|254416267|ref|ZP_05030021.1|   GGSEGNGWSFGRPVYSSDIVTLLQSVPG---VQYLGAVQLFELRR--QGQ
gi|315637245|ref|ZP_07892464.1|   --------------------------GGV---KEV---------------
gi|322807449|emb|CBZ05023.1|      -------------------MLISWLITNVPKEINIYNIENCTNKELINTI
gi|77165335|ref|YP_343860.1|      GGSEGTGWPFGRDVYRTEIMQVIDELSG---VDHIFSLELTANKN--EPQ
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ----TE--------------------------------------------
gi|148381088|ref|YP_001255629.1|  KNVFEE--------RVNI-------------YNHDKPIK-----------
gi|150390358|ref|YP_001320407.1|  --------------------------------------------------
gi|229496468|ref|ZP_04390183.1|   ----C-VAKSPSFSLVSPSQGSIRIPWTPTTSYQTSPIRGLYIYRCTLSG
gi|254416267|ref|ZP_05030021.1|   ----N-WMRSSPLTLIDPGPLGLICSWH------SNRSR-----------
gi|315637245|ref|ZP_07892464.1|   -------VISNPTQNVEVLS-------H------EIGVC-----------
gi|322807449|emb|CBZ05023.1|      KNVFEE--------RVNI-------------YNHDKPIK-----------
gi|77165335|ref|YP_343860.1|      ----CGNVCLNPIMLVTAG-------------------------------
                                                                                    

gi|119486597|ref|ZP_01620647.1|   ----------------EICHDAS
gi|148381088|ref|YP_001255629.1|  --------------L-KHTYNKL
gi|150390358|ref|YP_001320407.1|  --------------L-AERLEDQ
gi|229496468|ref|ZP_04390183.1|   SNGKSATTMGKLLLEESSSGATK
gi|254416267|ref|ZP_05030021.1|   --------------SGHVINLIT
gi|315637245|ref|ZP_07892464.1|   --------------DEFDISIAY
gi|322807449|emb|CBZ05023.1|      --------------L-KHTYNKL
gi|77165335|ref|YP_343860.1|      ----------------PHEVEVI